HHsearch results for GI: 254780892 and protein with PDBid: 3jte_A

>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405}
Probab=99.96  E-value=2.9e-28  Score=187.54  Aligned_cols=128  Identities=19%  Similarity=0.263  Sum_probs=116.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEE
Q ss_conf             97799973998999999999998898999999979999999717-9994899707899877--38999961434889739
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE-LLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~-~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pi   77 (133)
                      |.|||||||++.+|..++.+|+..||+|.+|.||.+|++.+.+. ..||+|++|+.||++.  ++++++++.  .+.+||
T Consensus         3 m~rILIVDDd~~~~~~l~~~L~~~g~~v~~a~~~~eal~~~~~~~~~~dlvilD~~mp~~~G~~l~~~~~~~--~~~~pv   80 (143)
T 3jte_A            3 LAKILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENCNSIDVVITDMKMPKLSGMDILREIKKI--TPHMAV   80 (143)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHTTTTCCEEEEESCCSSSCHHHHHHHHHHH--CTTCEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHH--CCCCCE
T ss_conf             988999969999999999999987999999788999999998459997399974777777889999999987--899969


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99963899899999997699889976989899999999999999999999877
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL  130 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~l  130 (133)
                      |++|++++.+...+|+++||+|||.|||+.++|..++++++++++...+++.+
T Consensus        81 I~lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~l~~e~~~l  133 (143)
T 3jte_A           81 IILTGHGDLDNAILAMKEGAFEYLRKPVTAQDLSIAINNAINRKKLLMENERM  133 (143)
T ss_dssp             EEEECTTCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHHHHHC-----
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99988899999999998699899828999999999999999999999999999