HHsearch results for GI: 254780892 and protein with PDBid: 3eod_A

>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12}
Probab=99.94  E-value=8.7e-26  Score=172.74  Aligned_cols=116  Identities=21%  Similarity=0.341  Sum_probs=106.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +|||||||++.+|..++..|+.+||+|.+|.||.+|++.+.+ ..||+|++|++||++  .++++++|+.  .+++|||+
T Consensus         8 ~kILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~~Al~~l~~-~~~dlvi~D~~mP~~dG~~~~~~ir~~--~~~~piI~   84 (130)
T 3eod_A            8 KQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGG-FTPDLMICDIAMPRMNGLKLLEHIRNR--GDQTPVLV   84 (130)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESCHHHHHHHHTT-CCCSEEEECCC-----CHHHHHHHHHT--TCCCCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEHHHHCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             989999698999999999999889999998999999999852-898874574217999899999999960--98998999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989-89999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRELPQM  120 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~-~~~L~~~i~~~~~~  120 (133)
                      +|++++.+...+|+++||++|+.|||. .+.|...+++++..
T Consensus        85 lt~~~~~~~~~~a~~~Ga~~~l~KP~~~~~~L~~~i~~~L~~  126 (130)
T 3eod_A           85 ISATENMADIAKALRLGVEDVLLKPVKDLNRLREMVFACLYP  126 (130)
T ss_dssp             EECCCCHHHHHHHHHHCCSEEEESCC---CHHHHHHHHHHC-
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             989999999999998699889979999799999999998517