HHsearch results for GI: 254780892 and protein with PDBid: 1zh2_A

>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A
Probab=99.96  E-value=8.5e-28  Score=184.74  Aligned_cols=117  Identities=26%  Similarity=0.392  Sum_probs=109.1

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |.||||||||+.+|+.++..|+.+||+|..|.||++|++.+.+. .||+|++|+.||++  +++++++|..   +++|||
T Consensus         1 M~~ILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~~~~~-~~dlil~D~~mp~~~G~~l~~~ir~~---~~ipiI   76 (121)
T 1zh2_A            1 MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATR-KPDLIILDLGLPDGDGIEFIRDLRQW---SAVPVI   76 (121)
T ss_dssp             -CEEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHH-CCSEEEEESEETTEEHHHHHHHHHTT---CCCCEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH---CCCEEE
T ss_conf             98499996999999999999998799999988899999999717-99999980999998979999999974---799099


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      ++|++++.+...+|+++||+||+.|||+.++|..+++++++++
T Consensus        77 ~lt~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~lrr~  119 (121)
T 1zh2_A           77 VLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRH  119 (121)
T ss_dssp             EEESCCSHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             9978599999999998699999979999999999999998875