HHsearch results for GI: 254780892 and protein with PDBid: 3ezx_A

>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri}
Probab=95.08  E-value=0.025  Score=32.95  Aligned_cols=92  Identities=12%  Similarity=0.072  Sum_probs=60.7

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEE--CC-HHHHHHHHHHCCCCCEEEE--CCC----CCCCCHHHHHHHHCCCCCCCEEEE
Q ss_conf             99899999999999889899999--99-7999999971799948997--078----998773899996143488973999
Q gi|254780892|r    9 SSHIVRKVGRHLFNDFGFMVFEA--TS-VCEAREFCEKELLPNYLVI--DES----MEGVLEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         9 D~~~~r~~l~~~L~~~g~~v~~a--~~-g~eAl~~~~~~~~pdlii~--D~~----mP~~~~l~~~ir~~~~~~~~pii~   79 (133)
                      -...-..++..+|+..||+|.-.  .. .++-++.+.+ ..||+|.+  ...    +|++-++...+|+....+++||++
T Consensus       104 ~H~lG~~~va~~l~~~G~~V~~LG~~~p~e~~~~~~~~-~~~d~v~ls~S~~~~~~~~~~~~~i~~lr~~~~~~~v~v~v  182 (215)
T 3ezx_A          104 IHDIGHRLVTTMLGANGFQIVDLGVDVLNENVVEEAAK-HKGEKVLLVGSALMTTSMLGQKDLMDRLNEEKLRDSVKCMF  182 (215)
T ss_dssp             CCCHHHHHHHHHHHHTSCEEEECCSSCCHHHHHHHHHH-TTTSCEEEEEECSSHHHHTHHHHHHHHHHHTTCGGGSEEEE
T ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHH-CCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             88899999999999779969988899999999999997-39981489985665433699999999999808889995998


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             9638998999999976998899769
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKP  104 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP  104 (133)
                       -|..-.+  .-+-..||+.|-.-+
T Consensus       183 -GGa~~~~--~~a~~~GAD~~a~da  204 (215)
T 3ezx_A          183 -GGAPVSD--KWIEEIGADATAENA  204 (215)
T ss_dssp             -ESSSCCH--HHHHHHTCCBCCSSH
T ss_pred             -ECCCCCH--HHHHHHCCCEECCCH
T ss_conf             -8902799--999983988783899