HHsearch results for GI: 254780892 and protein with PDBid: 2vyc_A

>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent enzyme, lyase, cytoplasm, acid resistance; HET: LLP; 2.4A {Escherichia coli}
Probab=98.01  E-value=4.2e-05  Score=49.51  Aligned_cols=117  Identities=14%  Similarity=0.066  Sum_probs=82.1

Q ss_pred             EEEEECCCH-----HHHHH---HHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC------CHHHHHHHH
Q ss_conf             799973998-----99999---9999998898999999979999999717999489970789987------738999961
Q gi|254780892|r    3 SLLLVDSSH-----IVRKV---GRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV------LEFIAHVRQ   68 (133)
Q Consensus         3 ~ILiVDD~~-----~~r~~---l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~------~~l~~~ir~   68 (133)
                      +|||||++-     .....   +...++..||+|..+.+-++|+..+..+...+++++||.+++.      .+++..+|.
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~v~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (755)
T 2vyc_A            2 KVLIVESEFLHQDTWVGNAVERLADALSQQNVTVIKSTSFDDGFAILSSNEAIDCLMFSYQMEHPDEHQNVRQLIGKLHE   81 (755)
T ss_dssp             EEEEECCTTSTTSHHHHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHTTTCCCSEEEEECCCCSHHHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             69999155557674011689999999986791899848789999999758887689997068885321349999999997


Q ss_pred             CCCCCCCEEEEEECCC-CHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHHHHHHH
Q ss_conf             4348897399996389-9899999997699889976989-899999999999999
Q gi|254780892|r   69 MPLGTDVFVYYLLMEV-DFEKMIAGARAGANSFLLKPFN-RETLRFAMRELPQMQ  121 (133)
Q Consensus        69 ~~~~~~~pii~lT~~~-~~~~~~~a~~~Ga~~yl~KP~~-~~~L~~~i~~~~~~~  121 (133)
                      .  .+++||.+++... ..+..-.......+.|+..-=+ ++....++....+++
T Consensus        82 ~--~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~y  134 (755)
T 2vyc_A           82 R--QQNVPVFLLGDREKALAAMDRDLLELVDEFAWILEDTADFIAGRAVAAMTRY  134 (755)
T ss_dssp             H--STTCCEEEEECHHHHHHTCSHHHHHHCSEEEETTTSCHHHHHHHHHHHHHHH
T ss_pred             H--CCCCCEEEEECCCCCHHHCCHHHHHHHHEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             3--8899989995465303107898986413577615787899999999999999