HHsearch results for GI: 254780892 and protein with PDBid: 1yio_A

>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A
Probab=99.92  E-value=2e-24  Score=164.69  Aligned_cols=117  Identities=24%  Similarity=0.320  Sum_probs=106.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEEE
Q ss_conf             7999739989999999999988989999999799999997179994899707899877--38999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~l   80 (133)
                      |||||||++.+|..++.+|+..||+|..|.+|.+|++.+.+ ..||+||+|++||++.  ++++++++.  .+.+|||++
T Consensus         6 ~ILIVDD~~~~r~~l~~~L~~~g~~V~~a~~~~eal~~~~~-~~pDlvllD~~mp~~~G~~~l~~i~~~--~~~~~iI~l   82 (208)
T 1yio_A            6 TVFVVDDDMSVREGLRNLLRSAGFEVETFDCASTFLEHRRP-EQHGCLVLDMRMPGMSGIELQEQLTAI--SDGIPIVFI   82 (208)
T ss_dssp             EEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHCCT-TSCEEEEEESCCSSSCHHHHHHHHHHT--TCCCCEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEEEECCCCCCCCHHHHHHHHHH--CCCCEEEEE
T ss_conf             79999499999999999999779989997999999998604-699989985788997657999998860--566517987


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             638998999999976998899769898999999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      |++++.+...+++++||++|+.||++.+++..+++++++...
T Consensus        83 t~~~~~~~~~~al~~Ga~~yl~Kp~~~~el~~~i~~~l~~~~  124 (208)
T 1yio_A           83 TAHGDIPMTVRAMKAGAIEFLPKPFEEQALLDAIEQGLQLNA  124 (208)
T ss_dssp             ESCTTSCCCHHHHHTTEEEEEESSCCHHHHHHHHHHHHHHHH
T ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             257999999999977999895389999999999999997401