HHsearch results for GI: 254780892 and protein with PDBid: 2gwr_A

>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A
Probab=99.91  E-value=8.8e-24  Score=160.81  Aligned_cols=116  Identities=19%  Similarity=0.287  Sum_probs=103.2

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCH--HHHHHHHCCCCCCCEE
Q ss_conf             97-79997399899999999999889899999997999999971799948997078998773--8999961434889739
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE--FIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~--l~~~ir~~~~~~~~pi   77 (133)
                      |+ |||||||++..+..++..|+..||+|..|.||.+|++.+.++ .||+||+|+.||++.+  ++.++|.   ....|+
T Consensus         4 Mk~kILiVeDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~~~~~-~~DliilD~~lp~~~g~~~~~~~r~---~~~~~i   79 (238)
T 2gwr_A            4 MRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVREL-RPDLVLLDLMLPGMNGIDVCRVLRA---DSGVPI   79 (238)
T ss_dssp             CCCEEEEECSCHHHHHHHHHHHHHTTCEEEEECCGGGHHHHHHHH-CCSEEEEESSCSSSCHHHHHHHHHT---TCCCCE
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCCCEEECCCC---CCCCCC
T ss_conf             687499993999999999999997799999989999999999837-9999999167766688712311223---566531


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             9996389989999999769988997698989999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      |++|+.++.+...+++++||+||+.|||+.++|..+++..+++
T Consensus        80 Iilt~~~~~~~~~~al~~Gaddyl~KP~~~~eL~ari~a~lrr  122 (238)
T 2gwr_A           80 VMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRR  122 (238)
T ss_dssp             EEEEETTCCSCHHHHHHTTCCEEEEESCCHHHHHHHHHHHCCC
T ss_pred             CCCCCCCCHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHCC
T ss_conf             1012589999999999779988021899999999999999632