HHsearch results for GI: 254780892 and protein with PDBid: 3kht_A

>3kht_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Hahella chejuensis kctc 2396}
Probab=99.94  E-value=1e-25  Score=172.37  Aligned_cols=119  Identities=13%  Similarity=0.061  Sum_probs=108.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEE
Q ss_conf             779997399899999999999889--8999999979999999717999489970789987--738999961434889739
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pi   77 (133)
                      +||||||||+.++..++++|+.+|  +++..|.||.+|++.+.+ ..||+|++|++||++  +++++++|+.+..+.+||
T Consensus         6 krILlVdD~~~~~~~l~~~L~~~g~~~~v~~a~~g~~Al~~l~~-~~~dliilD~~mP~~~G~el~~~ir~~~~~~~iPi   84 (144)
T 3kht_A            6 KRVLVVEDNPDDIALIRRVLDRKDIHCQLEFVDNGAKALYQVQQ-AKYDLIILDIGLPIANGFEVMSAVRKPGANQHTPI   84 (144)
T ss_dssp             EEEEEECCCHHHHHHHHHHHHHTTCCEEEEEESSHHHHHHHHTT-CCCSEEEECTTCGGGCHHHHHHHHHSSSTTTTCCE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHH-CCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCCE
T ss_conf             98999958999999999999968998299998999999999971-79999998699999999999999983787899918


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHHHHHHH
Q ss_conf             99963899899999997699889976989-899999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRELPQMQ  121 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~-~~~L~~~i~~~~~~~  121 (133)
                      |++|+.++.+...+|+++||++|+.||++ .++|..+++.++++.
T Consensus        85 I~lS~~~~~~~~~~a~~~Ga~~~l~KP~~~~~eL~~~i~~~l~~~  129 (144)
T 3kht_A           85 VILTDNVSDDRAKQCMAAGASSVVDKSSNNVTDFYGRIYAIFSYW  129 (144)
T ss_dssp             EEEETTCCHHHHHHHHHTTCSEEEECCTTSHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             999888999999999986999999699999999999999999986