HHsearch results for GI: 254780892 and protein with PDBid: 1qkk_A

>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A
Probab=99.96  E-value=8.1e-28  Score=184.87  Aligned_cols=126  Identities=21%  Similarity=0.264  Sum_probs=113.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEE
Q ss_conf             77999739989999999999988989999999799999997179994899707899877--3899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~   79 (133)
                      -+||||||++.+|..++..|+..||+|..|.||.+|++.+.+ ..||+||+|++||++.  ++++++|+.  .+++|||+
T Consensus         4 P~ILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~l~~-~~~dliilD~~mP~~dGle~~~~ir~~--~~~~pvI~   80 (155)
T 1qkk_A            4 PSVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSA-DFAGIVISDIRMPGMDGLALFRKILAL--DPDLPMIL   80 (155)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESCHHHHHHTCCT-TCCSEEEEESCCSSSCHHHHHHHHHHH--CTTSCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEECCCCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             989999599999999999999879989997899999998532-698777654578999899999999972--98994898


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999999999999877
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL  130 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~l  130 (133)
                      +||+++.+...+|++.||+|||.|||+.++|..+++++++.++...+++.+
T Consensus        81 lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~~~~~~~~~e~~~l  131 (155)
T 1qkk_A           81 VTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEEKRRLVMENRSL  131 (155)
T ss_dssp             EECGGGHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             979899999999998699889759999999999999999999999999999