HHsearch results for GI: 254780892 and protein with PDBid: 1mvo_A

>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1
Probab=99.95  E-value=1.3e-27  Score=183.73  Aligned_cols=124  Identities=19%  Similarity=0.277  Sum_probs=111.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      -+||||||||+.+|..++.+|+.+||+|.+|.||.+|++.+.++ .||+||+|++|||+  +++++++|..  .+.+|||
T Consensus         3 ~~rILiVDDd~~~~~~l~~~L~~~g~~v~~a~~g~~al~~l~~~-~~dlvl~D~~mP~~~G~el~~~ir~~--~~~~~ii   79 (136)
T 1mvo_A            3 NKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETE-KPDLIVLDVMLPKLDGIEVCKQLRQQ--KLMFPIL   79 (136)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHH-CCSEEEEESSCSSSCHHHHHHHHHHT--TCCCCEE
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHHHHHHC--CCCCEEE
T ss_conf             88789998999999999999998899999989999999998845-99899826999999889999999854--9998599


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDEN  127 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~  127 (133)
                      ++|++++.+...+|+++||+||+.|||+.++|..++++++++.+.+..+
T Consensus        80 ~lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~~~~~~  128 (136)
T 1mvo_A           80 MLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRRSEIRAPS  128 (136)
T ss_dssp             EEECTTCCCCHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHTC------
T ss_pred             EEECCCCHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHHHHHHHCHH
T ss_conf             9978799999999998699627889899999999999999887764836