HHsearch results for GI: 254780892 and protein with PDBid: 1xhf_A

>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A
Probab=99.94  E-value=2.3e-25  Score=170.29  Aligned_cols=115  Identities=24%  Similarity=0.385  Sum_probs=105.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEEE
Q ss_conf             7999739989999999999988989999999799999997179994899707899877--38999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~l   80 (133)
                      +|||||||+.+|..++..|+.+||+|..|.||++|++.+.++ .||+||+|++|||+.  ++++++|.   .+.+|+|++
T Consensus         5 ~ILiVdDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~l~~~-~~dlii~D~~lP~~~g~e~~~~~~~---~~~~pii~l   80 (123)
T 1xhf_A            5 HILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEY-DINLVIMDINLPGKNGLLLARELRE---QANVALMFL   80 (123)
T ss_dssp             EEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHS-CCSEEEECSSCSSSCHHHHHHHHHH---HCCCEEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEEECCCCCCHHHHHHHHHHH---CCCCCEEEE
T ss_conf             999996999999999999998799999989999999999708-9999999689998449999999985---699978999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             63899899999997699889976989899999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      |+.++.+...+|+++||++|+.|||++++|..++++++++.
T Consensus        81 t~~~~~~~~~~a~~~Ga~d~l~KP~~~~~L~~~v~~~l~R~  121 (123)
T 1xhf_A           81 TGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSRT  121 (123)
T ss_dssp             ESCCSHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             93599999999998498888869899999999999998772