HHsearch results for GI: 254780892 and protein with PDBid: 2qv0_A

>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae}
Probab=99.92  E-value=9.6e-24  Score=160.58  Aligned_cols=117  Identities=11%  Similarity=0.217  Sum_probs=101.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCC-E-EEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEE
Q ss_conf             799973998999999999998898-9-999999799999997179994899707899877--389999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGF-M-VFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~-~-v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii   78 (133)
                      |||||||++.+|+.++.+|+.+|+ . |.+|.||.+|++.+.++ .||+||+|++|||+.  ++++.+|+.  .+.+|+|
T Consensus        11 rvLIVDD~~~~r~~l~~~L~~~~~~~vv~~a~~g~eal~~l~~~-~~DlvilDi~mP~~dG~el~~~ir~~--~~~~~iI   87 (143)
T 2qv0_A           11 KVIIVEDEFLAQQELSWLINTHSQMEIVGSFDDGLDVLKFLQHN-KVDAIFLDINIPSLDGVLLAQNISQF--AHKPFIV   87 (143)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHHSCCEEEEEESCHHHHHHHHHHC-CCSEEEECSSCSSSCHHHHHHHHTTS--TTCCEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHHHHHHC--CCCCEEE
T ss_conf             89999499999999999998689927999979999999999866-99989987888889989999999954--9998089


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSK  124 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~  124 (133)
                      ++|++++  +..+|++.||.+||.||++.+.|..+++++.+..+.+
T Consensus        88 ~~t~~~e--~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~~~~~~~~  131 (143)
T 2qv0_A           88 FITAWKE--HAVEAFELEAFDYILKPYQESRIINMLQKLTTAWEQQ  131 (143)
T ss_dssp             EEESCCT--THHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHHHHC
T ss_pred             EEECCHH--HHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9977889--9999998599889979999999999999999999976