HHsearch results for GI: 254780892 and protein with PDBid: 1a04_A

>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A
Probab=99.86  E-value=2.1e-20  Score=140.72  Aligned_cols=114  Identities=21%  Similarity=0.297  Sum_probs=102.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCH--HHHHHHHCCCCCCCEEE
Q ss_conf             79997399899999999999889--899999997999999971799948997078998773--89999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE--FIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~--l~~~ir~~~~~~~~pii   78 (133)
                      |||||||++.+|..++.+|+..+  ..|.+|.+|++|++.+.+. .||+|++|++||++.|  +++.++..  .+.+|++
T Consensus         7 rILIvdD~~~~~~~l~~~L~~~~~~~~v~~a~~~~~~l~~~~~~-~pdlvllD~~lp~~~G~~~~~~~~~~--~~~~~ii   83 (215)
T 1a04_A            7 TILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESL-DPDLILLDLNMPGMNGLETLDKLREK--SLSGRIV   83 (215)
T ss_dssp             EEEEECSCHHHHHHHHHHHTTCTTEEEEEEESSHHHHHHHHHHH-CCSEEEEETTSTTSCHHHHHHHHHHS--CCCSEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCC--CCCCCCC
T ss_conf             89999298999999999998589928999979999999999746-99689996888998986232101124--5665543


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      ++|++++.+...+|+++||++|+.||++.+++..++..+..
T Consensus        84 vlt~~~~~~~~~~a~~~Ga~~yl~K~~~~~~l~~~i~~~~~  124 (215)
T 1a04_A           84 VFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAA  124 (215)
T ss_dssp             EEECCCCHHHHHHHHHTTCSEEEETTCCHHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             44367999999999984998986025999999999999984