HHsearch results for GI: 254780892 and protein with PDBid: 3lua_A

>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum}
Probab=99.95  E-value=1.9e-27  Score=182.67  Aligned_cols=124  Identities=15%  Similarity=0.208  Sum_probs=113.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCC---CCHHHHHHHHCCCCCCCEE
Q ss_conf             779997399899999999999889-899999997999999971799948997078998---7738999961434889739
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFG-FMVFEATSVCEAREFCEKELLPNYLVIDESMEG---VLEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g-~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~---~~~l~~~ir~~~~~~~~pi   77 (133)
                      .+|||||||+.+|+.++.+|+.+| |+|.+|.||++|++.+.+...||+||+|+.||+   |.++++.+|+.+..+++||
T Consensus         5 ~~ILiVDD~~~~r~~l~~~L~~~G~~~v~~a~~g~eal~~l~~~~~~dlii~D~~mP~~~~g~~l~~~ir~~~~~~~~pi   84 (140)
T 3lua_A            5 GTVLLIDYFEYEREKTKIIFDNIGEYDFIEVENLKKFYSIFKDLDSITLIIMDIAFPVEKEGLEVLSAIRNNSRTANTPV   84 (140)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHHCCCEEEEECSHHHHHTTTTTCCCCSEEEECSCSSSHHHHHHHHHHHHHSGGGTTCCE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCE
T ss_conf             97999949999999999999867990899989999999999738998599986899999988899998764424689988


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             999638998999999976998899769898999999999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      |++|++++.+...++++.|+++|+.|||++++|..++++++++.+...
T Consensus        85 I~lT~~~~~~~~~~~~~~G~~d~l~KP~~~~~L~~~i~~~L~~~~~~r  132 (140)
T 3lua_A           85 IIATKSDNPGYRHAALKFKVSDYILKPYPTKRLENSVRSVLKICQRFR  132 (140)
T ss_dssp             EEEESCCCHHHHHHHHHSCCSEEEESSCCTTHHHHHHHHHHCC-----
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             998279999999999986998999898999999999999999889985