HHsearch results for GI: 254780892 and protein with PDBid: 3h5i_A

>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901}
Probab=99.95  E-value=4.6e-28  Score=186.32  Aligned_cols=121  Identities=15%  Similarity=0.200  Sum_probs=109.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCC-C--CHHHHHHHHCCCCCCCEEE
Q ss_conf             779997399899999999999889899999997999999971799948997078998-7--7389999614348897399
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-V--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~-~--~~l~~~ir~~~~~~~~pii   78 (133)
                      +||||||||+.+|..++.+|+.+||+|.+|.||.+|++.+.++..||+|++|+.||+ +  +++++++|+   .+++|||
T Consensus         6 ~rILiVDD~~~~~~~l~~~L~~~g~~v~~a~~g~eAl~~l~~~~~~dlillD~~mp~g~dG~e~~~~ir~---~~~~PvI   82 (140)
T 3h5i_A            6 KKILIVEDSKFQAKTIANILNKYGYTVEIALTGEAAVEKVSGGWYPDLILMDIELGEGMDGVQTALAIQQ---ISELPVV   82 (140)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHTTCCCSEEEEESSCSSSCCHHHHHHHHHH---HCCCCEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHH---CCCCCEE
T ss_conf             9999995989999999999998799999989899999999846999899972665335789999999985---6999899


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      ++|++++.+...++++.|+++|+.|||++++|..++++++++++...
T Consensus        83 ~lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~~~~  129 (140)
T 3h5i_A           83 FLTAHTEPAVVEKIRSVTAYGYVMKSATEQVLITIVEMALRLYEANV  129 (140)
T ss_dssp             EEESSSSCCCCGGGGGSCEEEEEETTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99899999999999987999899898999999999999999988789