HHsearch results for GI: 254780892 and protein with PDBid: 3luf_A

>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A*
Probab=99.97  E-value=1.7e-29  Score=194.79  Aligned_cols=124  Identities=19%  Similarity=0.176  Sum_probs=114.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .+|||||||+.+|..++.+|+..||+|..|.||.+|++.+.++..||+||+|++||+|  +++++.+|+.+.++++|||+
T Consensus       125 ~~VLvVDD~~~~~~~i~~~L~~~g~~v~~a~~g~eal~~l~~~~~~DlIllD~~MP~~dG~e~~~~iR~~~~~~~iPII~  204 (259)
T 3luf_A          125 IEVLVVDDSRTSRHRTMAQLRKQLLQVHEASHAREALATLEQHPAIRLVLVDYYMPEIDGISLVRMLRERYSKQQLAIIG  204 (259)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHCTTEEEEEECSCCSSSCHHHHHHHHHHHCCTTTSEEEE
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             25787538889999999999834662453240568999984489965999647776754899999998378899994999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      +|+.+..+...+|+++||+|||.|||+.++|..+|++.+++.+...
T Consensus       205 lTa~~~~~~~~~~~~~Ga~d~l~KP~~~~eL~~~i~~~L~~~~~~~  250 (259)
T 3luf_A          205 ISVSDKRGLSARYLKQGANDFLNQPFEPEELQCRVSHNLEALEQFN  250 (259)
T ss_dssp             EECSSSSSHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHHHC--
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9899998999999987999999898999999999999999999996