HHsearch results for GI: 254780892 and protein with PDBid: 2r25_B

>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B
Probab=99.94  E-value=1.3e-25  Score=171.71  Aligned_cols=118  Identities=21%  Similarity=0.172  Sum_probs=105.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCE-EEEECCHHHHHHHHHH----CCCCCEEEECCCCCCCC--HHHHHHHHCCCCCC
Q ss_conf             77999739989999999999988989-9999997999999971----79994899707899877--38999961434889
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEK----ELLPNYLVIDESMEGVL--EFIAHVRQMPLGTD   74 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~-v~~a~~g~eAl~~~~~----~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~   74 (133)
                      -||||||||+.+|+.++.+|+.+||+ |..|.||.+|++.+.+    +..||+|++|++||+|.  ++++.+|+... ..
T Consensus         3 irVLiVDD~~~~~~~l~~~L~~~g~~~v~~a~~g~eal~~l~~~~~~~~~~dlil~D~~MP~~dG~~~~~~ir~~~~-~~   81 (133)
T 2r25_B            3 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLG-YT   81 (133)
T ss_dssp             SCEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHHHHHHTCCCSEEEECSCCSSSCHHHHHHHHHHHSC-CC
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHCCC-CC
T ss_conf             88999969899999999999986994899989999999999874213689888997388899889999999986489-99


Q ss_pred             CEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             7399996389989999999769988997698989999999999999
Q gi|254780892|r   75 VFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        75 ~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|||++|++++.+...+++++|+++||.|||+.++|..+++++...
T Consensus        82 ~piI~lta~~~~~~~~~~~~~G~~~~l~KP~~~~~L~~~l~~~~~~  127 (133)
T 2r25_B           82 SPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAA  127 (133)
T ss_dssp             SCEEEEESCCSHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHCTT
T ss_pred             CCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             9289997469999999999869988997989999999999999999