HHsearch results for GI: 254780892 and protein with PDBid: 3a10_A

>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A*
Probab=99.94  E-value=2.9e-26  Score=175.59  Aligned_cols=113  Identities=20%  Similarity=0.294  Sum_probs=101.9

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |+|||||||++.+|+.++..|+.+||+|.+|.||++|++.+.++ .||+|++|++||++  .++++++|+.  .+++|||
T Consensus         1 M~rILiVDDd~~~~~~l~~~L~~~g~~v~~a~~g~~al~~~~~~-~~dlvilD~~mP~~~G~e~~~~ir~~--~~~~pii   77 (116)
T 3a10_A            1 MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSG-NYDLVILDIEMPGISGLEVAGEIRKK--KKDAKII   77 (116)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHS-CCSEEEECSCCSSSCHHHHHHHHHHH--CTTCCEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHC--CCCCCEE
T ss_conf             98899992999999999999998799999989999999999847-99989983688999999999999843--9989799


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
                      ++|++++.+  .++...||++|+.|||+.++|..++++++
T Consensus        78 ~lt~~~~~~--~~~~~~Ga~~~l~KP~~~~~L~~~v~~~L  115 (116)
T 3a10_A           78 LLTAYSHYR--SDMSSWAADEYVVKSFNFDELKEKVKKLL  115 (116)
T ss_dssp             EEESCGGGG--GCGGGGGSSEEEECCSSTHHHHHHHHHHT
T ss_pred             EEECCCCHH--HHHHHCCCCEEEECCCCHHHHHHHHHHHC
T ss_conf             998978999--99982699889989899999999999974