Query         gi|254780892|ref|YP_003065305.1| probable two-component response regulator protein [Candidatus Liberibacter asiaticus str. psy62]
Match_columns 133
No_of_seqs    112 out of 20103
Neff          7.8 
Searched_HMMs 23785
Date          Tue May 31 23:42:38 2011
Command       /home/congqian_1/programs/hhpred/hhsearch -i 254780892.hhm -d /home/congqian_1/database/pdb/pdb70.hhm 

 No Hit                             Prob E-value P-value  Score    SS Cols Query HMM  Template HMM
  1 1w25_A Stalked-cell differenti 100.0 1.2E-29   5E-34  195.8  18.2  127    2-129     2-130 (459)
  2 3luf_A Two-component system re 100.0 1.7E-29 7.3E-34  194.8  15.7  124    2-125   125-250 (259)
  3 3gt7_A Sensor protein; structu 100.0 3.9E-29 1.6E-33  192.7  14.6  119    3-122     9-129 (154)
  4 3jte_A Response regulator rece 100.0 2.9E-28 1.2E-32  187.5  18.3  128    1-130     3-133 (143)
  5 3crn_A Response regulator rece 100.0 5.1E-28 2.2E-32  186.0  18.7  123    1-126     3-127 (132)
  6 2a9o_A Response regulator; ess 100.0 1.6E-28 6.6E-33  189.1  15.5  120    1-122     1-120 (120)
  7 3c3m_A Response regulator rece 100.0 1.2E-28   5E-33  189.8  14.3  125    1-126     3-129 (138)
  8 3gl9_A Response regulator; bet 100.0 7.9E-28 3.3E-32  184.9  17.6  117    2-119     3-121 (122)
  9 1qkk_A DCTD, C4-dicarboxylate  100.0 8.1E-28 3.4E-32  184.9  16.9  126    2-130     4-131 (155)
 10 1s8n_A Putative antiterminator 100.0 7.3E-28 3.1E-32  185.1  15.8  120    2-125    14-136 (205)
 11 1zh2_A KDP operon transcriptio 100.0 8.5E-28 3.6E-32  184.7  15.7  117    1-121     1-119 (121)
 12 3cnb_A DNA-binding response re 100.0 1.4E-27   6E-32  183.4  16.3  123    3-126    10-136 (143)
 13 3cg4_A Response regulator rece 100.0 1.7E-28 7.1E-33  188.9  11.4  126    2-128     8-135 (142)
 14 2zay_A Response regulator rece 100.0 9.7E-28 4.1E-32  184.4  15.1  120    2-122     9-130 (147)
 15 1mvo_A PHOP response regulator 100.0 1.3E-27 5.3E-32  183.7  14.4  124    1-127     3-128 (136)
 16 3h5i_A Response regulator/sens 100.0 4.6E-28 1.9E-32  186.3  12.0  121    2-125     6-129 (140)
 17 2ayx_A Sensor kinase protein R 100.0 1.9E-27 7.8E-32  182.7  15.1  118    2-122   130-249 (254)
 18 3nhm_A Response regulator; pro 100.0 1.7E-27 7.2E-32  182.9  14.6  121    1-124     3-126 (133)
 19 2pl1_A Transcriptional regulat 100.0 8.5E-27 3.6E-31  178.8  18.1  116    3-121     2-119 (121)
 20 3hdv_A Response regulator; PSI 100.0 5.1E-27 2.1E-31  180.1  16.2  121    2-123     8-130 (136)
 21 3cfy_A Putative LUXO repressor 100.0 6.3E-27 2.6E-31  179.6  16.5  122    1-125     3-127 (137)
 22 1k66_A Phytochrome response re 100.0 7.7E-27 3.2E-31  179.0  16.8  120    2-121     7-139 (149)
 23 2qzj_A Two-component response  100.0 5.1E-27 2.1E-31  180.1  15.9  123    2-128     5-129 (136)
 24 1k68_A Phytochrome response re 100.0   1E-26 4.3E-31  178.3  17.2  119    2-120     3-131 (140)
 25 3hv2_A Response regulator/HD d  99.9 8.4E-27 3.5E-31  178.8  16.2  125    3-130    16-143 (153)
 26 3lua_A Response regulator rece  99.9 1.9E-27 7.9E-32  182.7  12.4  124    2-125     5-132 (140)
 27 2qr3_A Two-component system re  99.9 2.3E-27 9.9E-32  182.1  12.9  123    1-126     3-132 (140)
 28 1jbe_A Chemotaxis protein CHEY  99.9 1.4E-26   6E-31  177.4  16.9  118    3-121     6-126 (128)
 29 3kcn_A Adenylate cyclase homol  99.9 2.2E-26 9.4E-31  176.3  17.8  125    2-129     5-132 (151)
 30 3h1g_A Chemotaxis protein CHEY  99.9 1.2E-26 5.2E-31  177.8  16.5  118    3-120     7-127 (129)
 31 1srr_A SPO0F, sporulation resp  99.9 4.9E-27   2E-31  180.2  14.1  118    2-122     4-123 (124)
 32 1mb3_A Cell division response   99.9 2.4E-27   1E-31  182.0  12.4  119    2-121     2-122 (124)
 33 2rjn_A Response regulator rece  99.9 1.6E-26 6.9E-31  177.1  16.7  126    2-130     8-136 (154)
 34 1i3c_A Response regulator RCP1  99.9 2.6E-26 1.1E-30  175.9  17.6  119    2-120     9-137 (149)
 35 2jk1_A HUPR, hydrogenase trans  99.9 2.1E-26   9E-31  176.4  16.8  126    2-131     2-130 (139)
 36 2qxy_A Response regulator; reg  99.9 1.2E-26 4.9E-31  178.0  14.8  117    2-122     5-123 (142)
 37 3bre_A Probable two-component   99.9 1.3E-26 5.6E-31  177.6  15.0  117    3-120    20-139 (358)
 38 3f6p_A Transcriptional regulat  99.9 1.8E-26 7.6E-31  176.8  15.5  115    2-120     3-119 (120)
 39 3heb_A Response regulator rece  99.9 4.6E-26 1.9E-30  174.4  17.2  118    2-119     5-134 (152)
 40 2jba_A Phosphate regulon trans  99.9 2.7E-27 1.2E-31  181.7  10.7  118    2-120     3-122 (127)
 41 1tmy_A CHEY protein, TMY; chem  99.9 2.4E-26   1E-30  176.1  15.3  114    2-118     3-119 (120)
 42 1zgz_A Torcad operon transcrip  99.9 6.9E-26 2.9E-30  173.4  17.6  116    2-121     3-120 (122)
 43 1dbw_A Transcriptional regulat  99.9 2.8E-26 1.2E-30  175.7  15.2  117    1-120     1-121 (126)
 44 3eq2_A Probable two-component   99.9 4.1E-26 1.7E-30  174.7  15.3  124    2-128     6-132 (394)
 45 3grc_A Sensor protein, kinase;  99.9   2E-26 8.2E-31  176.6  13.4  123    2-125     7-132 (140)
 46 3hdg_A Uncharacterized protein  99.9 3.6E-26 1.5E-30  175.0  14.4  118    3-123     9-128 (137)
 47 3kht_A Response regulator; PSI  99.9   1E-25 4.2E-30  172.4  16.6  119    2-121     6-129 (144)
 48 3lte_A Response regulator; str  99.9 6.7E-26 2.8E-30  173.4  15.6  118    2-121     7-126 (132)
 49 3dzd_A Transcriptional regulat  99.9 8.1E-26 3.4E-30  172.9  15.8  118    2-122     1-120 (368)
 50 2r25_B Osmosensing histidine p  99.9 1.3E-25 5.5E-30  171.7  16.8  118    2-120     3-127 (133)
 51 3m6m_D Sensory/regulatory prot  99.9 8.5E-26 3.6E-30  172.8  15.9  119    3-122    16-138 (143)
 52 3b2n_A Uncharacterized protein  99.9 8.2E-26 3.5E-30  172.9  15.5  119    1-122     3-125 (133)
 53 3eod_A Protein HNR; response r  99.9 8.7E-26 3.7E-30  172.7  15.1  116    2-120     8-126 (130)
 54 1ny5_A Transcriptional regulat  99.9 4.2E-25 1.8E-29  168.7  18.4  125    3-130     2-128 (387)
 55 2qvg_A Two component response   99.9 1.2E-25 5.1E-30  171.9  15.5  117    3-119     9-134 (143)
 56 3a10_A Response regulator; pho  99.9 2.9E-26 1.2E-30  175.6  12.1  113    1-118     1-115 (116)
 57 1dcf_A ETR1 protein; beta-alph  99.9   2E-25 8.4E-30  170.6  16.3  117    2-120     8-129 (136)
 58 1xhf_A DYE resistance, aerobic  99.9 2.3E-25 9.5E-30  170.3  16.5  115    3-121     5-121 (123)
 59 2gkg_A Response regulator homo  99.9   9E-26 3.8E-30  172.7  14.0  116    2-119     6-124 (127)
 60 3i42_A Response regulator rece  99.9 9.1E-26 3.8E-30  172.6  14.0  119    1-121     3-123 (127)
 61 3hzh_A Chemotaxis response reg  99.9   1E-25 4.3E-30  172.4  14.1  115    3-119    38-156 (157)
 62 3cg0_A Response regulator rece  99.9 1.6E-25 6.9E-30  171.1  15.0  120    1-124     9-132 (140)
 63 3cu5_A Two component transcrip  99.9 2.5E-26   1E-30  176.0  10.7  118    1-121     1-124 (141)
 64 1p6q_A CHEY2; chemotaxis, sign  99.9 1.1E-25 4.6E-30  172.2  13.5  117    3-120     8-127 (129)
 65 2qsj_A DNA-binding response re  99.9 2.8E-25 1.2E-29  169.7  12.1  118    1-120     3-124 (154)
 66 3n0r_A Response regulator; sig  99.9 8.8E-26 3.7E-30  172.7   9.1  116    2-123   161-280 (286)
 67 1yio_A Response regulatory pro  99.9   2E-24 8.2E-29  164.7  14.3  117    3-122     6-124 (208)
 68 3kto_A Response regulator rece  99.9 1.3E-24 5.4E-29  165.8  11.9  119    3-122     8-128 (136)
 69 2qv0_A Protein MRKE; structura  99.9 9.6E-24   4E-28  160.6  15.9  117    3-124    11-131 (143)
 70 1dz3_A Stage 0 sporulation pro  99.9 5.5E-24 2.3E-28  162.0  14.5  117    3-121     4-124 (130)
 71 1ys7_A Transcriptional regulat  99.9 3.6E-24 1.5E-28  163.1  13.5  118    2-122     8-127 (233)
 72 1kgs_A DRRD, DNA binding respo  99.9 1.4E-23 5.9E-28  159.6  15.9  118    1-121     1-121 (225)
 73 3f6c_A Positive transcription   99.9 3.4E-24 1.5E-28  163.2  12.4  115    3-120     3-120 (134)
 74 3ilh_A Two component response   99.9 2.3E-23 9.7E-28  158.3  16.3  121    1-121     9-140 (146)
 75 2b4a_A BH3024; 10175646, struc  99.9 2.3E-24 9.8E-29  164.3  10.7  112    2-118    16-129 (138)
 76 2rdm_A Response regulator rece  99.9 6.7E-24 2.8E-28  161.5  12.5  118    2-123     6-126 (132)
 77 3cz5_A Two-component response   99.9 1.9E-23 8.1E-28  158.8  14.4  116    2-120     6-125 (153)
 78 2oqr_A Sensory transduction pr  99.9   6E-24 2.5E-28  161.8  11.8  116    2-121     5-122 (230)
 79 2gwr_A DNA-binding response re  99.9 8.8E-24 3.7E-28  160.8  12.2  116    1-120     4-122 (238)
 80 1dc7_A NTRC, nitrogen regulati  99.9 3.1E-26 1.3E-30  175.4  -0.4  119    1-122     1-123 (124)
 81 3c97_A Signal transduction his  99.9 4.8E-24   2E-28  162.4  10.5  115    2-120    11-130 (140)
 82 3eul_A Possible nitrate/nitrit  99.9   8E-23 3.4E-27  155.1  16.7  118    3-123    17-138 (152)
 83 3kyj_B CHEY6 protein, putative  99.9 6.6E-24 2.8E-28  161.5  10.0  105    2-107    14-122 (145)
 84 3eqz_A Response regulator; str  99.9 2.7E-24 1.1E-28  163.9   7.8  116    1-120     3-125 (135)
 85 2pln_A HP1043, response regula  99.9 7.2E-23   3E-27  155.4  14.9  112    3-121    20-134 (137)
 86 1p2f_A Response regulator; DRR  99.9 9.1E-23 3.8E-27  154.8  14.9  115    1-121     2-118 (220)
 87 2j48_A Two-component sensor ki  99.9 1.5E-23 6.5E-28  159.4  10.9  113    2-118     2-116 (119)
 88 1qo0_D AMIR; binding protein,   99.9 2.1E-22 8.8E-27  152.6  12.8  113    2-120    13-125 (196)
 89 1a04_A Nitrate/nitrite respons  99.9 2.1E-20 8.7E-25  140.7  16.1  114    3-119     7-124 (215)
 90 1a2o_A CHEB methylesterase; ba  99.8 9.1E-21 3.8E-25  142.9  11.1  103    1-107     1-111 (349)
 91 2hqr_A Putative transcriptiona  99.8 2.5E-20 1.1E-24  140.2  13.3  110    1-118     1-113 (223)
 92 3c3w_A Two component transcrip  99.7 2.5E-18 1.1E-22  128.3   8.3  117    1-120     1-121 (225)
 93 3cwo_X Beta/alpha-barrel prote  99.7   2E-17 8.5E-22  122.9   5.2   80   28-110     8-89  (237)
 94 3luf_A Two-component system re  99.6 7.8E-16 3.3E-20  113.4  10.1  106    2-112     5-112 (259)
 95 3klo_A Transcriptional regulat  99.5 9.1E-15 3.8E-19  107.1   5.0  116    2-119     8-128 (225)
 96 1w25_A Stalked-cell differenti  98.8 4.3E-07 1.8E-11   61.3  16.5  119    2-123   153-273 (459)
 97 2vyc_A Biodegradative arginine  98.0 4.2E-05 1.8E-09   49.5   9.5  117    3-121     2-134 (755)
 98 2yxb_A Coenzyme B12-dependent   97.5  0.0037 1.5E-07   37.9  13.2  118    8-128    29-153 (161)
 99 1ccw_A Protein (glutamate muta  95.9    0.09 3.8E-06   29.7  13.5  114    3-118     5-134 (137)
100 2i2x_B MTAC, methyltransferase  95.3   0.098 4.1E-06   29.4   8.3  100    9-114   135-241 (258)
101 3ezx_A MMCP 1, monomethylamine  95.1   0.025 1.1E-06   33.0   4.7   92    9-104   104-204 (215)
102 1y80_A Predicted cobalamin bin  95.0    0.06 2.5E-06   30.7   6.5   90   11-104   102-198 (210)
103 2ayx_A Sensor kinase protein R  94.7   0.055 2.3E-06   30.9   5.5   50    2-59     12-61  (254)
104 1xrs_B D-lysine 5,6-aminomutas  91.2     0.6 2.5E-05   24.7   6.6  110    8-121   131-259 (262)
105 2xij_A Methylmalonyl-COA mutas  89.1     1.1 4.8E-05   23.1  12.8  114    3-119   606-734 (762)
106 1qdl_B Protein (anthranilate s  87.2    0.46 1.9E-05   25.4   3.5   91    1-98      1-97  (195)
107 3fkq_A NTRC-like two-domain pr  85.1     1.9 8.1E-05   21.7  14.0  103    1-118    20-126 (373)
108 1xm3_A Thiazole biosynthesis p  83.3     2.3 9.7E-05   21.2   8.1  101   17-123   118-232 (264)
109 2w6r_A Imidazole glycerol phos  81.7     2.7 0.00011   20.9   7.9   70   34-106   158-233 (266)
110 2ift_A Putative methylase HI07  80.9     2.8 0.00012   20.8   5.3   25   31-56     62-86  (201)
111 1ka9_F Imidazole glycerol phos  80.6     2.9 0.00012   20.6   6.9   66   34-102   154-224 (252)
112 2v5j_A 2,4-dihydroxyhept-2-ENE  78.9     3.3 0.00014   20.3   9.2  100   14-115    27-131 (287)
113 1thf_D HISF protein; thermophI  76.5     3.9 0.00016   19.9   8.4   66   34-102   153-223 (253)
114 2bas_A YKUI protein; EAL domai  75.4     4.2 0.00018   19.7   7.5  107   10-118   155-278 (431)
115 3c2e_A Nicotinate-nucleotide p  74.2     3.6 0.00015   20.1   4.3   73   28-102   203-276 (294)
116 2r6o_A Putative diguanylate cy  74.0     4.5 0.00019   19.5   6.7  105    9-116   161-278 (294)
117 3l9w_A Glutathione-regulated p  70.9     5.4 0.00023   19.1   7.6   92    3-103    29-122 (413)
118 2fhp_A Methylase, putative; al  69.6     5.7 0.00024   18.9   7.1   68    2-69     68-141 (187)
119 1req_A Methylmalonyl-COA mutas  68.9     5.9 0.00025   18.8  13.4   96    8-106   607-709 (727)
120 1ep3_A Dihydroorotate dehydrog  66.0     6.8 0.00028   18.5   4.3   57   62-121   232-294 (311)
121 1mxs_A KDPG aldolase; 2-keto-3  64.3     7.3 0.00031   18.3   7.3   95   14-113    16-115 (225)
122 1h5y_A HISF; histidine biosynt  63.4     7.6 0.00032   18.2   9.0   67   34-103   156-227 (253)
123 3igs_A N-acetylmannosamine-6-p  62.5     7.9 0.00033   18.1  11.7  100   14-119   118-228 (232)
124 2v82_A 2-dehydro-3-deoxy-6-pho  62.0     8.1 0.00034   18.0   8.9   28   73-101   147-174 (212)
125 2htm_A Thiazole biosynthesis p  60.7     8.5 0.00036   17.9   9.8  105   17-123   116-232 (268)
126 1x42_A Hypothetical protein PH  59.1     9.1 0.00038   17.7   4.0   56   56-117   102-168 (232)
127 3c3p_A Methyltransferase; NP_9  58.1     3.7 0.00015   20.0   1.7   62    3-67     83-147 (210)
128 3dr5_A Putative O-methyltransf  58.0     9.5  0.0004   17.6   5.2   63    3-66     83-149 (221)
129 2g5c_A Prephenate dehydrogenas  56.9     9.9 0.00042   17.5   8.6   67    1-68      1-84  (281)
130 2a9v_A GMP synthase; NP_394403  56.7       2 8.4E-05   21.6   0.2   76    1-80     13-91  (212)
131 1dxe_A 2-dehydro-3-deoxy-galac  56.2      10 0.00043   17.4  11.1   97   17-115    10-111 (256)
132 2gpy_A O-methyltransferase; st  55.3      11 0.00044   17.3   5.6   66    3-68     80-148 (233)
133 1a53_A IGPS, indole-3-glycerol  54.0      11 0.00047   17.2  11.7   90   11-103   138-232 (247)
134 1o4u_A Type II quinolic acid p  52.7      12 0.00049   17.1   3.9   68   28-100   197-265 (285)
135 2c20_A UDP-glucose 4-epimerase  52.2      12  0.0005   17.0   4.7   32    1-32      1-32  (330)
136 1geq_A Tryptophan synthase alp  52.1      12  0.0005   17.0   8.2  101    3-104   111-221 (248)
137 1i1q_B Anthranilate synthase c  51.9      12  0.0005   17.0   5.6   89    3-98      2-96  (192)
138 1y0e_A Putative N-acetylmannos  51.8      12  0.0005   17.0   4.5   74   28-103   123-204 (223)
139 1n8p_A Cystathionine gamma-lya  51.5      12 0.00051   17.0   4.8   88   12-101   105-198 (393)
140 3ggo_A Prephenate dehydrogenas  51.4      12 0.00051   16.9   9.8   68    1-69     33-117 (314)
141 3gx8_A Monothiol glutaredoxin-  50.8      12 0.00052   16.9   5.5   85   10-96      2-98  (121)
142 3gjy_A Spermidine synthase; AP  50.3      13 0.00053   16.8   6.4   84    2-87    114-207 (317)
143 2pv7_A T-protein [includes: ch  49.7      13 0.00054   16.8   9.1   65    1-67     21-86  (298)
144 1yxy_A Putative N-acetylmannos  49.6      13 0.00055   16.8   5.8   87   14-103   121-215 (234)
145 3l6e_A Oxidoreductase, short-c  49.3      13 0.00055   16.7   5.7   80    1-82      3-85  (235)
146 1id1_A Putative potassium chan  49.1      13 0.00056   16.7   8.2   92    3-101    28-123 (153)
147 1orr_A CDP-tyvelose-2-epimeras  48.6      13 0.00057   16.7   7.5   32    1-32      1-32  (347)
148 1t2a_A GDP-mannose 4,6 dehydra  48.6      13 0.00057   16.7   5.7   32    1-32     23-55  (375)
149 3kts_A Glycerol uptake operon   48.3      14 0.00057   16.6   5.3   81   15-102    91-178 (192)
150 1jvn_A Glutamine, bifunctional  47.7      14 0.00059   16.6   5.9   76   36-114   456-543 (555)
151 2is8_A Molybdopterin biosynthe  46.1      15 0.00062   16.4   5.6   47   10-56     19-72  (164)
152 1rj9_A FTSY, signal recognitio  45.9      15 0.00063   16.4   5.8   93   13-106   145-258 (304)
153 2vws_A YFAU, 2-keto-3-deoxy su  45.4      15 0.00064   16.4  11.2   98   16-115     8-110 (267)
154 2z6i_A Trans-2-enoyl-ACP reduc  44.9      15 0.00065   16.3   9.9   81   17-102   102-190 (332)
155 1to3_A Putative aldolase YIHT;  44.8      15 0.00065   16.3   4.0   63   37-102   182-253 (304)
156 3c85_A Putative glutathione-re  44.6      16 0.00065   16.3   8.8   91    3-101    65-157 (183)
157 3kzx_A HAD-superfamily hydrola  44.1      16 0.00067   16.3   3.1   83   19-103   113-204 (231)
158 3czc_A RMPB; alpha/beta sandwi  44.0      16 0.00067   16.2   9.7   79    1-91     18-103 (110)
159 2q1w_A Putative nucleotide sug  43.8      16 0.00067   16.2   4.8   32    1-32     21-52  (333)
160 3bw2_A 2-nitropropane dioxygen  43.8      16 0.00067   16.2  10.0   84   17-102   137-236 (369)
161 1izc_A Macrophomate synthase i  43.7      16 0.00068   16.2  10.7  102   13-116    28-138 (339)
162 1vch_A Phosphoribosyltransfera  43.5      16 0.00068   16.2   4.3   18   81-98    132-149 (175)
163 3l6u_A ABC-type sugar transpor  42.5      17 0.00071   16.1   4.9   65   13-82     26-97  (293)
164 2jbm_A Nicotinate-nucleotide p  41.8      17 0.00072   16.0   5.2   69   28-101   201-270 (299)
165 2agk_A 1-(5-phosphoribosyl)-5-  41.6      17 0.00073   16.0   5.5   69   36-104   161-238 (260)
166 3bo9_A Putative nitroalkan dio  41.5      17 0.00073   16.0   9.9   83   17-101   116-203 (326)
167 1wv2_A Thiazole moeity, thiazo  41.1      18 0.00074   16.0  13.4  105   14-123   124-241 (265)
168 2qm3_A Predicted methyltransfe  41.1      18 0.00074   16.0   3.2   75    2-79    196-276 (373)
169 1qo2_A Molecule: N-((5-phospho  40.8      17 0.00073   16.0   2.9   61   33-96    145-210 (241)
170 3bwc_A Spermidine synthase; SA  40.7      18 0.00075   15.9   5.9   66    2-69    120-199 (304)
171 3e05_A Precorrin-6Y C5,15-meth  40.3      17 0.00073   16.0   2.9   63    3-68     66-130 (204)
172 2fpo_A Methylase YHHF; structu  40.0      18 0.00077   15.9   5.3   50    2-54     78-130 (202)
173 1te2_A Putative phosphatase; s  39.9      18 0.00078   15.9   4.3   16   86-101   177-192 (226)
174 1r8j_A KAIA; circadian clock p  39.7      19 0.00078   15.8   9.1  108    4-116    12-125 (289)
175 3cbg_A O-methyltransferase; cy  38.3      20 0.00082   15.7   6.2   65    3-67     99-169 (232)
176 3fwz_A Inner membrane protein   37.5      20 0.00085   15.6   8.9   88    3-102    32-124 (140)
177 1vl0_A DTDP-4-dehydrorhamnose   37.3      20 0.00085   15.6   4.4   56    1-57     13-74  (292)
178 1hdo_A Biliverdin IX beta redu  37.0      17  0.0007   16.1   2.3   32    1-32      3-34  (206)
179 1ws6_A Methyltransferase; stru  36.8      21 0.00087   15.6   5.9   51    3-53     65-117 (171)
180 1t5b_A Acyl carrier protein ph  36.7      21 0.00087   15.6   4.1   30    1-30      1-40  (201)
181 3ff4_A Uncharacterized protein  35.6      11 0.00045   17.3   1.2   96    1-102     4-110 (122)
182 3iv3_A Tagatose 1,6-diphosphat  35.5      22 0.00091   15.4   4.9   66   37-102   193-279 (332)
183 3k1z_A Haloacid dehalogenase-l  34.7      22 0.00094   15.4   4.4   21   82-102   185-205 (263)
184 1u0t_A Inorganic polyphosphate  34.4      23 0.00095   15.3   3.3  103    2-119     5-130 (307)
185 1wa3_A 2-keto-3-deoxy-6-phosph  34.4      23 0.00095   15.3   9.1   23    8-30     18-40  (205)
186 3o9z_A Lipopolysaccaride biosy  34.3      23 0.00095   15.3   5.4  106    1-112     3-114 (312)
187 1wv9_A Rhodanese homolog TT165  34.0      17 0.00072   16.1   2.0   66   33-103     5-84  (94)
188 3oa2_A WBPB; oxidoreductase, s  34.0      23 0.00097   15.3   4.9  102    1-107     3-108 (318)
189 2bdq_A Copper homeostasis prot  33.7      23 0.00098   15.3   3.4   74   30-104     7-97  (224)
190 1y0b_A Xanthine phosphoribosyl  33.6      23 0.00098   15.3   4.2   11   24-34     52-63  (197)
191 1qv9_A F420-dependent methylen  33.4      23 0.00099   15.2   5.5   80   23-106    30-122 (283)
192 1xj5_A Spermidine synthase 1;   33.1      24   0.001   15.2   5.9   67    2-69    145-224 (334)
193 3dez_A OPRT, oprtase, orotate   32.7      16 0.00065   16.3   1.6   65   49-116   152-219 (243)
194 3l0g_A Nicotinate-nucleotide p  32.6      24   0.001   15.2   6.1   65   28-100   211-276 (300)
195 3dqq_A Putative tRNA synthase;  32.5      24   0.001   15.2   4.2   30    1-30      2-31  (421)
196 3jr2_A Hexulose-6-phosphate sy  32.3      24   0.001   15.1   6.0   22   81-102   172-193 (218)
197 1qpo_A Quinolinate acid phosph  32.3      24   0.001   15.1   6.1   69   28-101   198-267 (284)
198 1o57_A PUR operon repressor; p  32.1      25   0.001   15.1   3.0   16   14-29     44-59  (291)
199 2px0_A Flagellar biosynthesis   31.6      25  0.0011   15.1   7.2  103    3-106   136-250 (296)
200 3hut_A Putative branched-chain  31.5      25  0.0011   15.0   7.5  101    2-105   140-251 (358)
201 3e70_C DPA, signal recognition  31.0      26  0.0011   15.0   8.5   96   10-106   169-279 (328)
202 2hnk_A SAM-dependent O-methylt  30.8      26  0.0011   15.0   7.8   64    3-66     87-167 (239)
203 1qb7_A APRT, adenine phosphori  30.3      27  0.0011   14.9   4.2   27    3-29    140-169 (236)
204 3mjd_A Orotate phosphoribosylt  29.9      27  0.0011   14.9   2.4   21   49-69    139-162 (232)
205 1pv8_A Delta-aminolevulinic ac  29.7      23 0.00097   15.3   2.1   12   93-104   242-253 (330)
206 1uan_A Hypothetical protein TT  29.6      27  0.0011   14.9   6.8   54    1-54      1-72  (227)
207 2vpq_A Acetyl-COA carboxylase;  29.1      28  0.0012   14.8   2.7  118    1-121     1-187 (451)
208 1q6o_A Humps, 3-keto-L-gulonat  28.8      28  0.0012   14.8   5.9   23   80-102   168-190 (216)
209 3c1o_A Eugenol synthase; pheny  28.6      28  0.0012   14.8   5.1   54    1-55      4-66  (321)
210 3mbh_A Putative phosphomethylp  28.4      29  0.0012   14.7   7.8   78    1-79      7-111 (291)
211 1h7n_A 5-aminolaevulinic acid   28.3      23 0.00095   15.3   1.8   15   91-105   251-265 (342)
212 3n2l_A OPRT, oprtase, orotate   28.3      29  0.0012   14.7   2.6   20   49-68    145-167 (238)
213 3e58_A Putative beta-phosphogl  28.2      29  0.0012   14.7   4.1   80   20-102   100-188 (214)
214 2zxr_A Single-stranded DNA spe  28.0     9.4 0.00039   17.6  -0.2   29   30-59    134-165 (666)
215 3iuu_A MLRC-like, putative met  27.7      29  0.0012   14.7   3.8   70   40-111    91-170 (495)
216 3m3h_A OPRT, oprtase, orotate   27.6      21  0.0009   15.5   1.6   66   48-116   139-207 (234)
217 1l3i_A Precorrin-6Y methyltran  27.4      30  0.0013   14.6   3.3   65    2-69     56-123 (192)
218 2gjl_A Hypothetical protein PA  27.3      30  0.0013   14.6  11.8   84   17-102   110-200 (328)
219 1xdw_A NAD+-dependent (R)-2-hy  27.2      30  0.0013   14.6   7.9  105    1-113     1-109 (331)
220 1swv_A Phosphonoacetaldehyde h  27.1      27  0.0011   14.9   2.0   82   19-102   113-204 (267)
221 2o07_A Spermidine synthase; st  26.4      31  0.0013   14.5   8.0   74    2-78    120-207 (304)
222 2c1x_A UDP-glucose flavonoid 3  26.0      32  0.0013   14.5   5.5   51   72-122   361-414 (456)
223 3nav_A Tryptophan synthase alp  25.9      32  0.0013   14.5   7.4   97    3-103   128-237 (271)
224 3etn_A Putative phosphosugar i  25.9      32  0.0013   14.5   4.9   31   60-90    120-151 (220)
225 2r6j_A Eugenol synthase 1; phe  25.9      32  0.0013   14.5   5.1   56    1-57     10-70  (318)
226 3iaa_A CALG2; glycosyltransfer  25.8      32  0.0013   14.4   5.3   47   72-119   331-380 (416)
227 1wo8_A Methylglyoxal synthase;  25.7      32  0.0014   14.4   3.8   37    1-38      1-42  (126)
228 3kzp_A LMO0111 protein, putati  25.4      16 0.00069   16.2   0.7   86   18-105   134-233 (235)
229 1hg3_A Triosephosphate isomera  25.1      33  0.0014   14.4   5.7   86   13-103   106-205 (225)
230 3guy_A Short-chain dehydrogena  25.1      33  0.0014   14.4   6.9   78    1-82      1-80  (230)
231 1sny_A Sniffer CG10964-PA; alp  25.0      33  0.0014   14.4   7.1   82    1-82     21-110 (267)
232 1x1o_A Nicotinate-nucleotide p  25.0      33  0.0014   14.4   7.3   64   29-100   201-265 (286)
233 3cni_A Putative ABC type-2 tra  24.8      33  0.0014   14.3   6.0   61    2-68     11-72  (156)
234 1twd_A Copper homeostasis prot  24.8      33  0.0014   14.3   7.7   90    8-101    97-196 (256)
235 3hix_A ALR3790 protein; rhodan  24.7      33  0.0014   14.3   5.3   27   72-98     50-78  (106)
236 3l49_A ABC sugar (ribose) tran  24.3      34  0.0014   14.3   6.4   39   14-53     24-68  (291)
237 1iy9_A Spermidine synthase; ro  24.3      34  0.0014   14.3   6.3   65    2-69    100-178 (275)
238 2qy9_A Cell division protein F  24.0      34  0.0015   14.2   8.2  104    3-107   129-256 (309)
239 1lh0_A OMP synthase; loop clos  24.0      31  0.0013   14.6   1.9   22   48-69    119-143 (213)
240 3p3v_A PTS system, N-acetylgal  24.0      35  0.0015   14.2   4.7   43    2-45     31-76  (163)
241 1g5t_A COB(I)alamin adenosyltr  23.8      35  0.0015   14.2   4.2   47   44-93    118-171 (196)
242 2aee_A OPRT, oprtase, orotate   23.7      27  0.0011   14.9   1.5   66   48-116   119-187 (211)
243 1wl8_A GMP synthase [glutamine  23.7      35  0.0015   14.2   7.2   91    3-100     2-94  (189)
244 3pfn_A NAD kinase; structural   23.6      35  0.0015   14.2   7.5   76    2-82     39-140 (365)
245 2yvl_A TRMI protein, hypotheti  23.5      35  0.0015   14.2   4.4   89    3-97    115-207 (248)
246 2b7n_A Probable nicotinate-nuc  23.1      36  0.0015   14.1   5.9   33   84-116   190-222 (273)
247 3dhn_A NAD-dependent epimerase  23.0      36  0.0015   14.1   5.6   34    1-34      4-37  (227)
248 1k7k_A Hypothetical protein YG  22.9      36  0.0015   14.1   3.4   30    1-30     23-52  (221)
249 2an1_A Putative kinase; struct  22.8      36  0.0015   14.1   6.4   96    2-118     6-117 (292)
250 3ajx_A 3-hexulose-6-phosphate   22.7      37  0.0015   14.1   5.8   26   34-59     40-65  (207)
251 1rd5_A Tryptophan synthase alp  22.6      37  0.0015   14.1   8.1   98    3-104   121-231 (262)
252 2dwc_A PH0318, 433AA long hypo  22.3      37  0.0016   14.0   5.3  101    2-106    20-165 (433)
253 3kp1_A D-ornithine aminomutase  22.3      37  0.0016   14.0   6.1   98   21-122   630-738 (763)
254 1vzw_A Phosphoribosyl isomeras  22.2      38  0.0016   14.0   6.5   77   34-113   148-238 (244)
255 2r60_A Glycosyl transferase, g  22.2      38  0.0016   14.0   3.8   44   72-119   380-423 (499)
256 3ic5_A Putative saccharopine d  21.8      38  0.0016   14.0   7.9   90    2-102     6-98  (118)
257 2zg6_A Putative uncharacterize  21.8      38  0.0016   14.0   2.2   13   22-34    108-120 (220)
258 3e8x_A Putative NAD-dependent   21.5      39  0.0016   13.9   5.4   52    1-54     22-74  (236)
259 3llv_A Exopolyphosphatase-rela  21.4      39  0.0016   13.9   8.2  102    3-119    31-136 (141)
260 1gmx_A GLPE protein; transfera  21.1      40  0.0017   13.9   3.8   68   31-103     6-90  (108)
261 1zx0_A Guanidinoacetate N-meth  20.9      40  0.0017   13.9   4.3   52    3-55     85-137 (236)
262 1qxn_A SUD, sulfide dehydrogen  20.9      40  0.0017   13.9   2.9   70   32-103    25-114 (137)
263 2e6f_A Dihydroorotate dehydrog  20.7      40  0.0017   13.8   4.0   50   71-120   241-297 (314)
264 1vhq_A Enhancing lycopene bios  20.6      41  0.0017   13.8   4.4   32    1-32      6-45  (232)
265 2hpv_A FMN-dependent NADH-azor  20.4      41  0.0017   13.8   4.1   31    1-31      1-42  (208)
266 1sqg_A SUN protein, FMU protei  20.3      41  0.0017   13.8   2.1   51    3-54    272-323 (429)
267 3ius_A Uncharacterized conserv  20.2      41  0.0017   13.8   4.2   55    1-57      4-59  (286)
268 3lm8_A Thiamine pyrophosphokin  20.1      17 0.00072   16.1  -0.1   96    1-104     1-101 (222)
269 2hoq_A Putative HAD-hydrolase   20.1      42  0.0018   13.8   4.0   82   20-103   105-195 (241)

No 1  
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A*
Probab=99.97  E-value=1.2e-29  Score=195.77  Aligned_cols=127  Identities=20%  Similarity=0.258  Sum_probs=116.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .|||||||++.+|..++.+|+..||+|..|.||++|++.+.++ .||+||+|+.||+|  +++++.+|+.+.++++|||+
T Consensus         2 ~rILiVDD~~~~~~~l~~~L~~~g~~v~~a~~g~eal~~~~~~-~pdlvllD~~mP~mdG~e~~~~ir~~~~~~~iPVI~   80 (459)
T 1w25_A            2 ARILVVDDIEANVRLLEAKLTAEYYEVSTAMDGPTALAMAARD-LPDIILLDVMMPGMDGFTVCRKLKDDPTTRHIPVVL   80 (459)
T ss_dssp             CEEEEECSSTTHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHH-CCSEEEEESCCSSSCHHHHHHHHHHSTTTTTSCEEE
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEEECCCCCCCHHHHHHHHHCCCCCCCCCEEE
T ss_conf             8899995989999999999997898999979999999999627-999999979899999999999997086779896899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999999999987
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQF  129 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~  129 (133)
                      +|++++.+...+++++||+|||.||+++++|..+++.+++.++..++.+.
T Consensus        81 lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~rIr~llr~~~~~~el~~  130 (459)
T 1w25_A           81 ITALDGRGDRIQGLESGASDFLTKPIDDVMLFARVRSLTRFKLVIDELRQ  130 (459)
T ss_dssp             EECSSCHHHHHHHHHHTCCEEEESSCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHCCCCCCCCCCCHHHHHHHHH
T ss_conf             98899989999998669857985584012001321133330134445666


No 2  
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A*
Probab=99.97  E-value=1.7e-29  Score=194.79  Aligned_cols=124  Identities=19%  Similarity=0.176  Sum_probs=114.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .+|||||||+.+|..++.+|+..||+|..|.||.+|++.+.++..||+||+|++||+|  +++++.+|+.+.++++|||+
T Consensus       125 ~~VLvVDD~~~~~~~i~~~L~~~g~~v~~a~~g~eal~~l~~~~~~DlIllD~~MP~~dG~e~~~~iR~~~~~~~iPII~  204 (259)
T 3luf_A          125 IEVLVVDDSRTSRHRTMAQLRKQLLQVHEASHAREALATLEQHPAIRLVLVDYYMPEIDGISLVRMLRERYSKQQLAIIG  204 (259)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHCTTEEEEEECSCCSSSCHHHHHHHHHHHCCTTTSEEEE
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCCEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             25787538889999999999834662453240568999984489965999647776754899999998378899994999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      +|+.+..+...+|+++||+|||.|||+.++|..+|++.+++.+...
T Consensus       205 lTa~~~~~~~~~~~~~Ga~d~l~KP~~~~eL~~~i~~~L~~~~~~~  250 (259)
T 3luf_A          205 ISVSDKRGLSARYLKQGANDFLNQPFEPEELQCRVSHNLEALEQFN  250 (259)
T ss_dssp             EECSSSSSHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHHHC--
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             9899998999999987999999898999999999999999999996


No 3  
>3gt7_A Sensor protein; structural genomics, signal receiver domain, kinase, PSI-2, protein structure initiative; 2.30A {Syntrophus aciditrophicus SB}
Probab=99.96  E-value=3.9e-29  Score=192.70  Aligned_cols=119  Identities=19%  Similarity=0.266  Sum_probs=111.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             799973998999999999998898999999979999999717999489970789987--738999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~l   80 (133)
                      |||||||++.+|..++..|+.+||+|.+|.||++|++.+.+ ..||+||+|+.||++  +++++++|+.+..+++|||++
T Consensus         9 kILiVDDd~~~~~~l~~~L~~~G~~v~~a~~~~~al~~l~~-~~~DlillD~~mP~~dG~el~~~ir~~~~~~~iPiI~l   87 (154)
T 3gt7_A            9 EILIVEDSPTQAEHLKHILEETGYQTEHVRNGREAVRFLSL-TRPDLIISDVLMPEMDGYALCRWLKGQPDLRTIPVILL   87 (154)
T ss_dssp             EEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHTT-CCCSEEEEESCCSSSCHHHHHHHHHHSTTTTTSCEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCEEEEE
T ss_conf             09999799999999999999879999998999999999983-89999998089999988799999985845579959999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             638998999999976998899769898999999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      |++++.+...+|+++||++||.|||+.++|..+++++++..+
T Consensus        88 Ta~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~  129 (154)
T 3gt7_A           88 TILSDPRDVVRSLECGADDFITKPCKDVVLASHVKRLLSGVK  129 (154)
T ss_dssp             ECCCSHHHHHHHHHHCCSEEEESSCCHHHHHHHHHHHHHHTC
T ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             826999999999977988799798999999999999999999


No 4  
>3jte_A Response regulator receiver protein; structural genomics, nysgrc, response regulator receiver domain, target 11226E, PSI-2; 1.90A {Clostridium thermocellum atcc 27405}
Probab=99.96  E-value=2.9e-28  Score=187.54  Aligned_cols=128  Identities=19%  Similarity=0.263  Sum_probs=116.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEE
Q ss_conf             97799973998999999999998898999999979999999717-9994899707899877--38999961434889739
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE-LLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~-~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pi   77 (133)
                      |.|||||||++.+|..++.+|+..||+|.+|.||.+|++.+.+. ..||+|++|+.||++.  ++++++++.  .+.+||
T Consensus         3 m~rILIVDDd~~~~~~l~~~L~~~g~~v~~a~~~~eal~~~~~~~~~~dlvilD~~mp~~~G~~l~~~~~~~--~~~~pv   80 (143)
T 3jte_A            3 LAKILVIDDESTILQNIKFLLEIDGNEVLTASSSTEGLRIFTENCNSIDVVITDMKMPKLSGMDILREIKKI--TPHMAV   80 (143)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHTTTTCCEEEEESCCSSSCHHHHHHHHHHH--CTTCEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHHH--CCCCCE
T ss_conf             988999969999999999999987999999788999999998459997399974777777889999999987--899969


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             99963899899999997699889976989899999999999999999999877
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL  130 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~l  130 (133)
                      |++|++++.+...+|+++||+|||.|||+.++|..++++++++++...+++.+
T Consensus        81 I~lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~l~~e~~~l  133 (143)
T 3jte_A           81 IILTGHGDLDNAILAMKEGAFEYLRKPVTAQDLSIAINNAINRKKLLMENERM  133 (143)
T ss_dssp             EEEECTTCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHHHHHC-----
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             99988899999999998699899828999999999999999999999999999


No 5  
>3crn_A Response regulator receiver domain protein, CHEY- like; structural genomics, signal regulator receiver domain; HET: PHD; 1.58A {Methanospirillum hungatei jf-1}
Probab=99.96  E-value=5.1e-28  Score=186.03  Aligned_cols=123  Identities=17%  Similarity=0.258  Sum_probs=113.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |||||||||++.+|..++.+|+.+||+|.+|.||.+|++.+.++ .||+|++|+.||++  +++++++|+.  .+++|||
T Consensus         3 mkrILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~l~~~-~~dlvllD~~mp~~~G~el~~~lr~~--~~~~piI   79 (132)
T 3crn_A            3 LKRILIVDDDTAILDSTKQILEFEGYEVEIAATAGEGLAKIENE-FFNLALFXIKLPDMEGTELLEKAHKL--RPGMKKI   79 (132)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHS-CCSEEEECSBCSSSBHHHHHHHHHHH--CTTSEEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEECCCHHHHHHHHHHC-CCCEEEECCCCCCCHHHHHHHHHHHH--CCCCCEE
T ss_conf             88899995999999999999998699799709999999999857-99999970448996089999999984--8999899


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             996389989999999769988997698989999999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDE  126 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~  126 (133)
                      ++|++++.+...+|+++||++|+.|||++++|..++++++++++....
T Consensus        80 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~L~~~~~eG~  127 (132)
T 3crn_A           80 MVTGYASLENSVFSLNAGADAYIMKPVNPRDLLEKIKEKLDEQEKEGH  127 (132)
T ss_dssp             EEESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHCCCC
T ss_conf             997659999999999879989998979999999999999999961799


No 6  
>2a9o_A Response regulator; essential protein, YYCF/YYCG homolog, signaling protein; 1.65A {Streptococcus pneumoniae} SCOP: c.23.1.1 PDB: 1nxo_A 1nxs_A 1nxv_A 1nxw_A 1nxx_A 1nxp_A 2a9p_A 2a9q_A 1nxt_A* 2a9r_A*
Probab=99.96  E-value=1.6e-28  Score=189.11  Aligned_cols=120  Identities=20%  Similarity=0.302  Sum_probs=108.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987738999961434889739999
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii~l   80 (133)
                      |+||||||||+.+|+.++..|+.+||+|.+|.||++|++.+.++ .||+|++|++||++.|+ ..+++....+++|||++
T Consensus         1 M~rILiVDDd~~~~~~l~~~L~~~g~~v~~a~~g~~al~~l~~~-~~dliilD~~mp~~dG~-~~l~~~~~~~~~pvi~l   78 (120)
T 2a9o_A            1 MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-QPDIIILDLMLPEIDGL-EVAKTIRKTSSVPILML   78 (120)
T ss_dssp             -CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHH-CCSEEEECSSCSSSCHH-HHHHHHHHHCCCCEEEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHH-HHHHHHHHCCCCCEEEE
T ss_conf             98899997999999999999998899999989999999999857-99899982999998999-99999886599819999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             638998999999976998899769898999999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      |++++.+...+|++.||++|+.|||+.++|..++++++++.+
T Consensus        79 t~~~~~~~~~~a~~~Ga~d~l~KP~~~~~L~~~i~~~lrr~~  120 (120)
T 2a9o_A           79 SAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRRSQ  120 (120)
T ss_dssp             ESCCSHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHC--
T ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             798999999999987998999898999999999999997759


No 7  
>3c3m_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE; 1.70A {Methanoculleus marisnigri JR1}
Probab=99.96  E-value=1.2e-28  Score=189.83  Aligned_cols=125  Identities=20%  Similarity=0.214  Sum_probs=116.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |+||||||||+.+|..+++.|+.+||+|.+|.||.+|++.+.+ ..||+||+|+.||++  +++++++|+.+.++++|||
T Consensus         3 ~~rILIVDD~~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~~-~~pdliilD~~mP~~dG~el~~~ir~~~~~~~ipvI   81 (138)
T 3c3m_A            3 LYTILVVDDSPMIVDVFVTMLERGGYRPITAFSGEECLEALNA-TPPDLVLLDIMMEPMDGWETLERIKTDPATRDIPVL   81 (138)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHH-SCCSEEEEESCCSSSCHHHHHHHHHHSTTTTTSCEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCEE
T ss_conf             8989999799999999999999879999998999999999753-899899970678999889999999848655899879


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             996389989999999769988997698989999999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDE  126 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~  126 (133)
                      ++|++++.+...+++.+|+++|+.|||++++|..++++++++++....
T Consensus        82 ~ls~~~~~~~~~~~~~~G~~d~l~KP~~~~~L~~~l~~~l~r~~~~~a  129 (138)
T 3c3m_A           82 MLTAKPLTPEEANEYGSYIEDYILKPTTHHQLYEAIEHVLARRHSIAA  129 (138)
T ss_dssp             EEESSCCCHHHHHHTTTTCSEEEECCCHHHHHHHHHHHHHSCC-----
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             986379899999998679988998989999999999999996520554


No 8  
>3gl9_A Response regulator; beta-sheet, surrounded by alpha helices, BOTH sides, signaling protein; HET: BFD; 1.80A {Thermotoga maritima} PDB: 3dgf_C 3dge_C
Probab=99.96  E-value=7.9e-28  Score=184.93  Aligned_cols=117  Identities=21%  Similarity=0.245  Sum_probs=110.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +||||||||+.+|..++..|+.+||+|.+|.||.+|++.+.+ ..||+|++|++||++  +++++++|+.+..+++|||+
T Consensus         3 ~rILvVDD~~~~~~~l~~~L~~~g~~v~~a~~g~eal~~~~~-~~pdliilD~~mP~~~G~el~~~ir~~~~~~~iPiI~   81 (122)
T 3gl9_A            3 KKVLLVDDSAVLRKIVSFNLKKEGYEVIEAENGQIALEKLSE-FTPDLIVLXIMMPVMDGFTVLKKLQEKEEWKRIPVIV   81 (122)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHTT-BCCSEEEECSCCSSSCHHHHHHHHHTSTTTTTSCEEE
T ss_pred             CCEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCCEEE
T ss_conf             859999699999999999999879999998999999999983-7999998510289998899999998388789998999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      +|++++.+...+|+++||++|+.|||++++|..++++++.
T Consensus        82 lT~~~~~~~~~~a~~~G~~~yl~KP~~~~~L~~~v~~~L~  121 (122)
T 3gl9_A           82 LTAKGGEEDESLALSLGARKVMRKPFSPSQFIEEVKHLLN  121 (122)
T ss_dssp             EESCCSHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHC
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             8279999999999987998899798999999999999858


No 9  
>1qkk_A DCTD, C4-dicarboxylate transport transcriptional regulatory protein; receiver domain, 2-component signal transduction; 1.7A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1l5z_A 1l5y_A
Probab=99.96  E-value=8.1e-28  Score=184.87  Aligned_cols=126  Identities=21%  Similarity=0.264  Sum_probs=113.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEE
Q ss_conf             77999739989999999999988989999999799999997179994899707899877--3899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~   79 (133)
                      -+||||||++.+|..++..|+..||+|..|.||.+|++.+.+ ..||+||+|++||++.  ++++++|+.  .+++|||+
T Consensus         4 P~ILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~l~~-~~~dliilD~~mP~~dGle~~~~ir~~--~~~~pvI~   80 (155)
T 1qkk_A            4 PSVFLIDDDRDLRKAMQQTLELAGFTVSSFASATEALAGLSA-DFAGIVISDIRMPGMDGLALFRKILAL--DPDLPMIL   80 (155)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESCHHHHHHTCCT-TCCSEEEEESCCSSSCHHHHHHHHHHH--CTTSCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEECCCCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             989999599999999999999879989997899999998532-698777654578999899999999972--98994898


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999999999999877
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL  130 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~l  130 (133)
                      +||+++.+...+|++.||+|||.|||+.++|..+++++++.++...+++.+
T Consensus        81 lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~~~~~~~~~e~~~l  131 (155)
T 1qkk_A           81 VTGHGDIPMAVQAIQDGAYDFIAKPFAADRLVQSARRAEEKRRLVMENRSL  131 (155)
T ss_dssp             EECGGGHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             979899999999998699889759999999999999999999999999999


No 10 
>1s8n_A Putative antiterminator; structural genomics, transcriptional antiterminator, two component system, PSI; 1.48A {Mycobacterium tuberculosis H37RV} SCOP: c.23.1.1 PDB: 1sd5_A
Probab=99.96  E-value=7.3e-28  Score=185.14  Aligned_cols=120  Identities=18%  Similarity=0.214  Sum_probs=108.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEE
Q ss_conf             7799973998999999999998898999-9999799999997179994899707899877--389999614348897399
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii   78 (133)
                      +|||||||++.+|..++++|+..||+|. +|.||++|++.+.++ .||+||+|++||||+  ++++++|+.   +.+|||
T Consensus        14 ~rILIVDDd~~~r~~l~~~L~~~G~~vv~~a~~g~eal~~~~~~-~pDlillDi~MP~mdGle~~~~ir~~---~~~pii   89 (205)
T 1s8n_A           14 RRVLIAEDEALIRMDLAEMLREEGYEIVGEAGDGQEAVELAELH-KPDLVIMDVKMPRRDGIDAASEIASK---RIAPIV   89 (205)
T ss_dssp             CEEEEECSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHH-CCSEEEEESSCSSSCHHHHHHHHHHT---TCSCEE
T ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHC---CCCCEE
T ss_conf             88999829899999999999986997999989999999999837-99999996404586079999999856---999989


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      ++|++++.+...+|+++||++||.|||+.++|..+|++++...+...
T Consensus        90 ilTa~~~~~~~~~al~~Ga~dyl~KP~~~~~l~~~i~~~l~~~~~~~  136 (205)
T 1s8n_A           90 VLTAFSQRDLVERARDAGAMAYLVKPFSISDLIPAIELAVSRFREIT  136 (205)
T ss_dssp             EEEEGGGHHHHHTTGGGSCEEEEEESCCHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99567889999999982984214389999999999999998644310


No 11 
>1zh2_A KDP operon transcriptional regulatory protein KDPE; two-component system, gene regulation, transcription factor, KDP potassium transport system; 2.00A {Escherichia coli} SCOP: c.23.1.1 PDB: 1zh4_A
Probab=99.96  E-value=8.5e-28  Score=184.74  Aligned_cols=117  Identities=26%  Similarity=0.392  Sum_probs=109.1

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |.||||||||+.+|+.++..|+.+||+|..|.||++|++.+.+. .||+|++|+.||++  +++++++|..   +++|||
T Consensus         1 M~~ILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~~~~~-~~dlil~D~~mp~~~G~~l~~~ir~~---~~ipiI   76 (121)
T 1zh2_A            1 MTNVLIVEDEQAIRRFLRTALEGDGMRVFEAETLQRGLLEAATR-KPDLIILDLGLPDGDGIEFIRDLRQW---SAVPVI   76 (121)
T ss_dssp             -CEEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHH-CCSEEEEESEETTEEHHHHHHHHHTT---CCCCEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH---CCCEEE
T ss_conf             98499996999999999999998799999988899999999717-99999980999998979999999974---799099


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      ++|++++.+...+|+++||+||+.|||+.++|..+++++++++
T Consensus        77 ~lt~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~lrr~  119 (121)
T 1zh2_A           77 VLSARSEESDKIAALDAGADDYLSKPFGIGELQARLRVALRRH  119 (121)
T ss_dssp             EEESCCSHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             9978599999999998699999979999999999999998875


No 12 
>3cnb_A DNA-binding response regulator, MERR family; signal receiver domain, DNA binding protein, protein structure initiative, PSI-2; 2.00A {Colwellia psychrerythraea 34H}
Probab=99.96  E-value=1.4e-27  Score=183.39  Aligned_cols=123  Identities=15%  Similarity=0.254  Sum_probs=113.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHH--CCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             799973998999999999998--898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFND--FGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~--~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      ||||||||+.+|+.++..|+.  .|++|..|.||.+|++.+.+ ..||+||+|+.||++  +++++++|+.+..+++|||
T Consensus        10 ~ILiVDD~~~~~~~l~~~L~~~~~~~~v~~a~~g~eAl~~~~~-~~pDlillD~~mP~~dG~el~~~ir~~~~~~~ipvI   88 (143)
T 3cnb_A           10 SILIIEDDKEFADMLTQFLENLFPYAKIKIAYNPFDAGDLLHT-VKPDVVMLDLMMVGMDGFSICHRIKSTPATANIIVI   88 (143)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHHCTTCEEEEECSHHHHHHHHHH-TCCSEEEEETTCTTSCHHHHHHHHHTSTTTTTSEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCEEE
T ss_conf             9999919999999999999827898089998999999999972-799999980888999869999999847888998499


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             996389989999999769988997698989999999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDE  126 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~  126 (133)
                      ++|+.++.+...+++++||++||.|||+.++|..++++++++++...+
T Consensus        89 ~lt~~~~~~~~~~~~~~Ga~~yl~KP~~~~~L~~~i~~~l~~~~~~~E  136 (143)
T 3cnb_A           89 AMTGALTDDNVSRIVALGAETCFGKPLNFTLLEKTIKQLVEQKKATSE  136 (143)
T ss_dssp             EEESSCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHTTC----
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHCHHHCC
T ss_conf             998489989999999769989998989999999999999971576517


No 13 
>3cg4_A Response regulator receiver domain protein (CHEY- like); structural genomics, unknown function, uncharacterized protein; HET: MSE; 1.61A {Methanospirillum hungatei jf-1}
Probab=99.96  E-value=1.7e-28  Score=188.89  Aligned_cols=126  Identities=18%  Similarity=0.286  Sum_probs=117.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .+|||||||+.+|..++..|+.+||+|.+|.||.+|++.+.+ ..||+||+|++||++  +++++++|+.+..+.+|||+
T Consensus         8 ~~VLiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eal~~l~~-~~~dliilD~~mP~~~G~el~~~ir~~~~~~~ipiI~   86 (142)
T 3cg4_A            8 GDVMIVDDDAHVRIAVKTILSDAGFHIISADSGGQCIDLLKK-GFSGVVLLDIMMPGMDGWDTIRAILDNSLEQGIAIVM   86 (142)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHT-CCCEEEEEESCCSSSCHHHHHHHHHHTTCCTTEEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             959999798999999999999879999998999999999971-7999999838999986899999998575568995999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999999998
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQ  128 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~  128 (133)
                      +|++++.+...+++++|+++|+.|||+.++|..++++++...+.+..|+
T Consensus        87 lT~~~~~~~~~~a~~~G~~dyl~KP~~~~~Ll~~v~~~l~~~r~q~~~e  135 (142)
T 3cg4_A           87 LTAKNAPDAKMIGLQEYVVDYITKPFDNEDLIEKTTFFMGFVRNQTGNE  135 (142)
T ss_dssp             EECTTCCCCSSTTGGGGEEEEEESSCCHHHHHHHHHHHHHHHHHC----
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHCC
T ss_conf             9788999999999986998899898999999999999999888688668


No 14 
>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, PSI-2, protein structure initiative; 2.00A {Desulfuromonas acetoxidans dsm 684}
Probab=99.95  E-value=9.7e-28  Score=184.37  Aligned_cols=120  Identities=16%  Similarity=0.228  Sum_probs=112.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .|||||||++.+|..++..|+.+||+|.+|.||.+|++.+.++ .||+||+|++||++  +++++.+|+.+.++++|||+
T Consensus         9 ~rILiVDD~~~~~~~l~~~L~~~G~~v~~a~~g~eAl~~~~~~-~pdliilD~~mP~~dG~el~~~ir~~~~~~~iPiI~   87 (147)
T 2zay_A            9 WRIMLVDTQLPALAASISALSQEGFDIIQCGNAIEAVPVAVKT-HPHLIITEANMPKISGMDLFNSLKKNPQTASIPVIA   87 (147)
T ss_dssp             EEEEEECTTGGGGHHHHHHHHHHTEEEEEESSHHHHHHHHHHH-CCSEEEEESCCSSSCHHHHHHHHHTSTTTTTSCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCCHHHHHHHHHCCCCCCCCEEE
T ss_conf             8899997999999999999998799999989999999999837-999999859999997518999998485568971899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      +|++++.+...+++++||++||.|||+.++|..++++++++..
T Consensus        88 lS~~~~~~~~~~~~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~  130 (147)
T 2zay_A           88 LSGRATAKEEAQLLDMGFIDFIAKPVNAIRLSARIKRVLKLLY  130 (147)
T ss_dssp             EESSCCHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHHHC
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             7268999999999987998899799999999999999999874


No 15 
>1mvo_A PHOP response regulator; phosphate regulon, transcriptional regulatory protein, alpha/beta doubly wound fold, phosphorylation; 1.60A {Bacillus subtilis} SCOP: c.23.1.1
Probab=99.95  E-value=1.3e-27  Score=183.73  Aligned_cols=124  Identities=19%  Similarity=0.277  Sum_probs=111.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      -+||||||||+.+|..++.+|+.+||+|.+|.||.+|++.+.++ .||+||+|++|||+  +++++++|..  .+.+|||
T Consensus         3 ~~rILiVDDd~~~~~~l~~~L~~~g~~v~~a~~g~~al~~l~~~-~~dlvl~D~~mP~~~G~el~~~ir~~--~~~~~ii   79 (136)
T 1mvo_A            3 NKKILVVDDEESIVTLLQYNLERSGYDVITASDGEEALKKAETE-KPDLIVLDVMLPKLDGIEVCKQLRQQ--KLMFPIL   79 (136)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHH-CCSEEEEESSCSSSCHHHHHHHHHHT--TCCCCEE
T ss_pred             CCCEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHHHHHHC--CCCCEEE
T ss_conf             88789998999999999999998899999989999999998845-99899826999999889999999854--9998599


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDEN  127 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~  127 (133)
                      ++|++++.+...+|+++||+||+.|||+.++|..++++++++.+.+..+
T Consensus        80 ~lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~~~~~~  128 (136)
T 1mvo_A           80 MLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILRRSEIRAPS  128 (136)
T ss_dssp             EEECTTCCCCHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHTC------
T ss_pred             EEECCCCHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHHHHHHHCHH
T ss_conf             9978799999999998699627889899999999999999887764836


No 16 
>3h5i_A Response regulator/sensory box protein/ggdef domain protein; structural genomics, transcription, PSI-2; 1.90A {Carboxydothermus hydrogenoformans z-2901}
Probab=99.95  E-value=4.6e-28  Score=186.32  Aligned_cols=121  Identities=15%  Similarity=0.200  Sum_probs=109.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCC-C--CHHHHHHHHCCCCCCCEEE
Q ss_conf             779997399899999999999889899999997999999971799948997078998-7--7389999614348897399
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-V--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~-~--~~l~~~ir~~~~~~~~pii   78 (133)
                      +||||||||+.+|..++.+|+.+||+|.+|.||.+|++.+.++..||+|++|+.||+ +  +++++++|+   .+++|||
T Consensus         6 ~rILiVDD~~~~~~~l~~~L~~~g~~v~~a~~g~eAl~~l~~~~~~dlillD~~mp~g~dG~e~~~~ir~---~~~~PvI   82 (140)
T 3h5i_A            6 KKILIVEDSKFQAKTIANILNKYGYTVEIALTGEAAVEKVSGGWYPDLILMDIELGEGMDGVQTALAIQQ---ISELPVV   82 (140)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHTTCCCSEEEEESSCSSSCCHHHHHHHHHH---HCCCCEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHH---CCCCCEE
T ss_conf             9999995989999999999998799999989899999999846999899972665335789999999985---6999899


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      ++|++++.+...++++.|+++|+.|||++++|..++++++++++...
T Consensus        83 ~lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~~~~  129 (140)
T 3h5i_A           83 FLTAHTEPAVVEKIRSVTAYGYVMKSATEQVLITIVEMALRLYEANV  129 (140)
T ss_dssp             EEESSSSCCCCGGGGGSCEEEEEETTCCHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             99899999999999987999899898999999999999999988789


No 17 
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A
Probab=99.95  E-value=1.9e-27  Score=182.71  Aligned_cols=118  Identities=18%  Similarity=0.236  Sum_probs=108.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .+|||||||+.+|+.++.+|+.+||+|..|.||.+|++.+.++ .||+|++|++||+|  +++++++|+.  .+++|||+
T Consensus       130 ~~iLvvdD~~~~~~~l~~~L~~~g~~v~~a~~g~~Al~~~~~~-~~dlil~D~~mP~mdG~e~~~~ir~~--~~~~pii~  206 (254)
T 2ayx_A          130 MMILVVDDHPINRRLLADQLGSLGYQCKTANDGVDALNVLSKN-HIDIVLSDVNMPNMDGYRLTQRIRQL--GLTLPVIG  206 (254)
T ss_dssp             CEEEEEESSHHHHHHHHHHHHHHTSEEEEECCSHHHHHHHHHS-CCSEEEEEESSCSSCCHHHHHHHHHH--HCCSCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             9899990989999999999998799999989999999999847-99899995036899838999999962--99997999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      +|++.+.+...+++++|+++||.|||+.++|..++++++++.+
T Consensus       207 lta~~~~~~~~~~~~~G~~~~l~KP~~~~~L~~~l~~~l~r~r  249 (254)
T 2ayx_A          207 VTANALAEEKQRCLESGMDSCLSKPVTLDVIKQTLTLYAERVR  249 (254)
T ss_dssp             EESSTTSHHHHHHHHCCCEEEEESSCCHHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             9899999999999986998999798999999999999999999


No 18 
>3nhm_A Response regulator; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.19A {Myxococcus xanthus}
Probab=99.95  E-value=1.7e-27  Score=182.91  Aligned_cols=121  Identities=18%  Similarity=0.236  Sum_probs=109.1

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEE
Q ss_conf             97-799973998999999999998898999999979999999717999489970789987--738999961434889739
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pi   77 (133)
                      || ||||||||+.+|..++.+|+ .||+|.+|.||.+|++.+.+ ..||+||+|++||++  +++++.+|+.+.++++||
T Consensus         3 mkprILiVDD~~~~r~~l~~~L~-~~~~v~~a~~g~eal~~l~~-~~pdliilD~~mP~~dG~el~~~ir~~~~~~~iPi   80 (133)
T 3nhm_A            3 LKPKVLIVENSWTMRETLRLLLS-GEFDCTTAADGASGLQQALA-HPPDVLISDVNMDGMDGYALCGHFRSEPTLKHIPV   80 (133)
T ss_dssp             --CEEEEECSCHHHHHHHHHHHT-TTSEEEEESSHHHHHHHHHH-SCCSEEEECSSCSSSCHHHHHHHHHHSTTTTTCCE
T ss_pred             CCCEEEEEECCHHHHHHHHHHHH-CCCEEEEECCHHHHHHHHHH-CCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCCE
T ss_conf             99979999498999999999997-89989998999999999984-79999997599999999999999982888899878


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             99963899899999997699889976989899999999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSK  124 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~  124 (133)
                      |++|++++. ...++.+.||++||.|||++++|..++++++++.+..
T Consensus        81 I~lT~~~~~-~~~~a~~~ga~~yl~KP~~~~~L~~~i~~~l~r~~~e  126 (133)
T 3nhm_A           81 IFVSGYAPR-TEGPADQPVPDAYLVKPVKPPVLIAQLHALLARAEAE  126 (133)
T ss_dssp             EEEESCCC------TTSCCCSEEEESSCCHHHHHHHHHHHHHHHC--
T ss_pred             EEEECCCHH-HHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHC
T ss_conf             997078849-9999987799789989999999999999999889706


No 19 
>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A
Probab=99.95  E-value=8.5e-27  Score=178.77  Aligned_cols=116  Identities=21%  Similarity=0.336  Sum_probs=107.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             799973998999999999998898999999979999999717999489970789987--738999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~l   80 (133)
                      ||||||||+.+|..++..|+.+||+|.+|.||++|++.+.++ .||+|++|++||++  +++++++|+.  .+++|||++
T Consensus         2 rILvVdDd~~~~~~l~~~L~~~G~~v~~a~~~~~al~~l~~~-~~dlii~D~~mp~~dG~e~~~~lr~~--~~~~pii~l   78 (121)
T 2pl1_A            2 RVLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEH-IPDIAIVDLGLPDEDGLSLIRRWRSN--DVSLPILVL   78 (121)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHS-CCSEEEECSCCSSSCHHHHHHHHHHT--TCCSCEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEECCCCCCCCCHHHHHHHHHC--CCCCCEEEE
T ss_conf             899996899999999999998799999989999999996458-99899988999998747899999963--999818999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             63899899999997699889976989899999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      |++++.+...+|+++||+||+.|||+.++|..+++++++++
T Consensus        79 t~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~lrR~  119 (121)
T 2pl1_A           79 TARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQALMRRN  119 (121)
T ss_dssp             ESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             78899999999998699999979899999999999997574


No 20 
>3hdv_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.09A {Pseudomonas putida KT2440}
Probab=99.95  E-value=5.1e-27  Score=180.11  Aligned_cols=121  Identities=19%  Similarity=0.230  Sum_probs=110.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .+|||||||+.+|..++.+|+.+||++.+|.||++|+..+.++..||+||+|++||++  .++++++|+.+ .+.+|||+
T Consensus         8 ~~ILiVDD~~~~r~~l~~~L~~~G~~v~~a~~~~~a~~~l~~~~~~dlii~D~~mP~~~G~el~~~ir~~~-~~~~piI~   86 (136)
T 3hdv_A            8 PLVLVVDDNAVNREALILYLKSRGIDAVGADGAEEARLYLHYQKRIGLMITDLRMQPESGLDLIRTIRASE-RAALSIIV   86 (136)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCCEEEESSHHHHHHHHHHCTTEEEEEECSCCSSSCHHHHHHHHHTST-TTTCEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHCC-CCCCEEEE
T ss_conf             88999979999999999999987999999899999999997579998899879899998999999999557-99991999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      +|++++.+...+|+++|+++|+.|||+.+.|..+++++++..+.
T Consensus        87 lT~~~~~~~~~~a~~~G~~d~l~KP~~~~~L~~~v~~~L~~~eG  130 (136)
T 3hdv_A           87 VSGDTDVEEAVDVMHLGVVDFLLKPVDLGKLLELVNKELKIGEG  130 (136)
T ss_dssp             EESSCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHC----
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHCC
T ss_conf             98889999999999869998998989999999999999998179


No 21 
>3cfy_A Putative LUXO repressor protein; structural genomics, unknown function, uncharacterized protein, signal receiver domain; 2.50A {Vibrio parahaemolyticus rimd 2210633}
Probab=99.95  E-value=6.3e-27  Score=179.56  Aligned_cols=122  Identities=19%  Similarity=0.288  Sum_probs=111.5

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEE
Q ss_conf             97-799973998999999999998898999999979999999717999489970789987--738999961434889739
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pi   77 (133)
                      || ||||||||+.+|..++..|+.+||+|.+|.||++|++.+.++ .||+|++|++||++  .++++++|+.  .+.+||
T Consensus         3 mk~rILIVDDd~~~~~~l~~~L~~~g~~v~~a~~~~eal~~l~~~-~pdlillD~~mp~~~G~~l~~~ir~~--~~~~pi   79 (137)
T 3cfy_A            3 LRPRVLLVEDSTSLAILYKQYVKDEPYDIFHVETGRDAIQFIERS-KPQLIILDLKLPDMSGEDVLDWINQN--DIPTSV   79 (137)
T ss_dssp             CCCEEEEECSCTTHHHHHHHHTTTSSSEEEEESSHHHHHHHHHHH-CCSEEEECSBCSSSBHHHHHHHHHHT--TCCCEE
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCE
T ss_conf             997699997999999999999998799999989999999999847-99999983899999889999999974--899848


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             999638998999999976998899769898999999999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      |++|++++.+...+++++||+||+.|||+.++|..++++++++.+..+
T Consensus        80 I~lt~~~~~~~~~~~~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~le~  127 (137)
T 3cfy_A           80 IIATAHGSVDLAVNLIQKGAEDFLEKPINADRLKTSVALHLKRAKLED  127 (137)
T ss_dssp             EEEESSCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             999877999999999867986899898999999999999999988999


No 22 
>1k66_A Phytochrome response regulator RCPB; CHEY homologue, homodimer, APO-protein, (beta/alpha)5, signaling protein; 1.75A {Tolypothrix SP} SCOP: c.23.1.1
Probab=99.95  E-value=7.7e-27  Score=179.03  Aligned_cols=120  Identities=15%  Similarity=0.216  Sum_probs=111.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCC--EEEEECCHHHHHHHHHHC---------CCCCEEEECCCCCCC--CHHHHHHHH
Q ss_conf             7799973998999999999998898--999999979999999717---------999489970789987--738999961
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGF--MVFEATSVCEAREFCEKE---------LLPNYLVIDESMEGV--LEFIAHVRQ   68 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~--~v~~a~~g~eAl~~~~~~---------~~pdlii~D~~mP~~--~~l~~~ir~   68 (133)
                      ++|||||||+.+|..++++|+.+|+  +|.+|.||.+|++.+.+.         ..||+|++|++||++  +++++++|+
T Consensus         7 ~~ILiVDD~~~~~~~l~~~L~~~g~~~~v~~a~~g~eAl~~l~~~~~~~~~~~~~~pdlvllD~~mP~~dG~el~~~ir~   86 (149)
T 1k66_A            7 QPLLVVEDSDEDFSTFQRLLQREGVVNPIYRCITGDQALDFLYQTGSYCNPDIAPRPAVILLDLNLPGTDGREVLQEIKQ   86 (149)
T ss_dssp             SCEEEECCCHHHHHHHHHHHHHTTBCSCEEEECSHHHHHHHHHTCCSSSCGGGCCCCSEEEECSCCSSSCHHHHHHHHTT
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCCCCCCCCCCEEEEECCCCCCCHHHHHHHHHH
T ss_conf             80999989999999999999986997279998999999999985011111122689998998088999985899999985


Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             43488973999963899899999997699889976989899999999999999
Q gi|254780892|r   69 MPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        69 ~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      ++.++++|||++|++++.+...+++++||++|+.||++.++|..+++++++..
T Consensus        87 ~~~~~~iPvI~lT~~~~~~~~~~~~~~Ga~~yl~KP~~~~~L~~~i~~~l~~~  139 (149)
T 1k66_A           87 DEVLKKIPVVIMTTSSNPKDIEICYSYSISSYIVKPLEIDRLTETVQTFIKYW  139 (149)
T ss_dssp             STTGGGSCEEEEESCCCHHHHHHHHHTTCSEEEECCSSHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             86669995899978999999999998799799979899999999999999998


No 23 
>2qzj_A Two-component response regulator; 11017X, PSI-II, structural genomics, protein structure initiative; 2.89A {Clostridium difficile 630}
Probab=99.95  E-value=5.1e-27  Score=180.11  Aligned_cols=123  Identities=15%  Similarity=0.195  Sum_probs=111.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .||||||||+.++..++..|+.+||+|.+|.||++|++.+.++ .||+||+|+.||++  +++++++|.   .+.+|||+
T Consensus         5 ~kILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~eal~~l~~~-~~dlillD~~mP~~dG~el~~~~~~---~~~~piI~   80 (136)
T 2qzj_A            5 TKILIIDGDKDNCQKLKGFLEEKGISIDLAYNCEEAIGKIFSN-KYDLIFLEIILSDGDGWTLCKKIRN---VTTCPIVY   80 (136)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHC-CCSEEEEESEETTEEHHHHHHHHHT---TCCCCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCCHHHHHHHHH---CCCCCEEE
T ss_conf             7599998999999999999998799999989999999988627-9999997799989986079999983---69998999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999999998
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQ  128 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~  128 (133)
                      +|+.++.+...+|+++||+||+.|||++++|..++++++++.+...+++
T Consensus        81 lt~~~~~~~~~~al~~Ga~dyl~KP~~~~~L~~~i~~~lrR~~~~~~~e  129 (136)
T 2qzj_A           81 MTYINEDQSILNALNSGGDDYLIKPLNLEILYAKVKAILRRMNSYVNNE  129 (136)
T ss_dssp             EESCCCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHHHHC-----
T ss_pred             EEEECCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHCHHCCC
T ss_conf             9962899999999986998899898999999999999999730301079


No 24 
>1k68_A Phytochrome response regulator RCPA; phosphorylated aspartate, CHEY homologue, homodimer, (beta/alpha)5, signaling protein; HET: PHD; 1.90A {Tolypothrix SP} SCOP: c.23.1.1
Probab=99.95  E-value=1e-26  Score=178.29  Aligned_cols=119  Identities=13%  Similarity=0.198  Sum_probs=109.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCC--CEEEEECCHHHHHHHHHHC------CCCCEEEECCCCCCC--CHHHHHHHHCCC
Q ss_conf             779997399899999999999889--8999999979999999717------999489970789987--738999961434
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKE------LLPNYLVIDESMEGV--LEFIAHVRQMPL   71 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g--~~v~~a~~g~eAl~~~~~~------~~pdlii~D~~mP~~--~~l~~~ir~~~~   71 (133)
                      |||||||||+.++..+++.|+.+|  ++|.+|.||.+|++.+.+.      ..||+|++|++||++  .++++++|+++.
T Consensus         3 krILiVdDd~~~~~~l~~~L~~~g~~~~v~~a~~g~eAl~~l~~~~~~~~~~~pdliilD~~mP~~dG~el~~~ir~~~~   82 (140)
T 1k68_A            3 KKIFLVEDNKADIRLIQEALANSTVPHEVVTVRDGMEAMAYLRQEGEYANASRPDLILLXLNLPKKDGREVLAEIKSDPT   82 (140)
T ss_dssp             CEEEEECCCHHHHHHHHHHHHTCSSCCEEEEECSHHHHHHHHTTCGGGGSCCCCSEEEECSSCSSSCHHHHHHHHHHSTT
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHCCC
T ss_conf             80999979999999999999967998189998999999999986245440479968999889999855999999983866


Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             8897399996389989999999769988997698989999999999999
Q gi|254780892|r   72 GTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        72 ~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      ++++|||++|++++.+...+|+++||++|+.||++.++|..+++++.+.
T Consensus        83 ~~~iPvi~ls~~~~~~~~~~a~~~Ga~~~l~KP~~~~~L~~~i~~i~~~  131 (140)
T 1k68_A           83 LKRIPVVVLSTSINEDDIFHSYDLHVNCYITKSANLSQLFQIVKGIEEF  131 (140)
T ss_dssp             GGGSCEEEEESCCCHHHHHHHHHTTCSEEEECCSSHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             5899899995789999999999879989997989999999999999999


No 25 
>3hv2_A Response regulator/HD domain protein; PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.50A {Pseudomonas fluorescens pf-5}
Probab=99.95  E-value=8.4e-27  Score=178.79  Aligned_cols=125  Identities=18%  Similarity=0.274  Sum_probs=113.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEEE
Q ss_conf             7999739989999999999988989999999799999997179994899707899877--38999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~l   80 (133)
                      +||||||++.++..++.+|+.+||+|.+|.||.+|++.+.++ .||+||+|++||+|.  ++++++|+.  .+++|||++
T Consensus        16 ~ILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~eAl~~l~~~-~~dlvi~D~~mP~~~G~ell~~ir~~--~~~~piI~l   92 (153)
T 3hv2_A           16 EILLVDSQEVILQRLQQLLSPLPYTLHFARDATQALQLLASR-EVDLVISAAHLPQMDGPTLLARIHQQ--YPSTTRILL   92 (153)
T ss_dssp             EEEEECSCHHHHHHHHHHHTTSSCEEEEESSHHHHHHHHHHS-CCSEEEEESCCSSSCHHHHHHHHHHH--CTTSEEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEEE
T ss_conf             799997999999999999998799999989999999998727-99999983678899889999999986--899968999


Q ss_pred             ECCCCHHHHHHHHHCCC-CEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             63899899999997699-889976989899999999999999999999877
Q gi|254780892|r   81 LMEVDFEKMIAGARAGA-NSFLLKPFNRETLRFAMRELPQMQKSKDENQFL  130 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga-~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~l  130 (133)
                      |++++.+...+|++.|+ ++||.|||+.++|..+++++++.++...++..+
T Consensus        93 T~~~~~~~~~~a~~~Gav~~yl~KP~~~~~L~~~i~~~l~~~~~~~e~~~l  143 (153)
T 3hv2_A           93 TGDPDLKLIAKAINEGEIYRYLSKPWDDQELLLALRQALEHQHSERERLRL  143 (153)
T ss_dssp             CCCCCHHHHHHHHHTTCCSEEECSSCCHHHHHHHHHHHHHHHHHHHTTC--
T ss_pred             ECCCCHHHHHHHHHCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             799999999999977998877889899999999999999999999999999


No 26 
>3lua_A Response regulator receiver protein; two-component signal transduction system, histidine kinase, phosphorelay, receiver domain, nysgxrc; 2.40A {Clostridium thermocellum}
Probab=99.95  E-value=1.9e-27  Score=182.67  Aligned_cols=124  Identities=15%  Similarity=0.208  Sum_probs=113.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCC---CCHHHHHHHHCCCCCCCEE
Q ss_conf             779997399899999999999889-899999997999999971799948997078998---7738999961434889739
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFG-FMVFEATSVCEAREFCEKELLPNYLVIDESMEG---VLEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g-~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~---~~~l~~~ir~~~~~~~~pi   77 (133)
                      .+|||||||+.+|+.++.+|+.+| |+|.+|.||++|++.+.+...||+||+|+.||+   |.++++.+|+.+..+++||
T Consensus         5 ~~ILiVDD~~~~r~~l~~~L~~~G~~~v~~a~~g~eal~~l~~~~~~dlii~D~~mP~~~~g~~l~~~ir~~~~~~~~pi   84 (140)
T 3lua_A            5 GTVLLIDYFEYEREKTKIIFDNIGEYDFIEVENLKKFYSIFKDLDSITLIIMDIAFPVEKEGLEVLSAIRNNSRTANTPV   84 (140)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHHCCCEEEEECSHHHHHTTTTTCCCCSEEEECSCSSSHHHHHHHHHHHHHSGGGTTCCE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCE
T ss_conf             97999949999999999999867990899989999999999738998599986899999988899998764424689988


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             999638998999999976998899769898999999999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      |++|++++.+...++++.|+++|+.|||++++|..++++++++.+...
T Consensus        85 I~lT~~~~~~~~~~~~~~G~~d~l~KP~~~~~L~~~i~~~L~~~~~~r  132 (140)
T 3lua_A           85 IIATKSDNPGYRHAALKFKVSDYILKPYPTKRLENSVRSVLKICQRFR  132 (140)
T ss_dssp             EEEESCCCHHHHHHHHHSCCSEEEESSCCTTHHHHHHHHHHCC-----
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             998279999999999986998999898999999999999999889985


No 27 
>2qr3_A Two-component system response regulator; structural genomics, signal receiver, PSI-2, protein structure initiative; 1.80A {Bacteroides fragilis YCH46}
Probab=99.95  E-value=2.3e-27  Score=182.10  Aligned_cols=123  Identities=17%  Similarity=0.290  Sum_probs=110.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCC-----C--CHHHHHHHHCCCCC
Q ss_conf             9779997399899999999999889899999997999999971799948997078998-----7--73899996143488
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-----V--LEFIAHVRQMPLGT   73 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~-----~--~~l~~~ir~~~~~~   73 (133)
                      |.+||||||++.+|..++.+|+.+||+|.+|.||++|++.+.++ .||+||+|++||+     +  +++++++|+.  .+
T Consensus         3 ~~~ILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~l~~~-~~dlillDl~mP~~~~~G~dGl~~l~~ir~~--~~   79 (140)
T 2qr3_A            3 LGTIIIVDDNKGVLTAVQLLLKNHFSKVITLSSPVSLSTVLREE-NPEVVLLDMNFTSGINNGNEGLFWLHEIKRQ--YR   79 (140)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHTTTSSEEEEECCHHHHHHHHHHS-CEEEEEEETTTTC-----CCHHHHHHHHHHH--CT
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCHHHHHHHHHHH--CC
T ss_conf             99899997999999999999997899999989999999999727-9999999168877776775199999999986--89


Q ss_pred             CCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHH
Q ss_conf             97399996389989999999769988997698989999999999999999999
Q gi|254780892|r   74 DVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDE  126 (133)
Q Consensus        74 ~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~  126 (133)
                      ++|||++|++++.+...+|++.||++||.|||+.++|..++.+++++.+...+
T Consensus        80 ~ipvI~lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~al~~~~~~~~  132 (140)
T 2qr3_A           80 DLPVVLFTAYADIDLAVRGIKEGASDFVVKPWDNQKLLETLLNAASQAKDGKK  132 (140)
T ss_dssp             TCCEEEEEEGGGHHHHHHHHHTTCCEEEEESCCHHHHHHHHHHHHTCC-----
T ss_pred             CCCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             98289997899999999999869978997989999999999999997088871


No 28 
>1jbe_A Chemotaxis protein CHEY; signaling protein; 1.08A {Escherichia coli} SCOP: c.23.1.1 PDB: 3chy_A 1a0o_A 1cey_A 1bdj_A 1eay_A 1f4v_A 1ffg_A 1ffs_A 1ffw_A 1fqw_A 2b1j_A 1chn_A 1djm_A 1kmi_Y* 1d4z_A 1cye_A 2che_A 2chf_A 2pl9_A* 2pmc_A ...
Probab=99.95  E-value=1.4e-26  Score=177.41  Aligned_cols=118  Identities=26%  Similarity=0.386  Sum_probs=110.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCC-EEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             799973998999999999998898-999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~-~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      ||||||||+.+|..++.+|+.+|| .|.+|.+|.+|++.+.+ ..||+|++||+||+|  .++++++|+.+..+++|||+
T Consensus         6 rILiVDD~~~~r~~l~~~L~~~g~~~v~~a~~g~~a~~~~~~-~~~dliilD~~mP~~dG~el~~~ir~~~~~~~~piI~   84 (128)
T 1jbe_A            6 KFLVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQA-GGYGFVISDWNMPNMDGLELLKTIRAXXAMSALPVLM   84 (128)
T ss_dssp             CEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHTT-CCCCEEEEESCCSSSCHHHHHHHHHC--CCTTCCEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCEEE
T ss_conf             999996989999999999998799689998999999999762-8999999969999999899999999756779993899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      +|++++.+...+++++|+++|+.|||++++|..++++++++.
T Consensus        85 lt~~~~~~~~~~a~~~G~~~~l~KP~~~~~L~~~l~~~l~r~  126 (128)
T 1jbe_A           85 VTAEAKKENIIAAAQAGASGYVVKPFTAATLEEKLNKIFEKL  126 (128)
T ss_dssp             EESSCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             989899999999998799899989899999999999999874


No 29 
>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica}
Probab=99.95  E-value=2.2e-26  Score=176.27  Aligned_cols=125  Identities=20%  Similarity=0.222  Sum_probs=111.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +|||||||++.+|..++..|+ +||+|.+|.||.+|++.+.++..+|+||+|++||++  .++++++|+.  .+++|||+
T Consensus         5 ~rILiVDDd~~~~~~l~~~L~-~~~~v~~a~~g~eAl~~l~~~~~~dlvi~D~~mP~~~G~ell~~ir~~--~~~~~vI~   81 (151)
T 3kcn_A            5 ERILLVDDDYSLLNTLKRNLS-FDFEVTTCESGPEALACIKKSDPFSVIMVDMRMPGMEGTEVIQKARLI--SPNSVYLM   81 (151)
T ss_dssp             CEEEEECSCHHHHHHHHHHHT-TTSEEEEESSHHHHHHHHHHSCCCSEEEEESCCSSSCHHHHHHHHHHH--CSSCEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHH-CCCEEEEECCHHHHHHHHHHCCCCEEEEEECCCCCCCCHHHHHHHHHH--CCCCCEEE
T ss_conf             729999499999999999997-799899988999999999856997099983898898708999999986--89996899


Q ss_pred             EECCCCHHHHHHHHHCC-CCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             96389989999999769-988997698989999999999999999999987
Q gi|254780892|r   80 LLMEVDFEKMIAGARAG-ANSFLLKPFNRETLRFAMRELPQMQKSKDENQF  129 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~G-a~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~  129 (133)
                      +|++++.+...++++.| |++|+.|||+.++|..+++++++.++...+++.
T Consensus        82 lt~~~d~~~~~~a~~~G~a~dyl~KP~~~~~L~~~v~~~l~~~~~~~~~~~  132 (151)
T 3kcn_A           82 LTGNQDLTTAMEAVNEGQVFRFLNKPCQMSDIKAAINAGIKQYDLVTSKEE  132 (151)
T ss_dssp             EECGGGHHHHHHHHHHTCCSEEEESSCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             982599999999996789873786999999999999999999999999999


No 30 
>3h1g_A Chemotaxis protein CHEY homolog; sulfate-bound CHEY, cytoplasm, flagellar rotatio magnesium, metal-binding, phosphoprotein; 1.70A {Helicobacter pylori} PDB: 3gwg_A 3h1e_A 3h1f_A
Probab=99.95  E-value=1.2e-26  Score=177.79  Aligned_cols=118  Identities=24%  Similarity=0.373  Sum_probs=110.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCE-EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7999739989999999999988989-99999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~-v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      ||||||||+.+|+.++..|+.+||+ |.+|.||.+|++.+.++..||+|++||+||++  .++++++|+.+..+++|||+
T Consensus         7 rILiVDD~~~~~~~l~~~L~~~g~~~v~~a~~g~eal~~l~~~~~~dliilD~~mP~~~G~el~~~ir~~~~~~~~pii~   86 (129)
T 3h1g_A            7 KLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGLDLVKKVRSDSRFKEIPIIM   86 (129)
T ss_dssp             CEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHHCTTCCEEEECSCCSSSCHHHHHHHHHTSTTCTTCCEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCHHHHHHHHHCCCCCCCEEEE
T ss_conf             99999288999999999999869969999899999999997379998996221588888799999998375679993999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|++++.+...+++++|+++||.|||++++|..+++++++.
T Consensus        87 lt~~~~~~~~~~a~~~G~~~~l~KP~~~~~L~~~i~~~L~~  127 (129)
T 3h1g_A           87 ITAEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEVVLGT  127 (129)
T ss_dssp             EESCCSHHHHHHHHHHTCCEEEESCCCHHHHHHHHHHHHCC
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             97679999999999869989998989999999999999757


No 31 
>1srr_A SPO0F, sporulation response regulatory protein; aspartate pocket, two component system; 1.90A {Bacillus subtilis} SCOP: c.23.1.1 PDB: 1pey_A 2ftk_E* 1fsp_A 1nat_A 1pux_A 2fsp_A 2jvj_A 2jvk_A 2jvi_A 1f51_E
Probab=99.95  E-value=4.9e-27  Score=180.21  Aligned_cols=118  Identities=20%  Similarity=0.422  Sum_probs=108.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +|||||||++.+|..++..|+.+||+|.+|.||++|++.+.++ .||+|++|++||++  .++++++|+.  .+++|||+
T Consensus         4 ~rILiVDD~~~~~~~l~~~L~~~g~~v~~a~~g~eal~~~~~~-~~dliilD~~mP~~~G~el~~~ir~~--~~~~pii~   80 (124)
T 1srr_A            4 EKILIVDDQSGIRILLNEVFNKEGYQTFQAANGLQALDIVTKE-RPDLVLLDMKIPGMDGIEILKRMKVI--DENIRVII   80 (124)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHH-CCSEEEEESCCTTCCHHHHHHHHHHH--CTTCEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             8599997999999999999998699899959989999999807-99889985369999889999999960--99998999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      +|++++.+...+|+++||++|+.|||+.++|..+++++++.+.
T Consensus        81 lt~~~~~~~~~~a~~~Ga~~~l~KP~~~~~L~~~i~~~L~~~~  123 (124)
T 1srr_A           81 MTAYGELDMIQESKELGALTHFAKPFDIDEIRDAVKKYLPLKS  123 (124)
T ss_dssp             EESSCCHHHHHHHHHHTCCCEEESSCCHHHHHHHHHHHSCC--
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHCC
T ss_conf             9888999999999987998999898999999999999987567


No 32 
>1mb3_A Cell division response regulator DIVK; signal transduction protein, structural proteomics in europe, spine, structural genomics; 1.41A {Caulobacter vibrioides} SCOP: c.23.1.1 PDB: 1m5u_A 1mav_A 1mb0_A 1m5t_A
Probab=99.95  E-value=2.4e-27  Score=182.04  Aligned_cols=119  Identities=13%  Similarity=0.188  Sum_probs=111.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      |||||||||+.+|+.++.+|+.+||+|.+|.+|.+|++.+.++ .||+|++|++||++  .++++++|+.+.++++|||+
T Consensus         2 kriLiVdD~~~~~~~l~~~L~~~g~~v~~a~~g~~al~~~~~~-~pdlillD~~mp~~~G~el~~~ir~~~~~~~iPii~   80 (124)
T 1mb3_A            2 KKVLIVEDNELNMKLFHDLLEAQGYETLQTREGLSALSIAREN-KPDLILMDIQLPEISGLEVTKWLKEDDDLAHIPVVA   80 (124)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESCHHHHHHHHHHH-CCSEEEEESBCSSSBHHHHHHHHHHSTTTTTSCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCCEEE
T ss_conf             7599995899999999999998799999989999999999837-999999789999984799999998288779996899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      +|+++..+...+++++|+++|+.||++.++|..+++++++++
T Consensus        81 ls~~~~~~~~~~~~~~G~~~yl~KP~~~~~L~~~l~~~l~r~  122 (124)
T 1mb3_A           81 VTAFAMKGDEERIREGGCEAYISKPISVVHFLETIKRLLERQ  122 (124)
T ss_dssp             EC------CHHHHHHHTCSEEECSSCCHHHHHHHHHHHHSCC
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             989899899999997799899989899999999999998339


No 33 
>2rjn_A Response regulator receiver:metal-dependent phosphohydrolase, HD subdomain; structural genomics, oceanospirillum SP. MED92, PSI-2; 2.10A {Neptuniibacter caesariensis}
Probab=99.95  E-value=1.6e-26  Score=177.07  Aligned_cols=126  Identities=21%  Similarity=0.238  Sum_probs=114.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +|||||||++..|..++..|+..||+|.+|.||++|++.+.++ .||+||+|++||++  .++++++|+.  .+++|+|+
T Consensus         8 ~~ILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~Al~~l~~~-~~dliilD~~mp~~~G~~~l~~ir~~--~~~~piI~   84 (154)
T 2rjn_A            8 YTVMLVDDEQPILNSLKRLIKRLGCNIITFTSPLDALEALKGT-SVQLVISDMRMPEMGGEVFLEQVAKS--YPDIERVV   84 (154)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHTTTCEEEEESCHHHHHHHHTTS-CCSEEEEESSCSSSCHHHHHHHHHHH--CTTSEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEECCCCCCCCCHHHHHHHHHH--CCCCCEEE
T ss_conf             9899997999999999999998799899989999999998628-99889966888888818999999985--88997899


Q ss_pred             EECCCCHHHHHHHHHCCC-CEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             963899899999997699-889976989899999999999999999999877
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGA-NSFLLKPFNRETLRFAMRELPQMQKSKDENQFL  130 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga-~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~l  130 (133)
                      +|++++.+...+|++.|| ++||.|||+.+.|..+++++++..+.+.++..+
T Consensus        85 lt~~~~~~~~~~ai~~Gavd~yL~KP~~~~~L~~~i~~al~~~~~~~e~~~l  136 (154)
T 2rjn_A           85 ISGYADAQATIDAVNRGKISRFLLKPWEDEDVFKVVEKGLQLAFLREENLRL  136 (154)
T ss_dssp             EECGGGHHHHHHHHHTTCCSEEEESSCCHHHHHHHHHHHHHHHHHHHHTTSC
T ss_pred             EECCCCHHHHHHHHHCCCCCCEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             9866999999999976999877889799999999999999999999999999


No 34 
>1i3c_A Response regulator RCP1; phytochrome, signaling protein; 1.90A {Synechocystis SP} SCOP: c.23.1.1 PDB: 1jlk_A
Probab=99.95  E-value=2.6e-26  Score=175.91  Aligned_cols=119  Identities=18%  Similarity=0.219  Sum_probs=109.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCC--EEEEECCHHHHHHHHHHC------CCCCEEEECCCCCCC--CHHHHHHHHCCC
Q ss_conf             7799973998999999999998898--999999979999999717------999489970789987--738999961434
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGF--MVFEATSVCEAREFCEKE------LLPNYLVIDESMEGV--LEFIAHVRQMPL   71 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~--~v~~a~~g~eAl~~~~~~------~~pdlii~D~~mP~~--~~l~~~ir~~~~   71 (133)
                      ++|||||||+..|+.++..|+..|+  ++.+|.||.+|++.+++.      ..||+||+|++||++  +++++++|+++.
T Consensus         9 ~~ILiVdD~~~~~~~l~~~L~~~g~~~~v~~~~~g~eAl~~l~~~~~~~~~~~pdlillD~~mP~~~G~el~~~ir~~~~   88 (149)
T 1i3c_A            9 KVILLVEDSKADSRLVQEVLKTSTIDHELIILRDGLAAMAFLQQQGEYENSPRPNLILLDLNLPKKDGREVLAEIKQNPD   88 (149)
T ss_dssp             EEEEEECCCHHHHHHHHHHHHSCCSCEEEEEECSHHHHHHHHTTCGGGTTCCCCSEEEECSCCSSSCHHHHHHHHHHCTT
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHCCHHHCCCCCCEEEEECCCCCCCHHHHHHHHHHCCC
T ss_conf             98999979999999999999976998479998999999999985002212689888998489999864999999985804


Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             8897399996389989999999769988997698989999999999999
Q gi|254780892|r   72 GTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        72 ~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      ++++|||++|++++.+...+|+++||++|+.||++.++|..+++++.+.
T Consensus        89 ~~~iPvI~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~i~~~  137 (149)
T 1i3c_A           89 LKRIPVVVLTTSHNEDDVIASYELHVNCYLTKSRNLKDLFKMVQGIESF  137 (149)
T ss_dssp             TTTSCEEEEESCCCHHHHHHHHHTTCSEEEECCSSHHHHHHHHHHHHHH
T ss_pred             CCCCCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             4799889995689999999999879989997989999999999999998


No 35 
>2jk1_A HUPR, hydrogenase transcriptional regulatory protein HUPR1; nucleotide-binding, transcription regulation; 2.10A {Rhodobacter capsulatus} PDB: 2vui_B 2vuh_B
Probab=99.95  E-value=2.1e-26  Score=176.39  Aligned_cols=126  Identities=26%  Similarity=0.333  Sum_probs=111.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEE
Q ss_conf             77999739989999999999988989999999799999997179994899707899877--3899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~   79 (133)
                      .+||||||++.+|..++..|+. ||+|.+|.||++|++.+.++ .||+|++|++||||.  ++++++|+.  .+++|+|+
T Consensus         2 P~ILiVDDd~~~~~~l~~~L~~-g~~v~~a~~~~~al~~~~~~-~~dlvl~D~~mP~~~G~ell~~ir~~--~~~~~vI~   77 (139)
T 2jk1_A            2 PAILLVDDEPHSLAAMKLALED-DFDVLTAQGAEAAIAILEEE-WVQVIICDQRMPGRTGVDFLTEVRER--WPETVRII   77 (139)
T ss_dssp             CEEEEECSSHHHHHHHHHHHTT-TSCEEEESSHHHHHHHHHHS-CEEEEEEESCCSSSCHHHHHHHHHHH--CTTSEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHC-CCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             9999994999999999999987-99999989999999999728-99999985567898559999999981--89995899


Q ss_pred             EECCCCHHHHHHHHH-CCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             963899899999997-6998899769898999999999999999999998775
Q gi|254780892|r   80 LLMEVDFEKMIAGAR-AGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLD  131 (133)
Q Consensus        80 lT~~~~~~~~~~a~~-~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~l~  131 (133)
                      +|++++.+...+++. .||++||.|||++++|..+++++++..+...+++.+.
T Consensus        78 lt~~~~~~~~~~a~~~~Ga~dyl~KP~~~~~L~~~v~~~~~~~~~~~e~~~l~  130 (139)
T 2jk1_A           78 ITGYTDSASMMAAINDAGIHQFLTKPWHPEQLLSSARNAARMFTLARENERLS  130 (139)
T ss_dssp             EESCTTCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98979989999999985998089899999999999999999999999999999


No 36 
>2qxy_A Response regulator; regulation of transcription, NYSGXRC, protein structure initiative II (PSI II), structural genomics; 1.95A {Thermotoga maritima}
Probab=99.95  E-value=1.2e-26  Score=177.96  Aligned_cols=117  Identities=26%  Similarity=0.336  Sum_probs=107.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .+||||||++.+|..++.+|+.+||+|.+|.||++|++.+.+ ..||+||+|+ |||+  +++++++|+.  .+++|||+
T Consensus         5 p~ILiVDD~~~~~~~l~~~L~~~G~~v~~a~~g~eal~~l~~-~~~dlvllD~-mp~~dGl~l~~~ir~~--~~~~piI~   80 (142)
T 2qxy_A            5 PTVMVVDESRITFLAVKNALEKDGFNVIWAKNEQEAFTFLRR-EKIDLVFVDV-FEGEESLNLIRRIREE--FPDTKVAV   80 (142)
T ss_dssp             CEEEEECSCHHHHHHHHHHHGGGTCEEEEESSHHHHHHHHTT-SCCSEEEEEC-TTTHHHHHHHHHHHHH--CTTCEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEEECC-CCCHHHHHHHHHHHHH--CCCCCEEE
T ss_conf             969999898999999999999879999998999999999985-7999998547-8631289999999986--89997899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      +|++++.+...+|+++||+||+.|||+.++|..+++++++..+
T Consensus        81 lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~~  123 (142)
T 2qxy_A           81 LSAYVDKDLIINSVKAGAVDYILKPFRLDYLLERVKKIISSTP  123 (142)
T ss_dssp             EESCCCHHHHHHHHHHTCSCEEESSCCHHHHHHHHHHHHHC--
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             9735888999999976897899798999999999999985681


No 37 
>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa PAO1} PDB: 3i5a_A*
Probab=99.95  E-value=1.3e-26  Score=177.61  Aligned_cols=117  Identities=22%  Similarity=0.240  Sum_probs=108.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHH-CCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEE
Q ss_conf             799973998999999999998-8989999999799999997179994899707899877--3899996143488973999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFND-FGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~-~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~   79 (133)
                      +||||||++.++..++..|.. .||+|..|.||.+|++.+.+ ..||+||+||+||+|.  ++|+.+|+++.++++|||+
T Consensus        20 ~ILiVDD~~~~~~~l~~~L~~~~g~~v~~a~~g~eal~~~~~-~~pDlvllD~~mP~~dGlel~~~iR~~~~~~~~pii~   98 (358)
T 3bre_A           20 MVLLVDDQAMIGEAVRRSLASEAGIDFHFCSDPQQAVAVANQ-IKPTVILQDLVMPGVDGLTLLAAYRGNPATRDIPIIV   98 (358)
T ss_dssp             EEEEECSCTTHHHHHHTTSSSCTTEEEEEECCHHHHHHHHHH-HCCSEEEEESBCSSSBHHHHHHHHTTSTTTTTSCEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHH-CCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             799995999999999999853488399998999999999984-4999999808889999999999997364557962999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|++++.+...+|++.||+||+.||++..++..+++..+..
T Consensus        99 lt~~~d~~~~~~al~~Ga~Dfl~KP~~~~el~~~~~~~l~~  139 (358)
T 3bre_A           99 LSTKEEPTVKSAAFAAGANDYLVKLPDAIELVARIRYHSRS  139 (358)
T ss_dssp             EESSCCHHHHHHHHHTTCSEEEESCCCHHHHHHHHHHHHHH
T ss_pred             ECCCCHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHCCC
T ss_conf             63540267888762256534631587637777777641011


No 38 
>3f6p_A Transcriptional regulatory protein YYCF; unphosphorelated, receiver domain, cytoplasm, DNA-binding, phosphoprotein, transcription regulation; 1.95A {Bacillus subtilis} PDB: 2zwm_A
Probab=99.95  E-value=1.8e-26  Score=176.82  Aligned_cols=115  Identities=22%  Similarity=0.310  Sum_probs=105.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +||||||||+.+|..++..|+.+||+|.+|.||.+|++.+.+ ..||+||+|++|||+  +++++++|+   .+++|+|+
T Consensus         3 krILiVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~l~~-~~~dlii~D~~mP~~~G~e~~~~~r~---~~~~~ii~   78 (120)
T 3f6p_A            3 KKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVEE-LQPDLILLDIMLPNKDGVEVCREVRK---KYDMPIIM   78 (120)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHT-TCCSEEEEETTSTTTHHHHHHHHHHT---TCCSCEEE
T ss_pred             CCEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHH---CCCCCEEE
T ss_conf             719999399999999999999889999998999999999971-89999998299999999999999981---68995899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|++++.+...+|+++||++|+.|||+.++|..++++++++
T Consensus        79 lt~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~lrR  119 (120)
T 3f6p_A           79 LTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLRR  119 (120)
T ss_dssp             EEESSCHHHHHHHHHTTCCEEEEESCCHHHHHHHHHHHHTC
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             97679999999999759998997999999999999999767


No 39 
>3heb_A Response regulator receiver domain protein (CHEY); NYSGXRC, PSI-II, respose regulator, protein structure initiative; 2.40A {Rhodospirillum rubrum atcc 11170}
Probab=99.94  E-value=4.6e-26  Score=174.38  Aligned_cols=118  Identities=16%  Similarity=0.203  Sum_probs=108.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCC--EEEEECCHHHHHHHHH--------HCCCCCEEEECCCCCCC--CHHHHHHHHC
Q ss_conf             7799973998999999999998898--9999999799999997--------17999489970789987--7389999614
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGF--MVFEATSVCEAREFCE--------KELLPNYLVIDESMEGV--LEFIAHVRQM   69 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~--~v~~a~~g~eAl~~~~--------~~~~pdlii~D~~mP~~--~~l~~~ir~~   69 (133)
                      .+|||||||+.+++.++..|+.+||  +|.+|.||.+|++.+.        ....||+||+|++||++  +++++++|+.
T Consensus         5 ~~ILiVDDd~~~~~~l~~~L~~~g~~~~v~~a~~g~eAl~~l~~~~~~~~~~~~~~dlIilD~~mP~~dG~el~~~ir~~   84 (152)
T 3heb_A            5 VTIVMIEDDLGHARLIEKNIRRAGVNNEIIAFTDGTSALNYLFGDDKSGRVSAGRAQLVLLDLNLPDMTGIDILKLVKEN   84 (152)
T ss_dssp             CEEEEECCCHHHHHHHHHHHHHTTCCCCEEEESSHHHHHHHHHCTTSSSGGGTTCBEEEEECSBCSSSBHHHHHHHHHHS
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHCCHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHC
T ss_conf             65999979999999999999977996389997888999999843204556650699989986899999889999999848


Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             34889739999638998999999976998899769898999999999999
Q gi|254780892|r   70 PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        70 ~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      +..+.+|||++|++++.+...+|+++||++|+.||++.++|..+++++..
T Consensus        85 ~~~~~iPvI~lTa~~~~~~~~~a~~~G~~~yl~KP~~~~~L~~~i~~l~~  134 (152)
T 3heb_A           85 PHTRRSPVVILTTTDDQREIQRCYDLGANVYITKPVNYENFANAIRQLGL  134 (152)
T ss_dssp             TTTTTSCEEEEESCCCHHHHHHHHHTTCSEEEECCSSHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             77799958999776999999999986998999798999999999999999


No 40 
>2jba_A Phosphate regulon transcriptional regulatory protein PHOB; transcription factor, sensory transduction, phosphate regulation; 1.45A {Escherichia coli} PDB: 2jba_B 1b00_A 2iyn_A 2jb9_A 1zes_A
Probab=99.94  E-value=2.7e-27  Score=181.70  Aligned_cols=118  Identities=21%  Similarity=0.353  Sum_probs=111.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +||||||||+.+|..++..|+.+||+|..|.+|++|++.+.+ ..||+||+|+.||++  +++++++|+++..+++|||+
T Consensus         3 ~rILiVDDd~~~~~~l~~~L~~~G~~v~~a~~~~~al~~l~~-~~~dlii~D~~mp~~~G~~l~~~ir~~~~~~~~piI~   81 (127)
T 2jba_A            3 RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQLNE-PWPDLILLAWMLPGGSGIQFIKHLRRESMTRDIPVVM   81 (127)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEECSHHHHHTTCSS-SCCSEEEEESEETTEEHHHHHHHHHTSTTTTTSCEEE
T ss_pred             CCEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCCEEE
T ss_conf             889999799999999999999879999998999999999971-7999999818899962899999998478779990999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|++++.+...+++++||++|+.|||++.+|..++++++++
T Consensus        82 ls~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~r  122 (127)
T 2jba_A           82 LTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMRR  122 (127)
T ss_dssp             EEETTHHHHHHTTCCCSCSEEEEESCCHHHHHHHHHHHHHC
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             98989999999999849858771999999999999999815


No 41 
>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y
Probab=99.94  E-value=2.4e-26  Score=176.12  Aligned_cols=114  Identities=22%  Similarity=0.350  Sum_probs=105.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             7799973998999999999998898999-999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      +|||||||++.+|..++.+|+.+||+|. +|.||.+|++.+.++ .||+|++|++||++  .++++++|+.  .+++|||
T Consensus         3 ~rILiVDD~~~~r~~l~~~L~~~g~~v~~~a~~g~~al~~~~~~-~~dlii~D~~mP~~~G~e~~~~ir~~--~~~~~ii   79 (120)
T 1tmy_A            3 KRVLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKEL-KPDIVTMDITMPEMNGIDAIKEIMKI--DPNAKII   79 (120)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHH-CCSEEEEECSCGGGCHHHHHHHHHHH--CTTCCEE
T ss_pred             CCEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEE
T ss_conf             86999919999999999999987998999989999999999836-99999996368999799999999975--8799789


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
                      ++|++++.+...+++++||++|+.|||++++|..+++++.
T Consensus        80 ~lt~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~l~~v~  119 (120)
T 1tmy_A           80 VCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKVS  119 (120)
T ss_dssp             EEECTTCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHC
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHC
T ss_conf             9974289999999998699899979899999999999970


No 42 
>1zgz_A Torcad operon transcriptional regulatory protein TORR; two-component system, gene regulation, transcription factor, TMAO respiratory system; 1.80A {Escherichia coli} SCOP: c.23.1.1
Probab=99.94  E-value=6.9e-26  Score=173.36  Aligned_cols=116  Identities=16%  Similarity=0.248  Sum_probs=106.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEE
Q ss_conf             77999739989999999999988989999999799999997179994899707899877--3899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~   79 (133)
                      .||||||||+.++..++..|+.+||+|..|.||.+|++.+.++ .||+||+|++|||+.  ++++++|.   .+++|+|+
T Consensus         3 ~~ILvVDD~~~~~~~l~~~L~~~g~~v~~a~~~~~a~~~l~~~-~~dliilD~~mP~~dG~e~~~~~r~---~~~~piI~   78 (122)
T 1zgz_A            3 HHIVIVEDEPVTQARLQSYFTQEGYTVSVTASGAGLREIMQNQ-SVDLILLDINLPDENGLMLTRALRE---RSTVGIIL   78 (122)
T ss_dssp             CEEEEECSSHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHS-CCSEEEEESCCSSSCHHHHHHHHHT---TCCCEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEEECCCCCCCHHHHHHHHHH---CCCCCEEE
T ss_conf             7299994999999999999998799999989999999999739-9989999789899772899999984---79993999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      +|++++.+...+|+++||++|+.|||+.++|..++++++++.
T Consensus        79 lt~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~R~  120 (122)
T 1zgz_A           79 VTGRSDRIDRIVGLEMGADDYVTKPLELRELVVRVKNLLWRI  120 (122)
T ss_dssp             EESSCCHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             983699999999998699899979899999999999999872


No 43 
>1dbw_A Transcriptional regulatory protein FIXJ; doubly wound five-stranded beta/alpha fold, nitrogen fixation regulation; HET: 15P; 1.60A {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1dck_A* 1dcm_A 1d5w_A*
Probab=99.94  E-value=2.8e-26  Score=175.65  Aligned_cols=117  Identities=21%  Similarity=0.267  Sum_probs=107.9

Q ss_pred             CC--EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCE
Q ss_conf             97--7999739989999999999988989999999799999997179994899707899877--3899996143488973
Q gi|254780892|r    1 MD--SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVF   76 (133)
Q Consensus         1 m~--~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~p   76 (133)
                      |+  |||||||++..|..++..|+.+||+|..|.||++|++.+.+ ..||+|++|++||||.  ++++++|..  .+++|
T Consensus         1 M~~~~ILiVDDd~~~r~~l~~~L~~~g~~v~~a~~~~~al~~~~~-~~~dlvi~D~~mP~~~G~~ll~~ir~~--~~~~p   77 (126)
T 1dbw_A            1 MQDYTVHIVDDEEPVRKSLAFMLTMNGFAVKMHQSAEAFLAFAPD-VRNGVLVTDLRMPDMSGVELLRNLGDL--KINIP   77 (126)
T ss_dssp             CCCCEEEEEESSHHHHHHHHHHHHHTTCEEEEESCHHHHHHHGGG-CCSEEEEEECCSTTSCHHHHHHHHHHT--TCCCC
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEECCCCCCCCCCHHHHHHHHHH--CCCCE
T ss_conf             999989999699999999999999879999998999999999763-799879710368888829999999961--99983


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             99996389989999999769988997698989999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|++|++++.+...+|+++||++|+.|||+.+.|..++++++++
T Consensus        78 vI~lT~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~a~~~  121 (126)
T 1dbw_A           78 SIVITGHGDVPMAVEAMKAGAVDFIEKPFEDTVIIEAIERASEH  121 (126)
T ss_dssp             EEEEECTTCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHHTT
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             99996889999999999879988998969999999999999999


No 44 
>3eq2_A Probable two-component response regulator; adaptor sigmas, signaling protein; 3.40A {Pseudomonas aeruginosa} PDB: 3f7a_A
Probab=99.94  E-value=4.1e-26  Score=174.71  Aligned_cols=124  Identities=24%  Similarity=0.376  Sum_probs=106.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .+||||||++.+|..++.+|+.+||+|..|.+|.+|++.+.++ .||+||+|++||+|  .++++++|+.  .+++|||+
T Consensus         6 atiLiVDD~~~~~~~l~~~L~~~g~~v~~a~~~~~al~~~~~~-~~dlvl~D~~mP~~~G~e~~~~i~~~--~~~~pvi~   82 (394)
T 3eq2_A            6 ATLLIIDDDEVVRESLAAYLEDSNFKVLQALNGLQGLQIFESE-QPDLVICDLRMPQIDGLELIRRIRQT--ASETPIIV   82 (394)
T ss_dssp             EEEEEECSCHHHHHHHHHHHHHTTEEEEECSSHHHHHHHHHHS-CCSEEEECCCSSSSCTHHHHHHHHHT--TCCCCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEEECCCCCCCHHHHHHHHHHC--CCCCCEEE
T ss_conf             6599997999999999999997899999989999999998638-99999998978999899999999853--99983899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHH-HHHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999-999999999999999998
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETL-RFAMRELPQMQKSKDENQ  128 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L-~~~i~~~~~~~~~~~~~~  128 (133)
                      +|+.++.+...+++++||+||+.||+...++ ..++++.++..+...+++
T Consensus        83 lt~~~~~~~~~~~l~~Ga~dyl~KP~~~~~~~~~~i~~~l~~~~~~~~~~  132 (394)
T 3eq2_A           83 LSGAGVMSDAVEALRLGAADYLIKPLEDLAVLEHSVRRALDRAYLRVENQ  132 (394)
T ss_dssp             C---CHHHHHHHHHHHTCSEECCSSCSCTHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEECCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             98058789999999769720897799867999999998765776654334


No 45 
>3grc_A Sensor protein, kinase; protein structure initiative II(PSI II), NYSGXRC, 11025B, structural genomics; 2.21A {Polaromonas SP}
Probab=99.94  E-value=2e-26  Score=176.61  Aligned_cols=123  Identities=11%  Similarity=0.137  Sum_probs=110.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .||||||||+.+|+.++..|+.+||+|..|.||++|++.+.++ .||+||+|++||++  +++++++|+.+..+++|||+
T Consensus         7 ~rILiVDD~~~~~~~l~~~L~~~G~~v~~a~~~~eAl~~l~~~-~~dlvilD~~mP~~dG~~l~~~ir~~~~~~~~pii~   85 (140)
T 3grc_A            7 PRILICEDDPDIARLLNLMLEKGGFDSDMVHSAAQALEQVARR-PYAAMTVDLNLPDQDGVSLIRALRRDSRTRDLAIVV   85 (140)
T ss_dssp             SEEEEECSCHHHHHHHHHHHHHTTCEEEEECSHHHHHHHHHHS-CCSEEEECSCCSSSCHHHHHHHHHTSGGGTTCEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCCEEE
T ss_conf             7799996999999999999998799999989999999999718-998998536689997899999998472569997899


Q ss_pred             EECCCCHH-HHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHH
Q ss_conf             96389989-99999976998899769898999999999999999999
Q gi|254780892|r   80 LLMEVDFE-KMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKD  125 (133)
Q Consensus        80 lT~~~~~~-~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~  125 (133)
                      +|+++... ...++.+.|+++||.|||+++.|..+++++++......
T Consensus        86 lt~~~~~~~~~~~a~~~G~~~~L~KP~~~~~L~~~l~~~l~~~~~~k  132 (140)
T 3grc_A           86 VSANAREGELEFNSQPLAVSTWLEKPIDENLLILSLHRAIDNMAEGK  132 (140)
T ss_dssp             ECTTHHHHHHHHCCTTTCCCEEECSSCCHHHHHHHHHHHHHHHC---
T ss_pred             EECCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHCC
T ss_conf             96678758999999977998899898999999999999986077538


No 46 
>3hdg_A Uncharacterized protein; two-component sensor activity, response regulator, PSI-II, 11227F, NYSGXRC, structural genomics; 2.27A {Wolinella succinogenes}
Probab=99.94  E-value=3.6e-26  Score=175.02  Aligned_cols=118  Identities=17%  Similarity=0.277  Sum_probs=107.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             799973998999999999998898999999979999999717999489970789987--738999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~l   80 (133)
                      |||||||++.+|+.++.+|+.+||+|.+|.||++|++.+.+. .||+||+|++||++  +++++++|+.  .+++|||++
T Consensus         9 kVLiVDDd~~~~~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~-~~DlvilD~~mP~~dG~el~~~ir~~--~~~~piI~l   85 (137)
T 3hdg_A            9 KILIVEDDTDAREWLSTIISNHFPEVWSAGDGEEGERLFGLH-APDVIITDIRMPKLGGLEMLDRIKAG--GAKPYVIVI   85 (137)
T ss_dssp             CEEEECSCHHHHHHHHHHHHTTCSCEEEESSHHHHHHHHHHH-CCSEEEECSSCSSSCHHHHHHHHHHT--TCCCEEEEC
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEEE
T ss_conf             899995889999999999996799999989999999998747-99899973789999899999999950--989958999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             6389989999999769988997698989999999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      |++++.+...+|+++||++|+.||+++++|..+++++.+.+..
T Consensus        86 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~  128 (137)
T 3hdg_A           86 SAFSEMKYFIKAIELGVHLFLPKPIEPGRLMETLEDFRHIKLA  128 (137)
T ss_dssp             CCCCCHHHHHHHHHHCCSEECCSSCCHHHHHHHHHHHHHHHHH
T ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHH
T ss_conf             8989999999999869989997989999999999999989998


No 47 
>3kht_A Response regulator; PSI-II, structural genomics, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.10A {Hahella chejuensis kctc 2396}
Probab=99.94  E-value=1e-25  Score=172.37  Aligned_cols=119  Identities=13%  Similarity=0.061  Sum_probs=108.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEE
Q ss_conf             779997399899999999999889--8999999979999999717999489970789987--738999961434889739
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pi   77 (133)
                      +||||||||+.++..++++|+.+|  +++..|.||.+|++.+.+ ..||+|++|++||++  +++++++|+.+..+.+||
T Consensus         6 krILlVdD~~~~~~~l~~~L~~~g~~~~v~~a~~g~~Al~~l~~-~~~dliilD~~mP~~~G~el~~~ir~~~~~~~iPi   84 (144)
T 3kht_A            6 KRVLVVEDNPDDIALIRRVLDRKDIHCQLEFVDNGAKALYQVQQ-AKYDLIILDIGLPIANGFEVMSAVRKPGANQHTPI   84 (144)
T ss_dssp             EEEEEECCCHHHHHHHHHHHHHTTCCEEEEEESSHHHHHHHHTT-CCCSEEEECTTCGGGCHHHHHHHHHSSSTTTTCCE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHH-CCCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCCE
T ss_conf             98999958999999999999968998299998999999999971-79999998699999999999999983787899918


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHHHHHHH
Q ss_conf             99963899899999997699889976989-899999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRELPQMQ  121 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~-~~~L~~~i~~~~~~~  121 (133)
                      |++|+.++.+...+|+++||++|+.||++ .++|..+++.++++.
T Consensus        85 I~lS~~~~~~~~~~a~~~Ga~~~l~KP~~~~~eL~~~i~~~l~~~  129 (144)
T 3kht_A           85 VILTDNVSDDRAKQCMAAGASSVVDKSSNNVTDFYGRIYAIFSYW  129 (144)
T ss_dssp             EEEETTCCHHHHHHHHHTTCSEEEECCTTSHHHHHHHHHHHHHHH
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             999888999999999986999999699999999999999999986


No 48 
>3lte_A Response regulator; structural genomics, PSI, protein structure initiative, nysgrc, NEW YORK structural genomix research consortium; 2.00A {Bermanella marisrubri}
Probab=99.94  E-value=6.7e-26  Score=173.42  Aligned_cols=118  Identities=20%  Similarity=0.285  Sum_probs=103.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      |||||||||+.+|..++.+|+.+||+|.+|.||.+|++.+.+ ..||+|++|+.||++  +++++++|+.+....+|| +
T Consensus         7 krILiVDDd~~~~~~l~~~L~~~g~~v~~a~~g~eal~~l~~-~~pdlillD~~mP~~dG~el~~~ir~~~~~~~~~I-i   84 (132)
T 3lte_A            7 KRILVVDDDQAMAAAIERVLKRDHWQVEIAHNGFDAGIKLST-FEPAIMTLDLSMPKLDGLDVIRSLRQNKVANQPKI-L   84 (132)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHH-TCCSEEEEESCBTTBCHHHHHHHHHTTTCSSCCEE-E
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCE-E
T ss_conf             869999799999999999999889999998899999999974-79999999689878889999999984588898918-9


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      +|+..+.+...+|+++||++|+.|||+.++|..++++++++-
T Consensus        85 l~s~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~ll~~G  126 (132)
T 3lte_A           85 VVSGLDKAKLQQAVTEGADDYLEKPFDNDALLDRIHDLVNEG  126 (132)
T ss_dssp             EECCSCSHHHHHHHHHTCCEEECSSCCHHHHHHHHHHHHC--
T ss_pred             EEECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             995599999999998799899989899999999999999578


No 49 
>3dzd_A Transcriptional regulator (NTRC family); sigma43 activator, AAA+ ATPase, response regulator, transcriptional activator, ATP-binding; HET: ADP; 2.40A {Aquifex aeolicus} PDB: 1zit_A 2jrl_A
Probab=99.94  E-value=8.1e-26  Score=172.94  Aligned_cols=118  Identities=19%  Similarity=0.274  Sum_probs=109.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      ||||||||++.+|..++..|+..||+|..|.|+.+|++.+.+. .||+||+|+.||++  .++++++|..  .+++|||+
T Consensus         1 kRILIVDDd~~i~~~l~~~L~~~G~~V~~a~s~~eAl~~l~~~-~~DlvllDl~mP~~dGlell~~ir~~--~p~~pVIv   77 (368)
T 3dzd_A            1 KRVLVVDDEESITSSLSAILEEEGYHPDTAKTLREAEKKIKEL-FFPVIVLDVWMPDGDGVNFIDFIKEN--SPDSVVIV   77 (368)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHB-CCSEEEEESEETTEETTTHHHHHHHH--CTTCEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHC--CCCCCCCC
T ss_conf             9699992899999999999997799899979999999998717-99999997989999999999999963--99875445


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      +|++++.+...+|++.||.||+.|||+.++|..+++++++..+
T Consensus        78 lT~~~~~~~av~Al~~GA~Dyl~KP~~~~~L~~~I~~ale~~~  120 (368)
T 3dzd_A           78 ITGHGSVDTAVKAIKKGAYEFLEKPFSVERFLLTIKHAFEEYS  120 (368)
T ss_dssp             EECSSCCHHHHHHHHHTCCEEEESSCCHHHHHHHHHHHHHHHS
T ss_pred             CCCCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHHH
T ss_conf             5677999999999974876320588537999999999999997


No 50 
>2r25_B Osmosensing histidine protein kinase SLN1; alpha5-BETA5, response regulator, four helix bundle, histidine phosphotransfer (HPT) protein; 1.70A {Saccharomyces cerevisiae} SCOP: c.23.1.1 PDB: 1oxk_B 1oxb_B
Probab=99.94  E-value=1.3e-25  Score=171.71  Aligned_cols=118  Identities=21%  Similarity=0.172  Sum_probs=105.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCE-EEEECCHHHHHHHHHH----CCCCCEEEECCCCCCCC--HHHHHHHHCCCCCC
Q ss_conf             77999739989999999999988989-9999997999999971----79994899707899877--38999961434889
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEK----ELLPNYLVIDESMEGVL--EFIAHVRQMPLGTD   74 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~-v~~a~~g~eAl~~~~~----~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~   74 (133)
                      -||||||||+.+|+.++.+|+.+||+ |..|.||.+|++.+.+    +..||+|++|++||+|.  ++++.+|+... ..
T Consensus         3 irVLiVDD~~~~~~~l~~~L~~~g~~~v~~a~~g~eal~~l~~~~~~~~~~dlil~D~~MP~~dG~~~~~~ir~~~~-~~   81 (133)
T 2r25_B            3 VKILVVEDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLSTKMIRRDLG-YT   81 (133)
T ss_dssp             SCEEEECSCHHHHHHHHHHHHHTTCCCEEEESSHHHHHHHHHHHHHHTCCCSEEEECSCCSSSCHHHHHHHHHHHSC-CC
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCCCCEEEECCCCCCCCHHHHHHHHHHCCC-CC
T ss_conf             88999969899999999999986994899989999999999874213689888997388899889999999986489-99


Q ss_pred             CEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             7399996389989999999769988997698989999999999999
Q gi|254780892|r   75 VFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        75 ~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|||++|++++.+...+++++|+++||.|||+.++|..+++++...
T Consensus        82 ~piI~lta~~~~~~~~~~~~~G~~~~l~KP~~~~~L~~~l~~~~~~  127 (133)
T 2r25_B           82 SPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEFCAA  127 (133)
T ss_dssp             SCEEEEESCCSHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHCTT
T ss_pred             CCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             9289997469999999999869988997989999999999999999


No 51 
>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV}
Probab=99.94  E-value=8.5e-26  Score=172.81  Aligned_cols=119  Identities=24%  Similarity=0.279  Sum_probs=108.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHC--CCCCCCEEE
Q ss_conf             799973998999999999998898999999979999999717999489970789987--7389999614--348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQM--PLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~--~~~~~~pii   78 (133)
                      ||||||||+.+|..++++|+.+||+|.+|.+|++|++.+.++ .||+|++|++||++  .++++++|..  +..+.+|||
T Consensus        16 rILiVDD~~~~r~~l~~~L~~~g~~v~~a~~~~~al~~l~~~-~~dlii~D~~mp~~~G~el~~~ir~~~~~~~~~~pii   94 (143)
T 3m6m_D           16 RMLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDAMAEE-DYDAVIVDLHMPGMNGLDMLKQLRVMQASGMRYTPVV   94 (143)
T ss_dssp             EEEEECSSHHHHHHHHHHHHC--CEEEEESSHHHHHHHHHHS-CCSEEEEESCCSSSCHHHHHHHHHHHHHTTCCCCCEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCEEE
T ss_conf             799995889999999999998799999989999999997528-9999998388899988999999986284335899399


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      ++|++++.+...+++++|+++|+.|||+.++|..++.++....+
T Consensus        95 ~lt~~~~~~~~~~~~~~G~~~~l~KP~~~~~L~~~l~~l~~~~r  138 (143)
T 3m6m_D           95 VLSADVTPEAIRACEQAGARAFLAKPVVAAKLLDTLADLAVSTR  138 (143)
T ss_dssp             EEESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHHC----
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             99788999999999986998899798999999999999998246


No 52 
>3b2n_A Uncharacterized protein Q99UF4; structural genomics, PSI-2, protein structure initiative; 2.04A {Staphylococcus aureus}
Probab=99.94  E-value=8.2e-26  Score=172.89  Aligned_cols=119  Identities=19%  Similarity=0.305  Sum_probs=108.1

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCC-CEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCE
Q ss_conf             9779997399899999999999889-8999-999979999999717999489970789987--73899996143488973
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFG-FMVF-EATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVF   76 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g-~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~p   76 (133)
                      |+|||||||++.+|..++.+|+.+| |+|. +|.||.+|++.+.+. .||+|++|++||++  +++++++|+.  .+++|
T Consensus         3 m~~ILIvDD~~~~r~~l~~~L~~~~~~~vv~~a~~g~eal~~~~~~-~pDlvllDi~mP~~~G~e~~~~ir~~--~~~~~   79 (133)
T 3b2n_A            3 LTSLIIAEDQNMLRQAMVQLIKLHGDFEILADTDNGLDAMKLIEEY-NPNVVILDIEMPGMTGLEVLAEIRKK--HLNIK   79 (133)
T ss_dssp             CEEEEEECSCHHHHHHHHHHHHHHSSEEEEEEESCHHHHHHHHHHH-CCSEEEECSSCSSSCHHHHHHHHHHT--TCSCE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCC
T ss_conf             9999999299999999999998689969999989999999999856-99999995778999889999999986--89996


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9999638998999999976998899769898999999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      ||++|++++.+...+++++||++|+.||++.++|..+++++.+.++
T Consensus        80 vI~lT~~~~~~~~~~a~~~Ga~~yl~Kp~~~~~L~~~I~~v~~g~k  125 (133)
T 3b2n_A           80 VIIVTTFKRPGYFEKAVVNDVDAYVLKERSIEELVETINKVNNGEK  125 (133)
T ss_dssp             EEEEESCCCHHHHHHHHHTTCSEEEETTSCHHHHHHHHHHHHC---
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCCC
T ss_conf             8999678999999999987997899799999999999999997188


No 53 
>3eod_A Protein HNR; response regulator, phosphoprotein, two-component regulatory system, signaling protein; 1.75A {Escherichia coli K12}
Probab=99.94  E-value=8.7e-26  Score=172.74  Aligned_cols=116  Identities=21%  Similarity=0.341  Sum_probs=106.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +|||||||++.+|..++..|+.+||+|.+|.||.+|++.+.+ ..||+|++|++||++  .++++++|+.  .+++|||+
T Consensus         8 ~kILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~~Al~~l~~-~~~dlvi~D~~mP~~dG~~~~~~ir~~--~~~~piI~   84 (130)
T 3eod_A            8 KQILIVEDEQVFRSLLDSWFSSLGATTVLAADGVDALELLGG-FTPDLMICDIAMPRMNGLKLLEHIRNR--GDQTPVLV   84 (130)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESCHHHHHHHHTT-CCCSEEEECCC-----CHHHHHHHHHT--TCCCCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEHHHHCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             989999698999999999999889999998999999999852-898874574217999899999999960--98998999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989-89999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRELPQM  120 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~-~~~L~~~i~~~~~~  120 (133)
                      +|++++.+...+|+++||++|+.|||. .+.|...+++++..
T Consensus        85 lt~~~~~~~~~~a~~~Ga~~~l~KP~~~~~~L~~~i~~~L~~  126 (130)
T 3eod_A           85 ISATENMADIAKALRLGVEDVLLKPVKDLNRLREMVFACLYP  126 (130)
T ss_dssp             EECCCCHHHHHHHHHHCCSEEEESCC---CHHHHHHHHHHC-
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHHH
T ss_conf             989999999999998699889979999799999999998517


No 54 
>1ny5_A Transcriptional regulator (NTRC family); AAA+ ATPase, sigma54 activator, bacterial transcription, dimer; HET: ADP; 2.40A {Aquifex aeolicus} SCOP: c.23.1.1 c.37.1.20 PDB: 1ny6_A* 1zy2_A*
Probab=99.94  E-value=4.2e-25  Score=168.69  Aligned_cols=125  Identities=18%  Similarity=0.275  Sum_probs=113.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEEE
Q ss_conf             7999739989999999999988989999999799999997179994899707899877--38999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~l   80 (133)
                      |||||||++..+..++.+|+..||+|..|.||.+|++.+.++ .||+||+|+.||||.  ++++++|..  .+++|||++
T Consensus         2 rILiVDDd~~~~~~l~~~L~~~G~~V~~a~s~~eAl~~l~~~-~~DlVllDl~mP~~dGlell~~lr~~--~p~~pVIvl   78 (387)
T 1ny5_A            2 NVLVIEDDKVFRGLLEEYLSMKGIKVESAERGKEAYKLLSEK-HFNVVLLDLLLPDVNGLEILKWIKER--SPETEVIVI   78 (387)
T ss_dssp             EEEEECCCHHHHHHHHHHHHHHTCEEEEESSHHHHHHHHHHS-CCSEEEEESBCSSSBHHHHHHHHHHH--CTTSEEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEEECCCCCCCHHHHHHHHHHC--CCCCCEEEE
T ss_conf             799994889999999999997799999989999999998618-99889995999999999999999844--999828995


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             63899899999997699889976989899999999999999999999877
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL  130 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~~l  130 (133)
                      |++++.+...+|++.||.||+.||++.+.|..++.+.....+.+..++.+
T Consensus        79 Tg~~~~~~a~~A~~~GA~dyl~KP~~~~~L~~~i~~a~~~~~~~~~~~~l  128 (387)
T 1ny5_A           79 TGHGTIKTAVEAMKMGAYDFLTKPCMLEEIELTINKAIEHRKLRKENELL  128 (387)
T ss_dssp             EETTCHHHHHHHHTTTCCEEEEESCCHHHHHHHHHHHHHHHHHHHHHHHH
T ss_pred             ECCCCHHHHHHHHHCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             05541343544441476531258720256777887667788888778887


No 55 
>2qvg_A Two component response regulator; NYSGXRC, PSI-2, structural genomics, protein structure initiative; 1.50A {Legionella pneumophila subsp}
Probab=99.94  E-value=1.2e-25  Score=171.89  Aligned_cols=117  Identities=16%  Similarity=0.224  Sum_probs=106.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCC--CEEEEECCHHHHHHHHHH-----CCCCCEEEECCCCCCC--CHHHHHHHHCCCCC
Q ss_conf             79997399899999999999889--899999997999999971-----7999489970789987--73899996143488
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEK-----ELLPNYLVIDESMEGV--LEFIAHVRQMPLGT   73 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g--~~v~~a~~g~eAl~~~~~-----~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~   73 (133)
                      ||||||||+.+++.++++|+.+|  |+|.+|.||++|++.+.+     ...||+|++|++||++  .++++++|+.+.++
T Consensus         9 ~ILiVDD~~~~~~~l~~~L~~~g~~~~v~~a~~g~eAl~~l~~~~~~~~~~~dliilD~~mP~~~G~el~~~ir~~~~~~   88 (143)
T 2qvg_A            9 DILYLEDDEVDIQSVERVFHKISSLIKIEIAKSGNQALDMLYGRNKENKIHPKLILLDINIPKMNGIEFLKELRDDSSFT   88 (143)
T ss_dssp             SEEEECCCHHHHHHHHHHHHHHCTTCCEEEESSHHHHHHHHHTCTTCCCCCCSEEEEETTCTTSCHHHHHHHHTTSGGGT
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHHHHHCCCCCCEEEECCCCCCCCCHHHHHHHHHCCCCC
T ss_conf             89999799999999999999769984999989999999999841233037987899648788997279999998577779


Q ss_pred             CCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             9739999638998999999976998899769898999999999999
Q gi|254780892|r   74 DVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        74 ~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      ++|||++|++++.+...+++++|+++|+.|||+.++|...++.+.+
T Consensus        89 ~ipiI~lS~~~~~~~~~~a~~~G~~~~l~KPv~~~~ll~~~~~~~~  134 (143)
T 2qvg_A           89 DIEVFVLTAAYTSKDKLAFESLNIRGHLIKPLDYGEAIKLFWILQS  134 (143)
T ss_dssp             TCEEEEEESCCCHHHHHHHTTTTCCEEEESSCCHHHHHHHHHHHHH
T ss_pred             CCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
T ss_conf             9919999788999999999987998999897999999999999997


No 56 
>3a10_A Response regulator; phosphoacceptor, signaling protein; HET: MSE PG4; 1.63A {Thermotoga maritima} PDB: 3a0r_B* 3a0u_A*
Probab=99.94  E-value=2.9e-26  Score=175.59  Aligned_cols=113  Identities=20%  Similarity=0.294  Sum_probs=101.9

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |+|||||||++.+|+.++..|+.+||+|.+|.||++|++.+.++ .||+|++|++||++  .++++++|+.  .+++|||
T Consensus         1 M~rILiVDDd~~~~~~l~~~L~~~g~~v~~a~~g~~al~~~~~~-~~dlvilD~~mP~~~G~e~~~~ir~~--~~~~pii   77 (116)
T 3a10_A            1 MKRILVVDDEPNIRELLKEELQEEGYEIDTAENGEEALKKFFSG-NYDLVILDIEMPGISGLEVAGEIRKK--KKDAKII   77 (116)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHS-CCSEEEECSCCSSSCHHHHHHHHHHH--CTTCCEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHC--CCCCCEE
T ss_conf             98899992999999999999998799999989999999999847-99989983688999999999999843--9989799


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
                      ++|++++.+  .++...||++|+.|||+.++|..++++++
T Consensus        78 ~lt~~~~~~--~~~~~~Ga~~~l~KP~~~~~L~~~v~~~L  115 (116)
T 3a10_A           78 LLTAYSHYR--SDMSSWAADEYVVKSFNFDELKEKVKKLL  115 (116)
T ss_dssp             EEESCGGGG--GCGGGGGSSEEEECCSSTHHHHHHHHHHT
T ss_pred             EEECCCCHH--HHHHHCCCCEEEECCCCHHHHHHHHHHHC
T ss_conf             998978999--99982699889989899999999999974


No 57 
>1dcf_A ETR1 protein; beta-alpha five sandwich, transferase; 2.50A {Arabidopsis thaliana} SCOP: c.23.1.2
Probab=99.94  E-value=2e-25  Score=170.60  Aligned_cols=117  Identities=19%  Similarity=0.223  Sum_probs=106.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHC---CCCCCCE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--7389999614---3488973
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQM---PLGTDVF   76 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~---~~~~~~p   76 (133)
                      +||||||||+.+|..++++|+.+||+|.+|.||.+|++.+. + .||+|++|++||++  .++++++|+.   ...+.+|
T Consensus         8 ~rILvVDD~~~~~~~l~~~L~~~g~~v~~a~~g~eAl~~l~-~-~~dlii~D~~mP~~dG~e~~~~ir~~~~~~~~~~~~   85 (136)
T 1dcf_A            8 LKVLVMDENGVSRMVTKGLLVHLGCEVTTVSSNEECLRVVS-H-EHKVVFMDVCMPGVENYQIALRIHEKFTKQRHQRPL   85 (136)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHCC-T-TCSEEEEECCSSTTTTTHHHHHHHHHHC-CCSCCCE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHC-C-CCCEEEEECCCCCCCHHHHHHHHHHHCCCCCCCCCE
T ss_conf             99999939899999999999987999999899999998624-5-998999945689974899999999845012689886


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             99996389989999999769988997698989999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      ||++|++.+.+...+++++|+++||.||++.++|..++.++++.
T Consensus        86 ii~~Ta~~~~~~~~~~~~~G~~~~l~KP~~~~~L~~~l~~~l~~  129 (136)
T 1dcf_A           86 LVALSGNTDKSTKEKCMSFGLDGVLLKPVSLDNIRDVLSDLLEP  129 (136)
T ss_dssp             EEEEESCCSHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHSC
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             99996899999999999869998998989999999999999600


No 58 
>1xhf_A DYE resistance, aerobic respiration control protein ARCA; two-component system, gene regulation, transcription factor, anoxic redox control; 2.15A {Escherichia coli} SCOP: c.23.1.1 PDB: 1xhe_A
Probab=99.94  E-value=2.3e-25  Score=170.29  Aligned_cols=115  Identities=24%  Similarity=0.385  Sum_probs=105.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEEE
Q ss_conf             7999739989999999999988989999999799999997179994899707899877--38999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~l   80 (133)
                      +|||||||+.+|..++..|+.+||+|..|.||++|++.+.++ .||+||+|++|||+.  ++++++|.   .+.+|+|++
T Consensus         5 ~ILiVdDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~l~~~-~~dlii~D~~lP~~~g~e~~~~~~~---~~~~pii~l   80 (123)
T 1xhf_A            5 HILIVEDELVTRNTLKSIFEAEGYDVFEATDGAEMHQILSEY-DINLVIMDINLPGKNGLLLARELRE---QANVALMFL   80 (123)
T ss_dssp             EEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHHHHS-CCSEEEECSSCSSSCHHHHHHHHHH---HCCCEEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEEECCCCCCHHHHHHHHHHH---CCCCCEEEE
T ss_conf             999996999999999999998799999989999999999708-9999999689998449999999985---699978999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             63899899999997699889976989899999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      |+.++.+...+|+++||++|+.|||++++|..++++++++.
T Consensus        81 t~~~~~~~~~~a~~~Ga~d~l~KP~~~~~L~~~v~~~l~R~  121 (123)
T 1xhf_A           81 TGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLSRT  121 (123)
T ss_dssp             ESCCSHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             93599999999998498888869899999999999998772


No 59 
>2gkg_A Response regulator homolog; social motility, receiver domain, signalling, high resolutio signaling protein; 1.00A {Myxococcus xanthus} PDB: 2i6f_A 2nt4_A 2nt3_A
Probab=99.94  E-value=9e-26  Score=172.67  Aligned_cols=116  Identities=18%  Similarity=0.206  Sum_probs=106.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCC-CC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             77999739989999999999988989999999799999997179994899707899-87--7389999614348897399
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME-GV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP-~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      +||||||||+.++..++..|+.+||+|..|.||.+|++.+.++ .||+|++|++|| ++  +++++++|+.+.++++|||
T Consensus         6 kkILvVdDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~l~~~-~pdliilD~~lp~~~~G~~l~~~ir~~~~~~~iPii   84 (127)
T 2gkg_A            6 KKILIVESDTALSATLRSALEGRGFTVDETTDGKGSVEQIRRD-RPDLVVLAVDLSAGQNGYLICGKLKKDDDLKNVPIV   84 (127)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHHTCEEEEECCHHHHHHHHHHH-CCSEEEEESBCGGGCBHHHHHHHHHHSTTTTTSCEE
T ss_pred             CCEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCHHHHHHHHHHCCCCCCCCEE
T ss_conf             8599998999999999999998799999989999999999847-999999975777688899999999838888998389


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      ++|+.++. ...+++++||++|+.|||+.++|..++++++.
T Consensus        85 ~lt~~~~~-~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~L~  124 (127)
T 2gkg_A           85 IIGNPDGF-AQHRKLKAHADEYVAKPVDADQLVERAGALIG  124 (127)
T ss_dssp             EEECGGGH-HHHHHSTTCCSEEEESSCCHHHHHHHHHHHHC
T ss_pred             EEECCCHH-HHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             99689859-99999986998999898999999999999877


No 60 
>3i42_A Response regulator receiver domain protein (CHEY- like); structural genomics, PSI-2, protein structure initiative; 2.15A {Methylobacillus flagellatus KT}
Probab=99.94  E-value=9.1e-26  Score=172.64  Aligned_cols=119  Identities=13%  Similarity=0.146  Sum_probs=107.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |+||||||||+.+|+.++.+|+.+||+|..|.||.+|++.+.++ .||+|++|++||++  .++++++|+.+..+.+|||
T Consensus         3 ~~~vLiVDD~~~~~~~l~~~L~~~G~~v~~a~~g~eAl~~l~~~-~~dlillD~~mP~~~G~el~~~lr~~~~~~~~pii   81 (127)
T 3i42_A            3 LQQALIVEDYQAAAETFKELLEMLGFQADYVMSGTDALHAMSTR-GYDAVFIDLNLPDTSGLALVKQLRALPMEKTSKFV   81 (127)
T ss_dssp             CEEEEEECSCHHHHHHHHHHHHHTTEEEEEESSHHHHHHHHHHS-CCSEEEEESBCSSSBHHHHHHHHHHSCCSSCCEEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEEECCCCCCCCHHHHHHHHHHCCCCCCCEEE
T ss_conf             88899995789999999999998799999989999999999808-99999862789998459999999847678999499


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      ++|++++.+....+. .|+++||.|||+.++|..+++++....
T Consensus        82 ~lt~~~~~~~~~~~~-~g~~~~L~KP~~~~~L~~~l~~l~G~~  123 (127)
T 3i42_A           82 AVSGFAKNDLGKEAC-ELFDFYLEKPIDIASLEPILQSIEGHH  123 (127)
T ss_dssp             EEECC-CTTCCHHHH-HHCSEEEESSCCHHHHHHHHHHHC---
T ss_pred             EEECCCCHHHHHHHH-HCCCEEEECCCCHHHHHHHHHHHCCCC
T ss_conf             997888799999997-178789979899999999999804888


No 61 
>3hzh_A Chemotaxis response regulator (CHEY-3); phosphatase, complex, response regulator, receiver domain, two-component signal transduction; HET: BFD; 1.96A {Borrelia burgdorferi}
Probab=99.94  E-value=1e-25  Score=172.36  Aligned_cols=115  Identities=17%  Similarity=0.208  Sum_probs=104.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCC-CCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             799973998999999999998898999-9999799999997179-99489970789987--7389999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKEL-LPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~-~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |||||||++.+|+.++.+|+.+||+|. +|.||++|++.+.++. .+|+|++|++||++  +++++++|+.  .+++|||
T Consensus        38 ~ILiVDD~~~~~~~l~~~L~~~g~~vv~~a~~g~eAl~~~~~~~p~~dlvilD~~mP~~dG~e~~~~ir~~--~~~~piI  115 (157)
T 3hzh_A           38 NVLIVDDSVFTVKQLTQIFTSEGFNIIDTAADGEEAVIKYKNHYPNIDIVTLXITMPKMDGITCLSNIMEF--DKNARVI  115 (157)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHGGGCCEEEECSSCSSSCHHHHHHHHHHH--CTTCCEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHH--CCCCCEE
T ss_conf             89999699999999999999879989999899999999998419891899985689999789999999971--9999768


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      ++|++++.+...+|+++||++|+.|||+.++|..+++++++
T Consensus       116 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~vl~  156 (157)
T 3hzh_A          116 MISALGKEQLVKDCLIKGAKTFIVKPLDRAKVLQRVMSVFV  156 (157)
T ss_dssp             EEESCCCHHHHHHHHHTTCSEEEESSCCHHHHHHHHHHTTC
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             76327999999999985998899798999999999999967


No 62 
>3cg0_A Response regulator receiver modulated diguanylate cyclase with PAS/PAC sensor; signal receiver domain; 2.15A {Desulfovibrio desulfuricans subsp}
Probab=99.94  E-value=1.6e-25  Score=171.11  Aligned_cols=120  Identities=18%  Similarity=0.261  Sum_probs=107.9

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCC-C--CHHHHHHHHCCCCCCCE
Q ss_conf             97799973998999999999998898999-99997999999971799948997078998-7--73899996143488973
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEG-V--LEFIAHVRQMPLGTDVF   76 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~-~--~~l~~~ir~~~~~~~~p   76 (133)
                      |.+||||||++.+|..++..|+.+||+|. .|.||++|++.+.++ .||+|++|+.||+ +  .++++.+|+.   +++|
T Consensus         9 ~~~ILvVDD~~~~~~~l~~~L~~~G~~v~~~a~~~~eal~~~~~~-~~dlvi~D~~mp~~~dG~~l~~~lr~~---~~~p   84 (140)
T 3cg0_A            9 LPGVLIVEDGRLAAATLRIQLESLGYDVLGVFDNGEEAVRCAPDL-RPDIALVDIMLCGALDGVETAARLAAG---CNLP   84 (140)
T ss_dssp             CCEEEEECCBHHHHHHHHHHHHHHTCEEEEEESSHHHHHHHHHHH-CCSEEEEESSCCSSSCHHHHHHHHHHH---SCCC
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCHHHHHHHHHHC---CCCC
T ss_conf             998999979999999999999987998999978999999999827-998899976787679899999999857---9996


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             999963899899999997699889976989899999999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSK  124 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~  124 (133)
                      ||++|++++.+...+++++||++||.|||+.++|..++++++++++..
T Consensus        85 iI~lt~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~l~~~~~e  132 (140)
T 3cg0_A           85 IIFITSSQDVETFQRAKRVNPFGYLAKPVAADTLHRSIEMAIHKKKLE  132 (140)
T ss_dssp             EEEEECCCCHHHHHHHHTTCCSEEEEESCCHHHHHHHHHHHHHHHHHC
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHH
T ss_conf             899966899999999998799989979899999999999999999996


No 63 
>3cu5_A Two component transcriptional regulator, ARAC family; structural genomics, protein structure initiative; 2.60A {Clostridium phytofermentans isdg}
Probab=99.94  E-value=2.5e-26  Score=176.00  Aligned_cols=118  Identities=21%  Similarity=0.222  Sum_probs=106.1

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHHCCC---EEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCC
Q ss_conf             97-799973998999999999998898---999999979999999717999489970789987--738999961434889
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFNDFGF---MVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTD   74 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~~g~---~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~   74 (133)
                      |+ |||||||++.+|..++..|+.+|+   .|.+|.||.+|++.+.+ ..||+||+|++||+|  +++++++|+.  .++
T Consensus         1 M~irILiVDD~~~~r~~l~~~L~~~~~~~~~v~~a~~g~eal~~~~~-~~pdlillDi~MP~~dG~el~~~i~~~--~p~   77 (141)
T 3cu5_A            1 MSLRILIVDDEKLTRDGLIANINWKALSFDQIDQADDGINAIQIALK-HPPNVLLTDVRMPRMDGIELVDNILKL--YPD   77 (141)
T ss_dssp             -CCEEEEECSCHHHHHHHHHHCCGGGSCCSEEEEESSHHHHHHHHTT-SCCSEEEEESCCSSSCHHHHHHHHHHH--CTT
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHH-CCCCEEEEECCCCCCCHHHHHHHHHHH--CCC
T ss_conf             99749999099999999999999659984599897999999999986-799989973689999999999999975--879


Q ss_pred             CEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             73999963899899999997699889976989899999999999999
Q gi|254780892|r   75 VFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        75 ~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      +|||++|++++.+...+|+++||.+||.||+++++|..+++++++..
T Consensus        78 ~~iI~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~l~~~  124 (141)
T 3cu5_A           78 CSVIFMSGYSDKEYLKAAIKFRAIRYVEKPIDPSEIMDALKQSIQTV  124 (141)
T ss_dssp             CEEEEECCSTTTCCC------CCCEEECSSCCHHHHHHHHHHHHHHH
T ss_pred             CCEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
T ss_conf             93999978799999999998699989979899999999999999999


No 64 
>1p6q_A CHEY2; chemotaxis, signal transduction, response regulator, structural proteomics in europe, spine, structural genomics; NMR {Sinorhizobium meliloti} SCOP: c.23.1.1 PDB: 1p6u_A
Probab=99.93  E-value=1.1e-25  Score=172.17  Aligned_cols=117  Identities=21%  Similarity=0.269  Sum_probs=108.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCE-EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7999739989999999999988989-99999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~-v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      ||||||||+.+|..++..|+.+||. |.+|.||++|++.+.++ .||+|++|++||++  .++++.+|+.+..+.+|||+
T Consensus         8 rILiVDD~~~~~~~l~~~L~~~g~~~v~~a~~~~~al~~~~~~-~~dlii~D~~mP~~dG~~l~~~ir~~~~~~~~pii~   86 (129)
T 1p6q_A            8 KVLIVDDQVTSRLLLGDALQQLGFKQITAAGDGEQGMKIMAQN-PHHLVISDFNMPKMDGLGLLQAVRANPATKKAAFII   86 (129)
T ss_dssp             CEEEECSSHHHHHHHHHHHHTTTCSCEECCSSHHHHHHHHHTS-CCSEEEECSSSCSSCHHHHHHHHTTCTTSTTCEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             8999959899999999999987992999989999999999718-998999845889998799999998385668982999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|++++.+...++++.|+++|+.|||+.++|..++++++..
T Consensus        87 ls~~~~~~~~~~~~~~G~~~~l~KP~~~~~L~~~i~~vl~~  127 (129)
T 1p6q_A           87 LTAQGDRALVQKAAALGANNVLAKPFTIEKMKAAIEAVFGA  127 (129)
T ss_dssp             CCSCCCHHHHHHHHHHTCSCEECCCSSHHHHHHHHHHHHHC
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             98049999999999879988998989999999999999985


No 65 
>2qsj_A DNA-binding response regulator, LUXR family; structural genomics, PSI-2, protein structure initiative; 2.10A {Silicibacter pomeroyi dss-3}
Probab=99.93  E-value=2.8e-25  Score=169.70  Aligned_cols=118  Identities=22%  Similarity=0.347  Sum_probs=108.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHC--CCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCE
Q ss_conf             977999739989999999999988--98999999979999999717999489970789987--73899996143488973
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDF--GFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVF   76 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~--g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~p   76 (133)
                      |.+||||||++.+|..++.+|+..  |+.|.+|.++.+|++.+.++..||+||+|++|||+  .++++++|+.  .+.+|
T Consensus         3 ~~~VLIvDD~~~~r~~l~~~L~~~~~~~~v~~a~~~~eal~~l~~~~~~DlvllD~~mP~~~G~e~l~~ir~~--~p~~~   80 (154)
T 2qsj_A            3 LTVVLIVDDHHLIRAGAKNLLEGAFSGMRVEGAETVSDALAFLEADNTVDLILLDVNLPDAEAIDGLVRLKRF--DPSNA   80 (154)
T ss_dssp             CEEEEEECSCHHHHHHHHHHHHHHCTTEEEEEESSHHHHHHHHHTTCCCSEEEECC------CHHHHHHHHHH--CTTSE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHH--CCCCC
T ss_conf             9999999499999999999997289984999966899999999745999789980888998889999999987--88997


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             99996389989999999769988997698989999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      ||++|++++.+...+|+++||++|+.||++.++|..+|+++.+.
T Consensus        81 iivlT~~~~~~~~~~a~~~Ga~gyl~K~~~~~~L~~aI~~v~~g  124 (154)
T 2qsj_A           81 VALISGETDHELIRAALEAGADGFIPKSADPQVLIHAVSLILEG  124 (154)
T ss_dssp             EEEC-----CHHHHHHHHTTCCBBCCTTSCHHHHHHHHHHHHTT
T ss_pred             EEEEEEECCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             99998028999999999859988997999999999999999879


No 66 
>3n0r_A Response regulator; sigma factor, receiver, two-component SI transduction, signaling protein; HET: MSE GOL; 1.25A {Caulobacter vibrioides}
Probab=99.93  E-value=8.8e-26  Score=172.71  Aligned_cols=116  Identities=20%  Similarity=0.331  Sum_probs=102.4

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCC-CC--CHHHHHHHHCCCCCCCEE
Q ss_conf             7799973998999999999998898999-9999799999997179994899707899-87--738999961434889739
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESME-GV--LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP-~~--~~l~~~ir~~~~~~~~pi   77 (133)
                      .+|||||||+.+|..++.+|+.+||+|. .|.+|.+|++.+.++ .||+|++|++|| +|  +++++.+|+.   +++||
T Consensus       161 ~~ILiVdD~~~~~~~l~~~L~~~g~~v~~~a~~~~~a~~~~~~~-~~Dlil~Di~mp~~mdG~~~~~~ir~~---~~~pi  236 (286)
T 3n0r_A          161 TEVLIIEDEPVIAADIEALVRELGHDVTDIAATRGEALEAVTRR-TPGLVLADIQLADGSSGIDAVKDILGR---MDVPV  236 (286)
T ss_dssp             CEEEEECCSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHC-CCSEEEEESCCTTSCCTTTTTHHHHHH---TTCCE
T ss_pred             CEEEEECCHHHHHHHHHHHHHHCCCCEEEECCCHHHHHHHHHCC-CCCEEEEECCCCCCCCHHHHHHHHHHC---CCCCE
T ss_conf             32999888799999999999976997488613289999997517-998899817887898899999999866---99838


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9996389989999999769988997698989999999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      |++|++.  +...+++++|+++||.|||+.++|..+|++++.+++.
T Consensus       237 I~lTa~~--~~~~~~~~~g~~~yl~KP~~~~~L~~~i~~aL~~~~~  280 (286)
T 3n0r_A          237 IFITAFP--ERLLTGERPEPTFLITKPFQPETVKAAIGQALFFHPR  280 (286)
T ss_dssp             EEEESCG--GGGCCSSSCCCSSEEESSCCHHHHHHHHHHHHHHSCC
T ss_pred             EEEECCH--HHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHCHH
T ss_conf             9995688--8999999869998998989999999999999985420


No 67 
>1yio_A Response regulatory protein; transcription regulation, DNA binding protein; 2.20A {Pseudomonas fluorescens} SCOP: a.4.6.2 c.23.1.1 PDB: 1zn2_A
Probab=99.92  E-value=2e-24  Score=164.69  Aligned_cols=117  Identities=24%  Similarity=0.320  Sum_probs=106.9

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEEE
Q ss_conf             7999739989999999999988989999999799999997179994899707899877--38999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~l   80 (133)
                      |||||||++.+|..++.+|+..||+|..|.+|.+|++.+.+ ..||+||+|++||++.  ++++++++.  .+.+|||++
T Consensus         6 ~ILIVDD~~~~r~~l~~~L~~~g~~V~~a~~~~eal~~~~~-~~pDlvllD~~mp~~~G~~~l~~i~~~--~~~~~iI~l   82 (208)
T 1yio_A            6 TVFVVDDDMSVREGLRNLLRSAGFEVETFDCASTFLEHRRP-EQHGCLVLDMRMPGMSGIELQEQLTAI--SDGIPIVFI   82 (208)
T ss_dssp             EEEEECSCHHHHHHHHHHHHTTTCEEEEESSHHHHHHHCCT-TSCEEEEEESCCSSSCHHHHHHHHHHT--TCCCCEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEEEECCCCCCCCHHHHHHHHHH--CCCCEEEEE
T ss_conf             79999499999999999999779989997999999998604-699989985788997657999998860--566517987


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             638998999999976998899769898999999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      |++++.+...+++++||++|+.||++.+++..+++++++...
T Consensus        83 t~~~~~~~~~~al~~Ga~~yl~Kp~~~~el~~~i~~~l~~~~  124 (208)
T 1yio_A           83 TAHGDIPMTVRAMKAGAIEFLPKPFEEQALLDAIEQGLQLNA  124 (208)
T ss_dssp             ESCTTSCCCHHHHHTTEEEEEESSCCHHHHHHHHHHHHHHHH
T ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             257999999999977999895389999999999999997401


No 68 
>3kto_A Response regulator receiver protein; PSI-II,structural genomics, protein structure initiative; 1.98A {Pseudoalteromonas atlantica T6C}
Probab=99.92  E-value=1.3e-24  Score=165.80  Aligned_cols=119  Identities=16%  Similarity=0.109  Sum_probs=109.4

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCC--CCHHHHHHHHCCCCCCCEEEEE
Q ss_conf             79997399899999999999889899999997999999971799948997078998--7738999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~--~~~l~~~ir~~~~~~~~pii~l   80 (133)
                      +||||||++..|..++..|+.+||+|.+|.||.+|++.+.+ ..||++|+|++||+  +.++....+.....+.+|+|++
T Consensus         8 ~VLIVDDd~~~r~~l~~~L~~~g~~v~~a~~~~eal~~l~~-~~~d~vilD~~l~~~~~~gl~~~~~~~~~~~~~pvi~l   86 (136)
T 3kto_A            8 IIYLVDHQKDARAALSKLLSPLDVTIQCFASAESFMRQQIS-DDAIGMIIEAHLEDKKDSGIELLETLVKRGFHLPTIVM   86 (136)
T ss_dssp             EEEEECSCHHHHHHHHHHHTTSSSEEEEESSHHHHTTSCCC-TTEEEEEEETTGGGBTTHHHHHHHHHHHTTCCCCEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEEEEECCCCCCCCCHHHHHHHHHCCCCCCEEEE
T ss_conf             79999799999999999999879999998999999999984-79988999936864788408999999750268867999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             638998999999976998899769898999999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      |++++.+...+|++.||++||.|||+.++|..++++++++.+
T Consensus        87 t~~~~~~~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~l~~~r  128 (136)
T 3kto_A           87 ASSSDIPTAVRAMRASAADFIEKPFIEHVLVHDVQQIINGAK  128 (136)
T ss_dssp             ESSCCHHHHHHHHHTTCSEEEESSBCHHHHHHHHHHHHHHHC
T ss_pred             EECCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             705999999999975994899898999999999999999847


No 69 
>2qv0_A Protein MRKE; structural genomics, transcription, PSI-2, protein structure initiative; 2.40A {Klebsiella pneumoniae}
Probab=99.92  E-value=9.6e-24  Score=160.58  Aligned_cols=117  Identities=11%  Similarity=0.217  Sum_probs=101.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCC-E-EEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEE
Q ss_conf             799973998999999999998898-9-999999799999997179994899707899877--389999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGF-M-VFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~-~-v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii   78 (133)
                      |||||||++.+|+.++.+|+.+|+ . |.+|.||.+|++.+.++ .||+||+|++|||+.  ++++.+|+.  .+.+|+|
T Consensus        11 rvLIVDD~~~~r~~l~~~L~~~~~~~vv~~a~~g~eal~~l~~~-~~DlvilDi~mP~~dG~el~~~ir~~--~~~~~iI   87 (143)
T 2qv0_A           11 KVIIVEDEFLAQQELSWLINTHSQMEIVGSFDDGLDVLKFLQHN-KVDAIFLDINIPSLDGVLLAQNISQF--AHKPFIV   87 (143)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHHSCCEEEEEESCHHHHHHHHHHC-CCSEEEECSSCSSSCHHHHHHHHTTS--TTCCEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHHHHHHC--CCCCEEE
T ss_conf             89999499999999999998689927999979999999999866-99989987888889989999999954--9998089


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSK  124 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~  124 (133)
                      ++|++++  +..+|++.||.+||.||++.+.|..+++++.+..+.+
T Consensus        88 ~~t~~~e--~~~~a~~~Ga~dyl~KP~~~~~L~~~i~~~~~~~~~~  131 (143)
T 2qv0_A           88 FITAWKE--HAVEAFELEAFDYILKPYQESRIINMLQKLTTAWEQQ  131 (143)
T ss_dssp             EEESCCT--THHHHHHTTCSEEEESSCCHHHHHHHHHHHHHHHHHC
T ss_pred             EEECCHH--HHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHH
T ss_conf             9977889--9999998599889979999999999999999999976


No 70 
>1dz3_A Stage 0 sporulation protein A; response regulator, domain swapping; 1.65A {Bacillus stearothermophilus} SCOP: c.23.1.1 PDB: 1qmp_A*
Probab=99.92  E-value=5.5e-24  Score=162.01  Aligned_cols=117  Identities=18%  Similarity=0.199  Sum_probs=104.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCC-CE-EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             79997399899999999999889-89-99999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFG-FM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g-~~-v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      ||||||||+.++..++.+|+..| +. |.+|.||++|++.+.++ .||+|++|++||++  .++++++|+... ..+||+
T Consensus         4 rvLivDD~~~~~~~l~~~L~~~~~~~~v~~a~~g~eal~~~~~~-~pdlvllD~~mP~~dG~el~~~ir~~~~-~~~~ii   81 (130)
T 1dz3_A            4 KVCIADDNRELVSLLDEYISSQPDMEVIGTAYNGQDCLQMLEEK-RPDILLLDIIMPHLDGLAVLERIRAGFE-HQPNVI   81 (130)
T ss_dssp             EEEEECSCHHHHHHHHHHHHTSTTEEEEEEESSHHHHHHHHHHH-CCSEEEEESCCSSSCHHHHHHHHHHHCS-SCCEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHHHHHHCCC-CCCEEE
T ss_conf             39999799999999999998589937999989999999999855-9999998289999988999999985599-999799


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      ++|++++.+...+++++||++|+.|||+.++|..++++++.+.
T Consensus        82 ~~t~~~~~~~~~~a~~~Ga~~~l~KP~~~~~L~~~i~~~~~~~  124 (130)
T 1dz3_A           82 MLTAFGQEDVTKKAVELGASYFILKPFDMENLAHHIRQVYGKT  124 (130)
T ss_dssp             EEEETTCHHHHHHHHHTTCEEEEECSSCCTTHHHHHHHHHHCC
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCCC
T ss_conf             9978999999999998699799979999999999999998237


No 71 
>1ys7_A Transcriptional regulatory protein PRRA; response regulator, DNA binding domain, phosphorylation; 1.58A {Mycobacterium tuberculosis} SCOP: a.4.6.1 c.23.1.1 PDB: 1ys6_A
Probab=99.92  E-value=3.6e-24  Score=163.13  Aligned_cols=118  Identities=25%  Similarity=0.305  Sum_probs=105.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHH--HHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987738--99996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF--IAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l--~~~ir~~~~~~~~pii~   79 (133)
                      .|||||||++..+..++..|+..||+|..|.||.+|++.+.++ .||+|++|+.||++.++  +..+|  ...+.+|+++
T Consensus         8 pkILiVeDd~~~~~~l~~~L~~~g~~V~~a~~~~ea~~~~~~~-~~dlvilD~~lp~~~g~~~~~~~r--~~~~~~~iii   84 (233)
T 1ys7_A            8 PRVLVVDDDSDVLASLERGLRLSGFEVATAVDGAEALRSATEN-RPDAIVLDINMPVLDGVSVVTALR--AMDNDVPVCV   84 (233)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHS-CCSEEEEESSCSSSCHHHHHHHHH--HTTCCCCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCCCEEEECC--CCCCCCCEEC
T ss_conf             8799997999999999999997899999989999999999747-997897522387556862231012--3577762331


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9638998999999976998899769898999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      +|++++.+...+|+++||+||+.|||+.++|..+++.+....+
T Consensus        85 lt~~~~~~~~v~al~~GAddyl~KP~~~~eL~a~i~~~~~~~~  127 (233)
T 1ys7_A           85 LSARSSVDDRVAGLEAGADDYLVKPFVLAELVARVKALLRRRG  127 (233)
T ss_dssp             EECCCTTTCCCTTTTTTCSEEEESSCCHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             4566889999999977992999789987999999999998640


No 72 
>1kgs_A DRRD, DNA binding response regulator D; DNA-binding protein, ALPH-beta sandwich, winged-helix, helix-turn-helix, DNA binding protein; HET: DNA MSE; 1.50A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1
Probab=99.91  E-value=1.4e-23  Score=159.61  Aligned_cols=118  Identities=21%  Similarity=0.238  Sum_probs=106.7

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEE
Q ss_conf             97-7999739989999999999988989999999799999997179994899707899877--38999961434889739
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pi   77 (133)
                      |+ |||||||++..+..+...|+..||+|..|.||.+|++.+.++ .||+||+|+.||++.  ++++.+|+.  .+.+||
T Consensus         1 M~~rILiVeDd~~~~~~l~~~L~~~g~~V~~a~~~~ea~~~~~~~-~~dliilD~~lp~~~g~~~~~~ir~~--~~~~pi   77 (225)
T 1kgs_A            1 MNVRVLVVEDERDLADLITEALKKEMFTVDVCYDGEEGMYMALNE-PFDVVILDIMLPVHDGWEILKSMRES--GVNTPV   77 (225)
T ss_dssp             -CCEEEEECSSHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHHS-CCSEEEEESCCSSSCHHHHHHHHHHT--TCCCCE
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCCCHHHHHHCC--CCCCCE
T ss_conf             996199992999999999999998799999989999999999728-99899994677654310101221113--456753


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             99963899899999997699889976989899999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      |++|+.++.+...+++++||+||+.|||+.++|..+++...+..
T Consensus        78 i~ls~~~~~~~~~~~l~~Gaddyl~KP~~~~eL~a~i~~~~~~~  121 (225)
T 1kgs_A           78 LMLTALSDVEYRVKGLNMGADDYLPKPFDLRELIARVRALIRRK  121 (225)
T ss_dssp             EEEESSCHHHHHHHTCCCCCSEEEESSCCHHHHHHHHHHHHHHH
T ss_pred             EECCCCCCHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHHCC
T ss_conf             20233441678999997799852458999999999999997113


No 73 
>3f6c_A Positive transcription regulator EVGA; structural genomics, , PSI-2, protein structure initiative; 1.45A {Escherichia coli k-12}
Probab=99.91  E-value=3.4e-24  Score=163.23  Aligned_cols=115  Identities=19%  Similarity=0.206  Sum_probs=105.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             799973998999999999998898999-999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      |||||||++.+|..++.+|...||++. +|.||.+|++.+.+. .||+|++|++||++  .++++++|+.  .+.+|||+
T Consensus         3 ~vLIvDD~~~~r~~l~~~L~~~~~~vv~~a~~g~~al~~~~~~-~pDlvilD~~mP~~~G~e~~~~lr~~--~~~~~iiv   79 (134)
T 3f6c_A            3 NAIIIDDHPLAIAAIRNLLIKNDIEILAELTEGGSAVQRVETL-KPDIVIIDVDIPGVNGIQVLETLRKR--QYSGIIII   79 (134)
T ss_dssp             EEEEECCCHHHHHHHHHHHHHTTEEEEEEESSSTTHHHHHHHH-CCSEEEEETTCSSSCHHHHHHHHHHT--TCCSEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             9999969899999999999868998999989999999998726-99999995999999899999999952--99983899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +|++++.+...+|+++||++|+.||++.++|..+++++.+.
T Consensus        80 lS~~~~~~~~~~a~~~Ga~~yl~Kp~~~~~L~~ai~~v~~g  120 (134)
T 3f6c_A           80 VSAKNDHFYGKHCADAGANGFVSKKEGMNNIIAAIEAAKNG  120 (134)
T ss_dssp             EECC---CTHHHHHHTTCSEEEEGGGCTHHHHHHHHHHHTT
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             96789999999999879989997989999999999999879


No 74 
>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 2.59A {Cytophaga hutchinsonii atcc 33406}
Probab=99.91  E-value=2.3e-23  Score=158.31  Aligned_cols=121  Identities=21%  Similarity=0.256  Sum_probs=105.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCC--EEEEECCHHHHHHHHHH----CCCCCEEEECCCCCCC--CHHHHHHHHC--C
Q ss_conf             97799973998999999999998898--99999997999999971----7999489970789987--7389999614--3
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGF--MVFEATSVCEAREFCEK----ELLPNYLVIDESMEGV--LEFIAHVRQM--P   70 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~--~v~~a~~g~eAl~~~~~----~~~pdlii~D~~mP~~--~~l~~~ir~~--~   70 (133)
                      +++|||||||+.++..++..|+..|+  +|.+|.||++|++.+++    +..||+|++||+||++  .++++++|+.  +
T Consensus         9 ~~~ILiVDDd~~~~~~l~~~l~~~g~~~~v~~a~~g~~Al~~l~~~~~~~~~pdliilD~~MP~~dG~el~~~ir~~~~~   88 (146)
T 3ilh_A            9 IDSVLLIDDDDIVNFLNTTIIRMTHRVEEIQSVTSGNAAINKLNELYAAGRWPSIICIDINMPGINGWELIDLFKQHFQP   88 (146)
T ss_dssp             EEEEEEECSCHHHHHHHHHHHHTTCCEEEEEEESSHHHHHHHHHHHHTSSCCCSEEEEESSCSSSCHHHHHHHHHHHCGG
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCCCEEEEECCHHHHHHHHHHHHCCCCCCCEEEEECCCCCCCHHHHHHHHHHHCCC
T ss_conf             99799997989999999999997799818999899999999998631027899999984898999759999999860851


Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHH-CCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             488973999963899899999997-699889976989899999999999999
Q gi|254780892|r   71 LGTDVFVYYLLMEVDFEKMIAGAR-AGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        71 ~~~~~pii~lT~~~~~~~~~~a~~-~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      ....+|+|++|+..+.....++.. .|+++|+.||++.+.|..++++++++-
T Consensus        89 ~~~~~~viilts~~~~~~~~~~~~~~g~~~~l~KP~~~~~L~~~l~~~l~~g  140 (146)
T 3ilh_A           89 MKNKSIVCLLSSSLDPRDQAKAEASDWVDYYVSKPLTANALNNLYNKVLNEG  140 (146)
T ss_dssp             GTTTCEEEEECSSCCHHHHHHHHHCSSCCEEECSSCCHHHHHHHHHHHHCC-
T ss_pred             CCCCCEEEEEECCCCHHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHCC
T ss_conf             2488719999788998999999997799889979899999999999999714


No 75 
>2b4a_A BH3024; 10175646, structural genomics, joint center for structural genomics, JCSG, protein structure initiative PSI, unknown function; 2.42A {Bacillus halodurans c-125} SCOP: c.23.1.1
Probab=99.91  E-value=2.3e-24  Score=164.25  Aligned_cols=112  Identities=17%  Similarity=0.173  Sum_probs=99.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .||||||||+.+|..++..|+.+||+|.+|.+|.+|++.+.+...||+|++||+||++  +++++++|+.  .+++|||+
T Consensus        16 ~rILvVDDd~~~~~~l~~~L~~~G~~v~~~~~g~~al~~l~~~~~~DlvilD~~lP~~dG~~l~~~ir~~--~~~~piI~   93 (138)
T 2b4a_A           16 FRVTLVEDEPSHATLIQYHLNQLGAEVTVHPSGSAFFQHRSQLSTCDLLIVSDQLVDLSIFSLLDIVKEQ--TKQPSVLI   93 (138)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEESSHHHHHHTGGGGGSCSEEEEETTCTTSCHHHHHHHHTTS--SSCCEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEE
T ss_conf             8899996999999999999998599799809999999999836999889985888998889999999970--99996899


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
                      +|++++  ...++++.|+ |||.|||+.++|..+++...
T Consensus        94 lt~~~~--~~~~~~~~ga-dyL~KP~~~~eL~a~v~~~~  129 (138)
T 2b4a_A           94 LTTGRH--ELIESSEHNL-SYLQKPFAISELRAAIDYHK  129 (138)
T ss_dssp             EESCC----CCCCSSSCE-EEEESSCCHHHHHHHHHHTC
T ss_pred             EECCHH--HHHHHHHCCC-CEEECCCCHHHHHHHHHHHC
T ss_conf             989817--9999853699-88989999999999999856


No 76 
>2rdm_A Response regulator receiver protein; structural genomics, unknown function, PSI-2, protein structure initiative; HET: MSE; 1.76A {Sinorhizobium medicae WSM419}
Probab=99.91  E-value=6.7e-24  Score=161.53  Aligned_cols=118  Identities=20%  Similarity=0.223  Sum_probs=105.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCC-C--CHHHHHHHHCCCCCCCEEE
Q ss_conf             779997399899999999999889899999997999999971799948997078998-7--7389999614348897399
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-V--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~-~--~~l~~~ir~~~~~~~~pii   78 (133)
                      .+|||||||+.+|..++.+|+.+||+|.+|.||++|++.+.++..||+||+|+.||+ +  .++++++|+.  .+++|+|
T Consensus         6 ~~ILiVDDd~~~~~~l~~~L~~~G~~v~~a~s~~eAl~~l~~~~~~dlvi~D~~~p~~~~G~el~~~ir~~--~~~~pii   83 (132)
T 2rdm_A            6 VTILLADDEAILLLDFESTLTDAGFLVTAVSSGAKAIEMLKSGAAIDGVVTDIRFCQPPDGWQVARVAREI--DPNMPIV   83 (132)
T ss_dssp             CEEEEECSSHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHHTTCCCCEEEEESCCSSSSCHHHHHHHHHHH--CTTCCEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEEEECCCCCCCHHHHHHHHHHH--CCCCCEE
T ss_conf             98999979999999999999987999999899999999998389987998730058999999999999974--9899689


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             996389989999999769988997698989999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      ++|++++.+...+++..|  +||.|||++++|..++++++++++.
T Consensus        84 ~~s~~~~~~~~~~~~~~~--~~L~KP~~~~~L~~~i~~~l~~r~G  126 (132)
T 2rdm_A           84 YISGHAALEWASNGVPDS--IILEKPFTSAQLITAVSQLLNAREG  126 (132)
T ss_dssp             EEESSCCTTHHHHSCTTC--EEEESSCCHHHHHHHHHHHHHTTC-
T ss_pred             EEECCCCHHHHHHHCCCC--EEEECCCCHHHHHHHHHHHHHHCCC
T ss_conf             997569989999735289--0898999999999999999998799


No 77 
>3cz5_A Two-component response regulator, LUXR family; structural genomics, protein structure initiative; 2.70A {Aurantimonas SP}
Probab=99.91  E-value=1.9e-23  Score=158.78  Aligned_cols=116  Identities=25%  Similarity=0.340  Sum_probs=103.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHH-CCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEE
Q ss_conf             7799973998999999999998-898999-999979999999717999489970789987--738999961434889739
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFND-FGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~-~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pi   77 (133)
                      .|||||||++.+|..++.+|+. .|+.+. +|.+|.+|++.+.+ ..||+||+|++||++  +++++++|+.  .+.+||
T Consensus         6 ~RVLIVDD~~~~r~~l~~~L~~~~~~~vv~~a~~~~eal~~~~~-~~pDlvllDi~mP~~~G~e~~~~ir~~--~~~~~i   82 (153)
T 3cz5_A            6 ARIMLVDDHPIVREGYRRLIERRPGYAVVAEAADAGEAYRLYRE-TTPDIVVMDLTLPGPGGIEATRHIRQW--DGAARI   82 (153)
T ss_dssp             EEEEEECSCHHHHHHHHHHHTTSTTEEEEEEESSHHHHHHHHHT-TCCSEEEECSCCSSSCHHHHHHHHHHH--CTTCCE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCE
T ss_conf             77999929999999999999858991899998999999999754-699689996457998789999999985--899968


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             9996389989999999769988997698989999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      +++|++++.+...+|+++||++||.||++.++|..+++++.+.
T Consensus        83 ivlt~~~~~~~~~~al~~Ga~~yl~Kp~~~~~L~~ai~~v~~g  125 (153)
T 3cz5_A           83 LIFTMHQGSAFALKAFEAGASGYVTKSSDPAELVQAIEAILAG  125 (153)
T ss_dssp             EEEESCCSHHHHHHHHHTTCSEEEETTSCTTHHHHHHHHHTTT
T ss_pred             EEEEEECCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             9998148999999999869983896899999999999999849


No 78 
>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D domain swapping; 2.03A {Mycobacterium tuberculosis H37RV}
Probab=99.91  E-value=6e-24  Score=161.77  Aligned_cols=116  Identities=17%  Similarity=0.221  Sum_probs=104.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCH--HHHHHHHCCCCCCCEEEE
Q ss_conf             779997399899999999999889899999997999999971799948997078998773--899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE--FIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~--l~~~ir~~~~~~~~pii~   79 (133)
                      ++||+|||++..+..++..|+..||+|..|.||++|++.+..+ .||+|++|+.||++.+  +++.++.   ...+|||+
T Consensus         5 ~~ILlVeDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~~~~~-~~DliilDi~lp~~~g~~~~~~~~~---~~~~pii~   80 (230)
T 2oqr_A            5 TSVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRA-GADIVLLDLMLPGMSGTDVCKQLRA---RSSVPVIM   80 (230)
T ss_dssp             CEEEEECSCHHHHHHHHHHHHHTTCEEEEECSHHHHHHHHHHH-CCSEEEEESSCSSSCHHHHHHHHHH---HCSCSEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCC---CCCEEEEE
T ss_conf             8399996999999999999998799999989999999999748-9989999489999888742023224---56407999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      +|+.++.+...+|+++||+||+.|||+.++|..+++.++++.
T Consensus        81 lt~~~~~~~~~~~l~~Gaddyl~KP~~~~eL~ari~~~~rr~  122 (230)
T 2oqr_A           81 VTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRG  122 (230)
T ss_dssp             EECCHHHHHHHHHHHHCCSCCCCSSCCHHHHHHHHHHHHTTT
T ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHC
T ss_conf             824467688888887699889969999999999999998431


No 79 
>2gwr_A DNA-binding response regulator MTRA; two-component regulatory system, transcription regulation, phosphorylation, OMPR family; 2.10A {Mycobacterium tuberculosis} PDB: 3nhz_A
Probab=99.91  E-value=8.8e-24  Score=160.81  Aligned_cols=116  Identities=19%  Similarity=0.287  Sum_probs=103.2

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCH--HHHHHHHCCCCCCCEE
Q ss_conf             97-79997399899999999999889899999997999999971799948997078998773--8999961434889739
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE--FIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~--l~~~ir~~~~~~~~pi   77 (133)
                      |+ |||||||++..+..++..|+..||+|..|.||.+|++.+.++ .||+||+|+.||++.+  ++.++|.   ....|+
T Consensus         4 Mk~kILiVeDd~~~~~~l~~~L~~~g~~v~~a~~~~~al~~~~~~-~~DliilD~~lp~~~g~~~~~~~r~---~~~~~i   79 (238)
T 2gwr_A            4 MRQRILVVDDDASLAEMLTIVLRGEGFDTAVIGDGTQALTAVREL-RPDLVLLDLMLPGMNGIDVCRVLRA---DSGVPI   79 (238)
T ss_dssp             CCCEEEEECSCHHHHHHHHHHHHHTTCEEEEECCGGGHHHHHHHH-CCSEEEEESSCSSSCHHHHHHHHHT---TCCCCE
T ss_pred             CCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCCCEEECCCC---CCCCCC
T ss_conf             687499993999999999999997799999989999999999837-9999999167766688712311223---566531


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             9996389989999999769988997698989999999999999
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      |++|+.++.+...+++++||+||+.|||+.++|..+++..+++
T Consensus        80 Iilt~~~~~~~~~~al~~Gaddyl~KP~~~~eL~ari~a~lrr  122 (238)
T 2gwr_A           80 VMLTAKTDTVDVVLGLESGADDYIMKPFKPKELVARVRARLRR  122 (238)
T ss_dssp             EEEEETTCCSCHHHHHHTTCCEEEEESCCHHHHHHHHHHHCCC
T ss_pred             CCCCCCCCHHHHHHHHHCCCCEECCCCCCHHHHHHHHHHHHCC
T ss_conf             1012589999999999779988021899999999999999632


No 80 
>1dc7_A NTRC, nitrogen regulation protein; receiver domain, phosphorylation, signal transduction, conformational rearrangement; NMR {Salmonella typhimurium} SCOP: c.23.1.1 PDB: 1j56_A 1krw_A 1krx_A 1ntr_A 1dc8_A*
Probab=99.91  E-value=3.1e-26  Score=175.38  Aligned_cols=119  Identities=18%  Similarity=0.238  Sum_probs=109.2

Q ss_pred             CC--EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCE
Q ss_conf             97--799973998999999999998898999999979999999717999489970789987--73899996143488973
Q gi|254780892|r    1 MD--SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVF   76 (133)
Q Consensus         1 m~--~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~p   76 (133)
                      |+  +|||||||+.+|..++..|+.+||+|.+|.||.+|++.+.+ ..||+||+|++||++  .++++++|+.  .+++|
T Consensus         1 M~k~~ILIVDDd~~~~~~l~~~L~~~g~~v~~a~~~~~a~~~l~~-~~~dlii~D~~lp~~~G~el~~~l~~~--~~~~p   77 (124)
T 1dc7_A            1 MQRGIVWVVDDDSSIRWVLERALAGAGLTCTTFENGNEVLAALAS-KTPDVLLSDIRMPGMDGLALLKQIKQR--HPMLP   77 (124)
T ss_dssp             CCCCCCEEECSSSSHHHHHHHHHTTTTCCCEECCCTTHHHHHSSS-CCCSCEEECSCSSHHHHCSTHHHHHHH--CTTSC
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH-CCCCEEEECCCCCCCCHHHHHHHHHHH--CCCCE
T ss_conf             998989999599999999999999889999998999999999983-899999875889998459999999985--89991


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHH
Q ss_conf             9999638998999999976998899769898999999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK  122 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~  122 (133)
                      |+++|++++.+...+|++.|+++|+.|||+.++|..++++++++++
T Consensus        78 ii~~t~~~~~~~~~~a~~~G~~dyl~KP~~~~~L~~~i~~~l~~~~  123 (124)
T 1dc7_A           78 VIIMTAHSDLDAAVSAYQQGAFDYLPKPFDIDEAVALVERAISHYQ  123 (124)
T ss_dssp             CCCBCCSTTSTTTTSSCTTCCCCCBCSSCCHHHHHHHHHHHHHHTC
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHC
T ss_conf             9999898999999999986998078397999999999999999844


No 81 
>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40}
Probab=99.91  E-value=4.8e-24  Score=162.36  Aligned_cols=115  Identities=15%  Similarity=0.140  Sum_probs=100.6

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHC---CCCCCCE
Q ss_conf             77999739989999999999988989999999799999997179994899707899877--389999614---3488973
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQM---PLGTDVF   76 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~---~~~~~~p   76 (133)
                      .||||||||+.+|..++++|+.+||+|.+|.||.+|++.+.++ .||+||+|++||+|.  ++++.+|+.   ...+.+|
T Consensus        11 l~VLiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~-~~dlii~D~~mP~~dG~el~~~ir~~~~~~~~~~ip   89 (140)
T 3c97_A           11 LSVLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAYQNR-QFDVIIMDIQMPVMDGLEAVSEIRNYERTHNTKRAS   89 (140)
T ss_dssp             CEEEEECCCHHHHHHHHHHHTTTCSEEEEESSHHHHHHHHHHS-CCSEEEECTTCCSSCHHHHHHHHHHHHHHHTCCCCC
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCCCCE
T ss_conf             9899993989999999999998799999989999999998707-998899947999989999999998352103789983


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             99996389989999999769988997698989999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      |+++|+++..+..   ..+|+++|+.|||++++|..++.++...
T Consensus        90 ii~~ta~~~~~~~---~~ag~~~~l~KP~~~~~L~~~i~~~~~~  130 (140)
T 3c97_A           90 IIAITADTIDDDR---PGAELDEYVSKPLNPNQLRDVVLTCHSE  130 (140)
T ss_dssp             CEEEESSCCSCCC---CCSSCSEEEESSCCHHHHHHHHHHHHC-
T ss_pred             EEEEECCCCHHHH---HHCCCCEEEECCCCHHHHHHHHHHHHHC
T ss_conf             9999899629999---8579988998989999999999999745


No 82 
>3eul_A Possible nitrate/nitrite response transcriptional regulatory protein NARL (DNA-binding...; central beta strand flanked by alpha helices; 1.90A {Mycobacterium tuberculosis}
Probab=99.91  E-value=8e-23  Score=155.09  Aligned_cols=118  Identities=21%  Similarity=0.205  Sum_probs=105.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCC-E-EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             799973998999999999998898-9-99999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGF-M-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~-~-v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |||||||++.+|..++.+|+..|. + |.+|.||.+|++.+.+. .||+|++|++||++  .++++++|+.  .+.+|||
T Consensus        17 rVLIvDD~~~~r~~l~~~L~~~~~~~vv~~a~~~~eal~~~~~~-~pDvvllDl~mp~~~G~el~~~ir~~--~~~~~vi   93 (152)
T 3eul_A           17 RVVVGDDHPLFREGVVRALSLSGSVNVVGEADDGAAALELIKAH-LPDVALLDYRMPGMDGAQVAAAVRSY--ELPTRVL   93 (152)
T ss_dssp             EEEEECSSHHHHHHHHHHHHHHSSEEEEEEESSHHHHHHHHHHH-CCSEEEEETTCSSSCHHHHHHHHHHT--TCSCEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC-CCCEEEECCCCCCCCHHHHHHHHHHH--CCCCEEE
T ss_conf             89999499999999999998598957999989999999999846-99999981899998999999999975--8998599


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             996389989999999769988997698989999999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      ++|++++.+...+|+++||++|+.||++.++|..+++++.+.+..
T Consensus        94 vlS~~~~~~~~~~a~~~Ga~~yl~Kp~~~~~L~~aI~~~~~g~~~  138 (152)
T 3eul_A           94 LISAHDEPAIVYQALQQGAAGFLLKDSTRTEIVKAVLDCAKGRDV  138 (152)
T ss_dssp             EEESCCCHHHHHHHHHTTCSEEEETTCCHHHHHHHHHHHHHCC--
T ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCCCCC
T ss_conf             996869999999999869989997999999999999999879997


No 83 
>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B*
Probab=99.90  E-value=6.6e-24  Score=161.54  Aligned_cols=105  Identities=16%  Similarity=0.225  Sum_probs=91.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHC-CCE-EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEE
Q ss_conf             77999739989999999999988-989-99999979999999717999489970789987--738999961434889739
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDF-GFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~-g~~-v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pi   77 (133)
                      .|||||||++.+|+.++.+|+.. |++ |.+|.||.||++.+.++..||+||+||+||+|  +++++++|+.+.. .+|+
T Consensus        14 ~rVLIVDD~~~~r~~l~~~L~~~~~~~vv~~A~~g~eAl~~l~~~~~~DliilD~~MP~~dG~e~~~~ir~~~~~-~i~i   92 (145)
T 3kyj_B           14 YNVMIVDDAAMMRLYIASFIKTLPDFKVVAQAANGQEALDKLAAQPNVDLILLDIEMPVMDGMEFLRHAKLKTRA-KICM   92 (145)
T ss_dssp             EEEEEECSCHHHHHHHHHHHTTCTTEEEEEEESSHHHHHHHHHHCTTCCEEEECTTSCCCTTCHHHHHHHHHCCC-EEC-
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHHHCCCC-CEEE
T ss_conf             789999698999999999998599946999989999999999836999899987899999999999999856996-9399


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEECCCCH
Q ss_conf             999638998999999976998899769898
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLLKPFNR  107 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~  107 (133)
                      +++|++++.+...+|+++||++||.|||+.
T Consensus        93 i~~t~~~~~~~~~~a~~~Ga~~yl~KP~~~  122 (145)
T 3kyj_B           93 LSSVAVSGSPHAARARELGADGVVAKPSGT  122 (145)
T ss_dssp             CBSSCSTTSSHHHHHHHTTCSCCCBCCCSC
T ss_pred             EEEEECCCHHHHHHHHHCCCCEEEECCCCC
T ss_conf             999607998999999986998999899984


No 84 
>3eqz_A Response regulator; structural genomics, unknown function, PSI-2, protein structure initiative; 2.15A {Colwellia psychrerythraea 34H}
Probab=99.90  E-value=2.7e-24  Score=163.89  Aligned_cols=116  Identities=15%  Similarity=0.113  Sum_probs=101.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      |+||||||||+.+|+.++.+|+.+|+.|. |.++.+|+..+.+ ..||+|++|+.||++  .++++++|+.  .+.+|||
T Consensus         3 ~~rILIVDDd~~~~~~l~~~L~~~g~~v~-a~~~~eal~~l~~-~~~dlillD~~mP~~dG~el~~~lr~~--~~~~~ii   78 (135)
T 3eqz_A            3 LNRVFIVDDDTLTCNLLKTIVEPIFGNVE-AFQHPRAFLTLSL-NKQDIIILDLMMPDMDGIEVIRHLAEH--KSPASLI   78 (135)
T ss_dssp             CCEEEEECSCHHHHHHHHHHHTTTCSCEE-EESCHHHHTTSCC-CTTEEEEEECCTTTTHHHHHHHHHHHT--TCCCEEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEE-ECCHHHHHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHHC--CCCCCEE
T ss_conf             89999992999999999999997899899-9178999999865-899999985999999899999999952--9999799


Q ss_pred             EEECCCCH-----HHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             99638998-----9999999769988997698989999999999999
Q gi|254780892|r   79 YLLMEVDF-----EKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        79 ~lT~~~~~-----~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      ++|++++.     +...++..+|+.+||.|||++++|..+++++.++
T Consensus        79 ils~~~~~~~~~~~~~~~~~~~g~~d~l~KP~~~~~L~~~l~~~~~r  125 (135)
T 3eqz_A           79 LISGYDSGVLHSAETLALSCGLNVINTFTKPINTEVLTCFLTSLSNR  125 (135)
T ss_dssp             EEESSCHHHHHHHHHHHHHTTCEEEEEEESSCCHHHHHHHHHHHSCC
T ss_pred             EEECCCCCCCHHHHHHHHHHCCCCCEEEECCCCHHHHHHHHHHHHHH
T ss_conf             99835765440099999995599987997989999999999999989


No 85 
>2pln_A HP1043, response regulator; signaling protein; 1.80A {Helicobacter pylori} PDB: 2hqo_A
Probab=99.90  E-value=7.2e-23  Score=155.35  Aligned_cols=112  Identities=14%  Similarity=0.232  Sum_probs=101.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             799973998999999999998898999999979999999717999489970789987--738999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~l   80 (133)
                      ||||||||+.+++.++..|+..||+|..|.||++|++.+.+. .||+|+    ||++  +++++++|+.  .+.+|||++
T Consensus        20 rILvVEDd~~~~~~l~~~L~~~G~~v~~a~~g~~al~~l~~~-~~Dlvi----Lp~~~G~ell~~ir~~--~~~~piiil   92 (137)
T 2pln_A           20 RVLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDIR-NYDLVM----VSDKNALSFVSRIKEK--HSSIVVLVS   92 (137)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHTTCEEEEESCHHHHHHHHHHS-CCSEEE----ECSTTHHHHHHHHHHH--STTSEEEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHCC-CCCEEE----EECCCCHHHHHHHHHC--CCCCCEEEE
T ss_conf             899995999999999999998899999989999999999728-999999----8278763799999962--889975999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHHHHHHH
Q ss_conf             63899899999997699889976989-899999999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRELPQMQ  121 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~-~~~L~~~i~~~~~~~  121 (133)
                      |++++.+...+|+++||+||+.|||. .++|..+++.++++.
T Consensus        93 T~~~~~~~~~~al~~Gaddyl~KPf~~~~eL~aRI~allRR~  134 (137)
T 2pln_A           93 SDNPTSEEEVHAFEQGADDYIAKPYRSIKALVARIEARLRFW  134 (137)
T ss_dssp             ESSCCHHHHHHHHHTTCSEEEESSCSCHHHHHHHHHHHTC--
T ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHHHHCCC
T ss_conf             648999999999986998899799999899999999996665


No 86 
>1p2f_A Response regulator; DRRB, OMPR/PHOB, transcription; HET: MSE; 1.80A {Thermotoga maritima} SCOP: a.4.6.1 c.23.1.1
Probab=99.90  E-value=9.1e-23  Score=154.77  Aligned_cols=115  Identities=20%  Similarity=0.262  Sum_probs=103.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHH--HHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987738--9999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF--IAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l--~~~ir~~~~~~~~pii   78 (133)
                      |+|||||||++..+..++..|+..|+ |..|.+|.+|+.   ....||+||+|++||++.|+  +.+++.  ..+.+||+
T Consensus         2 M~kILiVdDd~~~~~~l~~~L~~~g~-v~~~~~~~eal~---~~~~~DlvilD~~lp~~~g~~~~~~~~~--~~~~~~ii   75 (220)
T 1p2f_A            2 MWKIAVVDDDKNILKKVSEKLQQLGR-VKTFLTGEDFLN---DEEAFHVVVLDVMLPDYSGYEICRMIKE--TRPETWVI   75 (220)
T ss_dssp             CEEEEEECSCHHHHHHHHHHHTTTEE-EEEESSHHHHHH---CCSCCSEEEEESBCSSSBHHHHHHHHHH--HCTTSEEE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCE-EEEECCHHHHHH---HCCCCCEEEEECCCCCCCCCHHHHHHHH--CCCCEEEE
T ss_conf             98899995989999999999986999-999879999995---2789999999799998886023332110--24420343


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             9963899899999997699889976989899999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      ++|+.++.+...++++.||+||+.||++.++|..++++++++.
T Consensus        76 ilt~~~~~~~~~~~~~~gaddyl~KP~~~~eL~~ri~~~l~r~  118 (220)
T 1p2f_A           76 LLTLLSDDESVLKGFEAGADDYVTKPFNPEILLARVKRFLERE  118 (220)
T ss_dssp             EEESCCSHHHHHHHHHHTCSEEEESSCCHHHHHHHHHHHHHHC
T ss_pred             ECCCCCCCEEEEEEECCCCCEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             0122323003675441465222435732001899999998305


No 87 
>2j48_A Two-component sensor kinase; pseudo-receiver, circadian clock, transferase, response regulator, histidine protein kinase; NMR {Synechococcus elongatus}
Probab=99.90  E-value=1.5e-23  Score=159.35  Aligned_cols=113  Identities=18%  Similarity=0.163  Sum_probs=103.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .||||||||+.+++.++..|+.+||+|..|.||.+|++.+.+. .||+|++|+.||++  .++++++|+.+..+.+|+|+
T Consensus         2 ~rILiVdd~~~~~~~~~~~L~~~g~~v~~a~~~~~al~~l~~~-~pdlvllD~~lp~~~G~~l~~~lr~~~~~~~~pii~   80 (119)
T 2j48_A            2 GHILLLEEEDEAATVVCEMLTAAGFKVIWLVDGSTALDQLDLL-QPIVILMAWPPPDQSCLLLLQHLREHQADPHPPLVL   80 (119)
T ss_dssp             CEEEEECCCHHHHHHHHHHHHHTTCEEEEESCHHHHHHHHHHH-CCSEEEEECSTTCCTHHHHHHHHHHTCCCSSCCCEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHCCCCCCCEEEE
T ss_conf             9899997999999999999998899999989999999999817-999899963799999999999998288889864999


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             963899899999997699889976989899999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
                      +|++++.   .+++++|+++|+.|||++++|..++++++
T Consensus        81 ~t~~~~~---~~~~~~ga~~~l~KP~~~~~L~~~v~~ll  116 (119)
T 2j48_A           81 FLGEPPV---DPLLTAQASAILSKPLDPQLLLTTLQGLC  116 (119)
T ss_dssp             EESSCCS---SHHHHHHCSEECSSCSTTHHHHHHHHTTC
T ss_pred             EECCHHH---HHHHHCCCCEEEECCCCHHHHHHHHHHHC
T ss_conf             9771889---99998799899989899999999999883


No 88 
>1qo0_D AMIR; binding protein, gene regulator, receptor; 2.25A {Pseudomonas aeruginosa} SCOP: c.23.1.3
Probab=99.89  E-value=2.1e-22  Score=152.60  Aligned_cols=113  Identities=9%  Similarity=-0.033  Sum_probs=97.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             77999739989999999999988989999999799999997179994899707899877389999614348897399996
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYYLL   81 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii~lT   81 (133)
                      .|||||||++.+|..+...|+.+||+|..+.+|.+|+.     ..||+|++|+.||++.+... .+.....+.+|||++|
T Consensus        13 l~vLvvdd~~~~~~~l~~~L~~~G~~v~~~~~~~~al~-----~~~D~vl~D~~mp~~~~~~~-~~~~~~~~~~pvI~lt   86 (196)
T 1qo0_D           13 LQVLVLNPPGEVSDALVLQLIRIGCSVRQCWPPPEAFD-----VPVDVVFTSIFQNRHHDEIA-ALLAAGTPRTTLVALV   86 (196)
T ss_dssp             CEEEEESCTTHHHHHHHHHHHHHTCEEEEECSCCSSCS-----SCCSEEEEECCSSTHHHHHH-HHHHHSCTTCEEEEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEECCCCHHHHCC-----CCCCEEEEECCCCCCCHHHH-HHHHHCCCCCCEEEEE
T ss_conf             86999957999999999999986998871699799848-----89998998489999859999-9998649999889984


Q ss_pred             CCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             389989999999769988997698989999999999999
Q gi|254780892|r   82 MEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        82 ~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      ++++.+...+++++|+++|+.|||++++|..++..+...
T Consensus        87 ~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~l~~~~~~  125 (196)
T 1qo0_D           87 EYESPAVLSQIIELECHGVITQPLDAHRVLPVLVSARRI  125 (196)
T ss_dssp             CCCSHHHHHHHHHHTCSEEEESSCCGGGHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHH
T ss_conf             579999999999859998655999989999999999999


No 89 
>1a04_A Nitrate/nitrite response regulator protein NARL; signal transduction protein, response regulators, two- component systems; 2.20A {Escherichia coli} SCOP: a.4.6.2 c.23.1.1 PDB: 1rnl_A
Probab=99.86  E-value=2.1e-20  Score=140.72  Aligned_cols=114  Identities=21%  Similarity=0.297  Sum_probs=102.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCH--HHHHHHHCCCCCCCEEE
Q ss_conf             79997399899999999999889--899999997999999971799948997078998773--89999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE--FIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~--l~~~ir~~~~~~~~pii   78 (133)
                      |||||||++.+|..++.+|+..+  ..|.+|.+|++|++.+.+. .||+|++|++||++.|  +++.++..  .+.+|++
T Consensus         7 rILIvdD~~~~~~~l~~~L~~~~~~~~v~~a~~~~~~l~~~~~~-~pdlvllD~~lp~~~G~~~~~~~~~~--~~~~~ii   83 (215)
T 1a04_A            7 TILLIDDHPMLRTGVKQLISMAPDITVVGEASNGEQGIELAESL-DPDLILLDLNMPGMNGLETLDKLREK--SLSGRIV   83 (215)
T ss_dssp             EEEEECSCHHHHHHHHHHHTTCTTEEEEEEESSHHHHHHHHHHH-CCSEEEEETTSTTSCHHHHHHHHHHS--CCCSEEE
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCCCCCCCCCCC--CCCCCCC
T ss_conf             89999298999999999998589928999979999999999746-99689996888998986232101124--5665543


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      ++|++++.+...+|+++||++|+.||++.+++..++..+..
T Consensus        84 vlt~~~~~~~~~~a~~~Ga~~yl~K~~~~~~l~~~i~~~~~  124 (215)
T 1a04_A           84 VFSVSNHEEDVVTALKRGADGYLLKDMEPEDLLKALHQAAA  124 (215)
T ss_dssp             EEECCCCHHHHHHHHHTTCSEEEETTCCHHHHHHHHHHHHH
T ss_pred             CCCCCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             44367999999999984998986025999999999999984


No 90 
>1a2o_A CHEB methylesterase; bacterial chemotaxis, adaptation, serine hydrolase; 2.40A {Salmonella typhimurium} SCOP: c.23.1.1 c.40.1.1
Probab=99.84  E-value=9.1e-21  Score=142.85  Aligned_cols=103  Identities=24%  Similarity=0.301  Sum_probs=83.0

Q ss_pred             CC--EEEEECCCHHHHHHHHHHHHHCC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCC
Q ss_conf             97--79997399899999999999889--89999999799999997179994899707899877--38999961434889
Q gi|254780892|r    1 MD--SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTD   74 (133)
Q Consensus         1 m~--~ILiVDD~~~~r~~l~~~L~~~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~   74 (133)
                      |+  |||||||++.+|+.++++|+..|  +.|.+|.||.+|++.+.+. .||+|++|++||+|+  ++++++++..   .
T Consensus         1 M~kiRVLIVDD~~~~R~~l~~~L~~~~~~~vV~~A~~g~eAl~~~~~~-~pDvvilDi~MP~mdGle~l~~i~~~~---~   76 (349)
T 1a2o_A            1 MSKIRVLSVDDSALMRQIMTEIINSHSDMEMVATAPDPLVARDLIKKF-NPDVLTLDVEMPRMDGLDFLEKLMRLR---P   76 (349)
T ss_dssp             CCCEEEEEECSCHHHHHHHHHHHHTSTTEEEEEEESSHHHHHHHHHHH-CCSEEEEECCCSSSCHHHHHHHHHHSS---C
T ss_pred             CCCCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHHC---C
T ss_conf             998889999598999999999998588969999979999999999627-998999979789999899999988758---9


Q ss_pred             CEEEEEECCCC--HHHHHHHHHCCCCEEEECCCCH
Q ss_conf             73999963899--8999999976998899769898
Q gi|254780892|r   75 VFVYYLLMEVD--FEKMIAGARAGANSFLLKPFNR  107 (133)
Q Consensus        75 ~pii~lT~~~~--~~~~~~a~~~Ga~~yl~KP~~~  107 (133)
                      .|++++++...  .+...+|+++||+||+.||+..
T Consensus        77 ~~ii~i~~~~~~~~~~~~~Al~~GA~dyl~KP~~~  111 (349)
T 1a2o_A           77 MPVVMVSSLTGKGSEVTLRALELGAIDFVTKPQLG  111 (349)
T ss_dssp             CCEEEEECCTHHHHHHHHHHHHHTCCEEEECSSSS
T ss_pred             CCCEEEEEEEECCHHHHHHHHHCCCCEEEECCCHH
T ss_conf             97048999850441777889975981999778402


No 91 
>2hqr_A Putative transcriptional regulator; phosporylation-independent response regulator, H. pylori, symmetric dimer, signaling protein; NMR {Helicobacter pylori J99}
Probab=99.84  E-value=2.5e-20  Score=140.19  Aligned_cols=110  Identities=15%  Similarity=0.246  Sum_probs=95.6

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEE
Q ss_conf             97799973998999999999998898999999979999999717999489970789987--7389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii   78 (133)
                      || ||+||||+..+..++..|+..||+|..|.+|.+|++.+.. ..||+|+    ||++  +++++++|+.  .+.+|||
T Consensus         1 Mr-ILiVeDd~~~~~~l~~~L~~~g~~v~~a~~~~~a~~~~~~-~~~Dlvi----lp~~~G~~l~~~ir~~--~~~~pIi   72 (223)
T 2hqr_A            1 MR-VLLIEKNSVLGGEIEKGLNVKGFMADVTESLEDGEYLMDI-RNYDLVM----VSDKNALSFVSRIKEK--HSSIVVL   72 (223)
T ss_dssp             CC-EEEECSCHHHHHHHHHHHGGGTCCEEEESSHHHHHHHHTT-SCCSEEE----ECCTTHHHHHHHHHHH--CTTSEEE
T ss_pred             CE-EEEEECCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHC-CCCCEEE----ECCCCHHHHHHHHHHC--CCCCEEE
T ss_conf             98-9999389999999999999879999998999999999845-8999999----5898899999998764--8983299


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCH-HHHHHHHHHHH
Q ss_conf             99638998999999976998899769898-99999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNR-ETLRFAMRELP  118 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~-~~L~~~i~~~~  118 (133)
                      ++|+.++.+...+++++||+||+.|||+. ++|..+++...
T Consensus        73 ~lt~~~~~~~~~~~l~~Gaddyl~KP~~~~~~l~~~~~~~~  113 (223)
T 2hqr_A           73 VSSDNPTSEEEVHAFEQGADDYIAKPYRSIKALVARIEARL  113 (223)
T ss_dssp             EEESSCCHHHHHHHHHHTCSEEEETTCSCTHHHHHHHHHHT
T ss_pred             EECCCCCHHHHHHHHHCCCCCEEECCCCHHHHHHHHHHHHH
T ss_conf             82366758999998753997078724220256899999997


No 92 
>3c3w_A Two component transcriptional regulatory protein DEVR; response regulator, two-component regulatory system, DNA- binding protein; 2.20A {Mycobacterium tuberculosis}
Probab=99.75  E-value=2.5e-18  Score=128.30  Aligned_cols=117  Identities=24%  Similarity=0.212  Sum_probs=103.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCC-CE-EEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCE
Q ss_conf             9779997399899999999999889-89-999999799999997179994899707899877--3899996143488973
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFG-FM-VFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVF   76 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g-~~-v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~p   76 (133)
                      |.|||||||++.+|..++.+|+..+ ++ |.+|.++.+|++.+... .||++++|+.||++.  ++++.++..  .+++|
T Consensus         1 MirIlivdD~~~~r~~l~~~L~~~~~~~vv~~a~~~~eal~~~~~~-~pdlvl~d~~l~~~~g~~~~~~l~~~--~~~~~   77 (225)
T 3c3w_A            1 MVKVFLVDDHEVVRRGLVDLLGADPELDVVGEAGSVAEAMARVPAA-RPDVAVLDVRLPDGNGIELCRDLLSR--MPDLR   77 (225)
T ss_dssp             CEEEEEECSCHHHHHHHHHHHHTCTTEEEEEEESSHHHHHHHHHHH-CCSEEEECSEETTEEHHHHHHHHHHH--CTTCE
T ss_pred             CCEEEEEECCHHHHHHHHHHHHHCCCEEEEEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCCHHHHHHHHCC--CCCCC
T ss_conf             9889999698999999999998589948999979999999999865-99899982778998615898875302--89985


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHH
Q ss_conf             99996389989999999769988997698989999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM  120 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~  120 (133)
                      |+++|+..+.....++++.||++|+.||++.+++..++..+.+.
T Consensus        78 vi~~t~~~~~~~~~~al~~Ga~~~l~K~~~~~~l~~~i~~v~~~  121 (225)
T 3c3w_A           78 CLILTSYTSDEAMLDAILAGASGYVVKDIKGMELARAVKDVGAG  121 (225)
T ss_dssp             EEEGGGSSSHHHHHHHHHHTCCCHHHHHHHHHHHHHHHHHHHHH
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHCC
T ss_conf             78631566578999999849887740677799999999999869


No 93 
>3cwo_X Beta/alpha-barrel protein based on 1THF and 1TMY; XRAY, CHEY, HISF, half barrel, de novo protein; 3.10A {Thermotoga maritima}
Probab=99.68  E-value=2e-17  Score=122.89  Aligned_cols=80  Identities=20%  Similarity=0.209  Sum_probs=70.3

Q ss_pred             EEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC--HHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             999999799999997179994899707899877--389999614348897399996389989999999769988997698
Q gi|254780892|r   28 VFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF  105 (133)
Q Consensus        28 v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~--~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~  105 (133)
                      |.+|.||.||++.+.+. .||+|++|++||+|+  ++++++|+.  .+++|||++|++++.++..+|+++||++|+.||+
T Consensus         8 v~~A~~g~eal~~~~~~-~pdlv~~Di~mP~~~G~~~~~~i~~~--~~~~~ii~~t~~~~~~~~~~a~~~Ga~~y~~Kp~   84 (237)
T 3cwo_X            8 VDDATNGREAVEKYKEL-KPDIVTMDITMPEMNGIDAIKEIMKI--DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVNTA   84 (237)
T ss_dssp             EECCCSSSTTHHHHHHH-CCSCEEEECCSTTSSHHHHHHHHHHH--SSSCCEEEECCSSTHHHHHHHHHTTCCEEEESHH
T ss_pred             EEEECCHHHHHHHHHHC-CCCEEEEECCCCCCCHHHHHHHHHHH--CCCCCEEEEEECCCHHHHHHHHHCCCCEEEECCC
T ss_conf             99859999999999843-99999992878998999999999986--8998499998165132324788459876998985


Q ss_pred             CHHHH
Q ss_conf             98999
Q gi|254780892|r  106 NRETL  110 (133)
Q Consensus       106 ~~~~L  110 (133)
                      +.+++
T Consensus        85 ~~~~~   89 (237)
T 3cwo_X           85 AVENP   89 (237)
T ss_dssp             HHHCT
T ss_pred             CCCCH
T ss_conf             63677


No 94 
>3luf_A Two-component system response regulator/ggdef domain protein; structural genomics, ASA_2441, PSI-2, protein structure initiative; HET: MSE; 1.76A {Aeromonas salmonicida} PDB: 3mf4_A*
Probab=99.65  E-value=7.8e-16  Score=113.43  Aligned_cols=106  Identities=15%  Similarity=0.140  Sum_probs=87.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      +||||||||+..|+.+...|...|+.+..+.++.+|+..+. +..||+|++|++|||+  .++++.++.    .++|+++
T Consensus         5 ~rILvVdD~~~~~~~l~~~L~~~~~~~v~~~~~~ea~~~~~-~~~~dlillD~~mP~~~g~e~~~~l~~----~~~pvi~   79 (259)
T 3luf_A            5 QKILIVEDSMTIRRMLIQAIAQQTGLEIDAFDTLEGARHCQ-GDEYVVALVDLTLPDAPSGEAVKVLLE----RGLPVVI   79 (259)
T ss_dssp             CEEEEECCCHHHHHHHHHHHHHHHCCEEEEESSTGGGTTCC-TTTEEEEEEESCBTTBTTSHHHHHHHH----TTCCEEE
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEEEECHHHHHHHHC-CCCCCEEEEECCCCCCCHHHHHHHHHH----CCCCCCC
T ss_conf             87999979999999999999975998999938699999965-899988999788875402357898764----0387423


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHH
Q ss_conf             963899899999997699889976989899999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRF  112 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~  112 (133)
                      +|+.........++.+|+.+|+.||.....+..
T Consensus        80 ~t~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~  112 (259)
T 3luf_A           80 LTADISEDKREAWLEAGVLDYVMKDSRHSLQYA  112 (259)
T ss_dssp             EECC-CHHHHHHHHHTTCCEEEECSSHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHCCCCCCCCCCCCCCCHHH
T ss_conf             467545788999997488644454321000027


No 95 
>3klo_A Transcriptional regulator VPST; REC domain, HTH domain, DNA-binding, transcription regulation; HET: C2E TAR; 2.80A {Vibrio cholerae} PDB: 3kln_A*
Probab=99.51  E-value=9.1e-15  Score=107.09  Aligned_cols=116  Identities=11%  Similarity=0.000  Sum_probs=92.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHC-CCE--EEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHH--HHHHHHCCCCCCCE
Q ss_conf             77999739989999999999988-989--99999979999999717999489970789987738--99996143488973
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDF-GFM--VFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF--IAHVRQMPLGTDVF   76 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~-g~~--v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l--~~~ir~~~~~~~~p   76 (133)
                      -+|+||||++..+..++..|+.. +..  +..+.++..+...+.. ..||+|++|+.||++.++  +..++. ...+++|
T Consensus         8 ~~VllvdD~~l~~~~L~~~Le~~~~~~~~v~~~~~~~~~~~~~~~-~~~dlvl~D~~~~~~~~~~~~~~~~~-~~~p~~~   85 (225)
T 3klo_A            8 LNVRMLSDVCMQSRLLKEALESKLPLALEITPFSELWLEENKPES-RSIQMLVIDYSRISDDVLTDYSSFKH-ISCPDAK   85 (225)
T ss_dssp             EEEEEESCCSHHHHHHHHHHHHHSSEEEEEECGGGHHHHTTCSGG-GGCCEEEEEGGGCCHHHHHHHHHHHH-HHCTTCE
T ss_pred             CEEEEEECCHHHHHHHHHHHHCCCCCEEEEEECCCHHHHHHHHHC-CCCCEEEEECCCCCCCHHHHHHHHHH-HHCCCCE
T ss_conf             989998287999999999994789964999975768999862442-58888997236899736999999999-7589984


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             9999638998999999976998899769898999999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      |+++|++.+......+++.|+.+|+.|+.+.++|..+++.+.+
T Consensus        86 vivlt~~~~~~~~~~~~~~Ga~g~l~K~~~~~~L~~ai~~v~~  128 (225)
T 3klo_A           86 EVIINCPQDIEHKLLFKWNNLAGVFYIDDDMDTLIKGMSKILQ  128 (225)
T ss_dssp             EEEEEECTTCCHHHHTTSTTEEEEEETTCCHHHHHHHHHHHHT
T ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHC
T ss_conf             9999615668999999986995999779999999999999847


No 96 
>1w25_A Stalked-cell differentiation controlling protein; two-component system, response regulator, diguanylate cyclase, ggdef domain; HET: C2E; 2.70A {Caulobacter vibrioides} SCOP: c.23.1.1 c.23.1.1 d.58.29.2 PDB: 2v0n_A* 2wb4_A*
Probab=98.84  E-value=4.3e-07  Score=61.32  Aligned_cols=119  Identities=16%  Similarity=0.184  Sum_probs=95.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEE
Q ss_conf             7799973998999999999998898999999979999999717999489970789987--73899996143488973999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~   79 (133)
                      .+++++|++...+..+...+....+....+ ++ .+...... ..+|++++|+.||++  .+++...+.......+|++.
T Consensus       153 ~~~~~~d~~~~~~~~l~~~l~~~~~~~~~~-~~-~~~~l~~~-~~~dlvl~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~  229 (459)
T 1w25_A          153 GRVLIVDDNERQAQRVAAELGVEHRPVIES-DP-EKAKISAG-GPVDLVIVNAAAKNFDGLRFTAALRSEERTRQLPVLA  229 (459)
T ss_dssp             CEEEEECSCHHHHHHHHHHHTTTSEEEEEC-CH-HHHHHHHH-SSCSEEEEETTCSSSCHHHHHHHHHTSGGGTTCCEEE
T ss_pred             CEEEECCCCHHHHHHHHHHHHCCCEEEEEC-CH-HHHHHHCC-CCCEEEEECHHHHCCCHHHHHHHHHHHHHHHHHHHHH
T ss_conf             535530535999999999853156077736-86-89998359-9960999613651331488988876410043311221


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHH
Q ss_conf             96389989999999769988997698989999999999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      +++.........+++.|+.+|+.||+....+..++.........
T Consensus       230 ~~~~~~~~~~~~~~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~  273 (459)
T 1w25_A          230 MVDPDDRGRMVKALEIGVNDILSRPIDPQELSARVKTQIQRKRY  273 (459)
T ss_dssp             EECTTCHHHHHHHHHTTCCEEEESSCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCCCHHHHHHHHHHCCCHHCCCCCCCHHHHHHHHHHHHHHHH
T ss_conf             25753078999999815531104553100114555555445777


No 97 
>2vyc_A Biodegradative arginine decarboxylase; pyridoxal phosphate, PLP-dependent enzyme, lyase, cytoplasm, acid resistance; HET: LLP; 2.4A {Escherichia coli}
Probab=98.01  E-value=4.2e-05  Score=49.51  Aligned_cols=117  Identities=14%  Similarity=0.066  Sum_probs=82.1

Q ss_pred             EEEEECCCH-----HHHHH---HHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC------CHHHHHHHH
Q ss_conf             799973998-----99999---9999998898999999979999999717999489970789987------738999961
Q gi|254780892|r    3 SLLLVDSSH-----IVRKV---GRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV------LEFIAHVRQ   68 (133)
Q Consensus         3 ~ILiVDD~~-----~~r~~---l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~------~~l~~~ir~   68 (133)
                      +|||||++-     .....   +...++..||+|..+.+-++|+..+..+...+++++||.+++.      .+++..+|.
T Consensus         2 ~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~v~~~~~~~d~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~   81 (755)
T 2vyc_A            2 KVLIVESEFLHQDTWVGNAVERLADALSQQNVTVIKSTSFDDGFAILSSNEAIDCLMFSYQMEHPDEHQNVRQLIGKLHE   81 (755)
T ss_dssp             EEEEECCTTSTTSHHHHHHHHHHHHHHHHTTCEEEEESSHHHHHHHHTTTCCCSEEEEECCCCSHHHHHHHHHHHHHHHH
T ss_pred             EEEEEECCCCCCCCHHHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHHH
T ss_conf             69999155557674011689999999986791899848789999999758887689997068885321349999999997


Q ss_pred             CCCCCCCEEEEEECCC-CHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHHHHHHH
Q ss_conf             4348897399996389-9899999997699889976989-899999999999999
Q gi|254780892|r   69 MPLGTDVFVYYLLMEV-DFEKMIAGARAGANSFLLKPFN-RETLRFAMRELPQMQ  121 (133)
Q Consensus        69 ~~~~~~~pii~lT~~~-~~~~~~~a~~~Ga~~yl~KP~~-~~~L~~~i~~~~~~~  121 (133)
                      .  .+++||.+++... ..+..-.......+.|+..-=+ ++....++....+++
T Consensus        82 ~--~~~~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~y  134 (755)
T 2vyc_A           82 R--QQNVPVFLLGDREKALAAMDRDLLELVDEFAWILEDTADFIAGRAVAAMTRY  134 (755)
T ss_dssp             H--STTCCEEEEECHHHHHHTCSHHHHHHCSEEEETTTSCHHHHHHHHHHHHHHH
T ss_pred             H--CCCCCEEEEECCCCCHHHCCHHHHHHHHEEEECCCCCHHHHHHHHHHHHHHH
T ss_conf             3--8899989995465303107898986413577615787899999999999999


No 98 
>2yxb_A Coenzyme B12-dependent mutase; alpha/beta, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.80A {Aeropyrum pernix K1}
Probab=97.54  E-value=0.0037  Score=37.93  Aligned_cols=118  Identities=15%  Similarity=0.127  Sum_probs=87.5

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEEC---CHHHHHHHHHHCCCCCEEEECCCCCCC----CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             3998999999999998898999999---979999999717999489970789987----738999961434889739999
Q gi|254780892|r    8 DSSHIVRKVGRHLFNDFGFMVFEAT---SVCEAREFCEKELLPNYLVIDESMEGV----LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         8 DD~~~~r~~l~~~L~~~g~~v~~a~---~g~eAl~~~~~~~~pdlii~D~~mP~~----~~l~~~ir~~~~~~~~pii~l   80 (133)
                      |....-..++..+|+..||+|.-..   +.++.++.+.++ .||+|.+...|...    .++...+|+. ...++||+ +
T Consensus        29 D~HdiG~~~va~~l~~~G~eV~~LG~~~p~e~~v~~a~~~-~~d~v~lS~~~~~~~~~~~~~i~~L~~~-g~~~i~i~-v  105 (161)
T 2yxb_A           29 DGHDRGAKVVARALRDAGFEVVYTGLRQTPEQVAMAAVQE-DVDVIGVSILNGAHLHLMKRLMAKLREL-GADDIPVV-L  105 (161)
T ss_dssp             SSCCHHHHHHHHHHHHTTCEEECCCSBCCHHHHHHHHHHT-TCSEEEEEESSSCHHHHHHHHHHHHHHT-TCTTSCEE-E
T ss_pred             CHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHC-CCCEEEEECCCCCCHHHHHHHHHHHHHC-CCCCCEEE-E
T ss_conf             6247889999999997898899789778999999999866-9989998557664489999999999975-99998799-9


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             638998999999976998899769898999999999999999999998
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQ  128 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~~~~~~~~  128 (133)
                      -|.....+.....+.|++.+...-.+..+....+.+.+..++.+.+..
T Consensus       106 GG~~~~~d~~~l~~~Gvd~vF~pgt~~~e~v~~l~~~~~~~r~~~~~~  153 (161)
T 2yxb_A          106 GGTIPIPDLEPLRSLGIREIFLPGTSLGEIIEKVRKLAEEKRMREEAE  153 (161)
T ss_dssp             EECCCHHHHHHHHHTTCCEEECTTCCHHHHHHHHHHHHHHHHHHHHTC
T ss_pred             ECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHHHHHCCCC
T ss_conf             668798889999977988884998999999999999999988631346


No 99 
>1ccw_A Protein (glutamate mutase); coenzyme B12, radical reaction, TIM- barrel, rossman-fold, isomerase; HET: CNC TAR; 1.60A {Clostridium cochlearium} SCOP: c.23.6.1 PDB: 1cb7_A* 1b1a_A 1i9c_A* 1be1_A 1fmf_A 1id8_A*
Probab=95.90  E-value=0.09  Score=29.66  Aligned_cols=114  Identities=10%  Similarity=-0.013  Sum_probs=79.8

Q ss_pred             EEEE--E--CCCHHHHHHHHHHHHHCCCEEEEE---CCHHHHHHHHHHCCCCCEEEECCCCCCC----CHHHHHHHHCCC
Q ss_conf             7999--7--399899999999999889899999---9979999999717999489970789987----738999961434
Q gi|254780892|r    3 SLLL--V--DSSHIVRKVGRHLFNDFGFMVFEA---TSVCEAREFCEKELLPNYLVIDESMEGV----LEFIAHVRQMPL   71 (133)
Q Consensus         3 ~ILi--V--DD~~~~r~~l~~~L~~~g~~v~~a---~~g~eAl~~~~~~~~pdlii~D~~mP~~----~~l~~~ir~~~~   71 (133)
                      ||++  +  |-...-..++..+|+..||+|.-.   ...++-++.+.++ .||+|.+...|+..    -++++.+|+. .
T Consensus         5 kVvi~~~~~D~H~lG~~~va~~l~~~G~~V~~LG~~~p~e~iv~~~~~~-~~d~V~iS~~~~~~~~~~~~~i~~L~~~-~   82 (137)
T 1ccw_A            5 TIVLGVIGSDCHAVGNKILDHAFTNAGFNVVNIGVLSPQELFIKAAIET-KADAILVSSLYGQGEIDCKGLRQKCDEA-G   82 (137)
T ss_dssp             EEEEEEETTCCCCHHHHHHHHHHHHTTCEEEEEEEEECHHHHHHHHHHH-TCSEEEEEECSSTHHHHHTTHHHHHHHT-T
T ss_pred             EEEEEECCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHH-CCCEEEEEECCCCCHHHHHHHHHHHHHC-C
T ss_conf             7999946987458999999999998798799778666999999999983-9987887611344557799999999974-9


Q ss_pred             CCCCEEEEEECC----C-CHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             889739999638----9-9899999997699889976989899999999999
Q gi|254780892|r   72 GTDVFVYYLLME----V-DFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        72 ~~~~pii~lT~~----~-~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
                      ..++||++--+-    . .++...+..+.|++......-++++....+++-+
T Consensus        83 ~~~v~iivGG~~~~~~~~~~~~~~~l~~~G~~~vf~~gt~~~~~~~~i~~~l  134 (137)
T 1ccw_A           83 LEGILLYVGGNIVVGKQHWPDVEKRFKDMGYDRVYAPGTPPEVGIADLKKDL  134 (137)
T ss_dssp             CTTCEEEEEESCSSSSCCHHHHHHHHHHTTCSEECCTTCCHHHHHHHHHHHH
T ss_pred             CCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHH
T ss_conf             9999799978878874441889999997598889799889999999999986


No 100
>2i2x_B MTAC, methyltransferase 1; TIM barrel and helix bundle (MTAB), rossman fold and helix bundle (MTAC); HET: B13; 2.50A {Methanosarcina barkeri}
Probab=95.32  E-value=0.098  Score=29.42  Aligned_cols=100  Identities=12%  Similarity=-0.009  Sum_probs=65.9

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEE--E-CCHHHHHHHHHHCCCCCEEEECCCCCC----CCHHHHHHHHCCCCCCCEEEEEE
Q ss_conf             9989999999999988989999--9-997999999971799948997078998----77389999614348897399996
Q gi|254780892|r    9 SSHIVRKVGRHLFNDFGFMVFE--A-TSVCEAREFCEKELLPNYLVIDESMEG----VLEFIAHVRQMPLGTDVFVYYLL   81 (133)
Q Consensus         9 D~~~~r~~l~~~L~~~g~~v~~--a-~~g~eAl~~~~~~~~pdlii~D~~mP~----~~~l~~~ir~~~~~~~~pii~lT   81 (133)
                      -...-..++..+|+..||+|..  + ...++-++.+.+ ..||+|.+...|+.    +-++++.+|+.  .+++||++ -
T Consensus       135 ~H~lG~~~va~~l~~~G~~V~~LG~~~p~e~i~~~v~~-~~~d~vglS~~l~~~l~~~~~~i~~l~~~--~~~~~iiv-G  210 (258)
T 2i2x_B          135 VHDIGKNIVTALLRANGYNVVDLGRDVPAEEVLAAVQK-EKPIMLTGTALMTTTMYAFKEVNDMLLEN--GIKIPFAC-G  210 (258)
T ss_dssp             CCCHHHHHHHHHHHHTTCEEEEEEEECCSHHHHHHHHH-HCCSEEEEECCCTTTTTHHHHHHHHHHTT--TCCCCEEE-E
T ss_pred             CCHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHH-HCCCEEEEECCCCCCHHHHHHHHHHHHHC--CCCCCEEE-E
T ss_conf             01789999999999879938978998999999999998-29998999415567679999999999974--99994898-8


Q ss_pred             CCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHH
Q ss_conf             389989999999769988997698989999999
Q gi|254780892|r   82 MEVDFEKMIAGARAGANSFLLKPFNRETLRFAM  114 (133)
Q Consensus        82 ~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i  114 (133)
                      |..-.  ..-+-..||+.|-.-+...-.+...+
T Consensus       211 Ga~~~--~~~a~~~gaD~~a~da~~av~~a~~l  241 (258)
T 2i2x_B          211 GGAVN--QDFVSQFALGVYGEEAADAPKIADAI  241 (258)
T ss_dssp             STTCC--HHHHHTSTTEEECSSTTHHHHHHHHH
T ss_pred             CCCCC--HHHHHHHCCCEECCCHHHHHHHHHHH
T ss_conf             98799--99999829884767999999999999


No 101
>3ezx_A MMCP 1, monomethylamine corrinoid protein 1; N terminal all helical bundle C terminal rossmann fold, cobalt, metal-binding; HET: HCB; 2.56A {Methanosarcina barkeri}
Probab=95.08  E-value=0.025  Score=32.95  Aligned_cols=92  Identities=12%  Similarity=0.072  Sum_probs=60.7

Q ss_pred             CCHHHHHHHHHHHHHCCCEEEEE--CC-HHHHHHHHHHCCCCCEEEE--CCC----CCCCCHHHHHHHHCCCCCCCEEEE
Q ss_conf             99899999999999889899999--99-7999999971799948997--078----998773899996143488973999
Q gi|254780892|r    9 SSHIVRKVGRHLFNDFGFMVFEA--TS-VCEAREFCEKELLPNYLVI--DES----MEGVLEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         9 D~~~~r~~l~~~L~~~g~~v~~a--~~-g~eAl~~~~~~~~pdlii~--D~~----mP~~~~l~~~ir~~~~~~~~pii~   79 (133)
                      -...-..++..+|+..||+|.-.  .. .++-++.+.+ ..||+|.+  ...    +|++-++...+|+....+++||++
T Consensus       104 ~H~lG~~~va~~l~~~G~~V~~LG~~~p~e~~~~~~~~-~~~d~v~ls~S~~~~~~~~~~~~~i~~lr~~~~~~~v~v~v  182 (215)
T 3ezx_A          104 IHDIGHRLVTTMLGANGFQIVDLGVDVLNENVVEEAAK-HKGEKVLLVGSALMTTSMLGQKDLMDRLNEEKLRDSVKCMF  182 (215)
T ss_dssp             CCCHHHHHHHHHHHHTSCEEEECCSSCCHHHHHHHHHH-TTTSCEEEEEECSSHHHHTHHHHHHHHHHHTTCGGGSEEEE
T ss_pred             HHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHH-CCCCEEEEEEECCCCCCHHHHHHHHHHHHHCCCCCCCEEEE
T ss_conf             88899999999999779969988899999999999997-39981489985665433699999999999808889995998


Q ss_pred             EECCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             9638998999999976998899769
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLLKP  104 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~KP  104 (133)
                       -|..-.+  .-+-..||+.|-.-+
T Consensus       183 -GGa~~~~--~~a~~~GAD~~a~da  204 (215)
T 3ezx_A          183 -GGAPVSD--KWIEEIGADATAENA  204 (215)
T ss_dssp             -ESSSCCH--HHHHHHTCCBCCSSH
T ss_pred             -ECCCCCH--HHHHHHCCCEECCCH
T ss_conf             -8902799--999983988783899


No 102
>1y80_A Predicted cobalamin binding protein; corrinoid, factor IIIM, methyl transferase, structural genomics, PSI, protein structure initiative; HET: B1M; 1.70A {Moorella thermoacetica}
Probab=95.04  E-value=0.06  Score=30.68  Aligned_cols=90  Identities=14%  Similarity=0.073  Sum_probs=59.8

Q ss_pred             HHHHHHHHHHHHHCCCEEEEE--CCH-HHHHHHHHHCCCCCEEEECCCCCCC----CHHHHHHHHCCCCCCCEEEEEECC
Q ss_conf             899999999999889899999--997-9999999717999489970789987----738999961434889739999638
Q gi|254780892|r   11 HIVRKVGRHLFNDFGFMVFEA--TSV-CEAREFCEKELLPNYLVIDESMEGV----LEFIAHVRQMPLGTDVFVYYLLME   83 (133)
Q Consensus        11 ~~~r~~l~~~L~~~g~~v~~a--~~g-~eAl~~~~~~~~pdlii~D~~mP~~----~~l~~~ir~~~~~~~~pii~lT~~   83 (133)
                      ..-..++..+|+..||+|...  ..+ ++-++.+.+ ..||+|.+...|+..    -+++..+|+....+++||++ -|.
T Consensus       102 ~lG~~~va~~l~~~Gw~V~~LG~~vp~e~l~~~~~~-~~~~~v~lS~~~~~~~~~~~~~i~~l~~~~~~~~v~i~v-GG~  179 (210)
T 1y80_A          102 DIGKNLVAMMLESGGFTVYNLGVDIEPGKFVEAVKK-YQPDIVGMSALLTTTMMNMKSTIDALIAAGLRDRVKVIV-GGA  179 (210)
T ss_dssp             CHHHHHHHHHHHHTTCEEEECCSSBCHHHHHHHHHH-HCCSEEEEECCSGGGTHHHHHHHHHHHHTTCGGGCEEEE-EST
T ss_pred             HHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHH-CCCCEEEEEEECCCCHHHHHHHHHHHHHCCCCCCCEEEE-ECC
T ss_conf             899999999999889848856789999999999985-299999998435677999999999999848999996999-892


Q ss_pred             CCHHHHHHHHHCCCCEEEECC
Q ss_conf             998999999976998899769
Q gi|254780892|r   84 VDFEKMIAGARAGANSFLLKP  104 (133)
Q Consensus        84 ~~~~~~~~a~~~Ga~~yl~KP  104 (133)
                      .-.  ..-+-..||+.|-.-+
T Consensus       180 ~~~--~~~a~~~GaD~~a~da  198 (210)
T 1y80_A          180 PLS--QDFADEIGADGYAPDA  198 (210)
T ss_dssp             TCC--HHHHHHHTCSEECSSH
T ss_pred             CCC--HHHHHHHCCCEEECCH
T ss_conf             089--9999993998897899


No 103
>2ayx_A Sensor kinase protein RCSC; two independent structural domains, transferase; NMR {Escherichia coli} SCOP: c.23.1.1 c.23.1.6 PDB: 2ayz_A 2ayy_A
Probab=94.67  E-value=0.055  Score=30.92  Aligned_cols=50  Identities=12%  Similarity=0.064  Sum_probs=41.5

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC
Q ss_conf             7799973998999999999998898999999979999999717999489970789987
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV   59 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~   59 (133)
                      +|++++++|...+..+...|+.+|+.|..+.+.        ....+|+++.|..+|..
T Consensus        12 ~ri~l~~~n~~~~~~L~~~L~~~G~~v~~~~~~--------~~~~~d~~i~d~~~~~~   61 (254)
T 2ayx_A           12 KRCWLAVRNASLCQFLETSLQRSGIVVTTYEGQ--------EPTPEDVLITDEVVSKK   61 (254)
T ss_dssp             EEEEEECCCHHHHHHHHHHHTTTTEEEEECSSC--------CCCTTCEEEEESSCSCC
T ss_pred             CEEEEEECCHHHHHHHHHHHHHCCCEEEECCCC--------CCCCCCEEEECCCCCCC
T ss_conf             889999079899999999999779989834446--------77889779855876655


No 104
>1xrs_B D-lysine 5,6-aminomutase beta subunit; TIM barrel, rossmann domain, PLP, cobalamin, 5'- deoxyadenosine, radical, adenosylcobalamin; HET: B12 PLP 5AD; 2.80A {Clostridium sticklandii} SCOP: c.23.6.1 d.230.4.1
Probab=91.23  E-value=0.6  Score=24.73  Aligned_cols=110  Identities=5%  Similarity=-0.061  Sum_probs=69.6

Q ss_pred             CCCHHHHHHHHHHHHHCC---------CEEEEE---CCHHHHHHHHHHCCCCCEEEECCCCCCC-------CHHHHHHHH
Q ss_conf             399899999999999889---------899999---9979999999717999489970789987-------738999961
Q gi|254780892|r    8 DSSHIVRKVGRHLFNDFG---------FMVFEA---TSVCEAREFCEKELLPNYLVIDESMEGV-------LEFIAHVRQ   68 (133)
Q Consensus         8 DD~~~~r~~l~~~L~~~g---------~~v~~a---~~g~eAl~~~~~~~~pdlii~D~~mP~~-------~~l~~~ir~   68 (133)
                      |-...-.+.+...+...|         |+|.-.   .+.++.++.+.++ .||+|.+...|...       -+++..++.
T Consensus       131 D~H~~G~~~v~~~~~~aG~~~~e~~~~feVi~LG~~vp~ee~v~~a~e~-~aD~VgvS~llt~~~~h~~~~~~li~~l~e  209 (262)
T 1xrs_B          131 DAHTVGIDAIMNMKGYAGHYGLERYEMIDAYNLGSQVANEDFIKKAVEL-EADVLLVSQTVTQKNVHIQNMTHLIELLEA  209 (262)
T ss_dssp             CCCCHHHHHHHSTTCBTTBCCGGGCTTEEEEECCSSBCHHHHHHHHHHT-TCSEEEEECCCCTTSHHHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHHHHHHCCCCCCCCCCCEEEEECCCCCCHHHHHHHHHHC-CCCEEEEEEECCCCHHHHHHHHHHHHHHHH
T ss_conf             4447789999999987586430026844999688899999999999864-999999975215523378999999999996


Q ss_pred             CCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHHHH
Q ss_conf             43488973999963899899999997699889976989899999999999999
Q gi|254780892|r   69 MPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        69 ~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~~~  121 (133)
                      .....++|+++=-+..+.   .-+.+.|++.+...--...+....+...+..+
T Consensus       210 ~gl~~~v~vivGG~~~~~---~~a~~lGaDavfg~gt~~~dva~~l~~~l~~r  259 (262)
T 1xrs_B          210 EGLRDRFVLLCGGPRINN---EIAKELGYDAGFGPGRFADDVATFAVKTLNDR  259 (262)
T ss_dssp             TTCGGGSEEEEECTTCCH---HHHHTTTCSEEECTTCCHHHHHHHHHHHHHHH
T ss_pred             CCCCCCCEEEEECCCCCH---HHHHHCCCCEECCCCCCHHHHHHHHHHHHHHH
T ss_conf             699889589998998999---99997799887699988999999999999987


No 105
>2xij_A Methylmalonyl-COA mutase, mitochondrial; isomerase, organic aciduria, vitamin B12; HET: B12 5AD BTB; 1.95A {Homo sapiens} PDB: 2xiq_A* 3bic_A
Probab=89.06  E-value=1.1  Score=23.05  Aligned_cols=114  Identities=15%  Similarity=0.051  Sum_probs=70.5

Q ss_pred             EEEEE----CCCHHHHHHHHHHHHHCCCEEEE---ECCHHHHHHHHHHCCCCCEEEECCCCCCC----CHHHHHHHHCCC
Q ss_conf             79997----39989999999999988989999---99979999999717999489970789987----738999961434
Q gi|254780892|r    3 SLLLV----DSSHIVRKVGRHLFNDFGFMVFE---ATSVCEAREFCEKELLPNYLVIDESMEGV----LEFIAHVRQMPL   71 (133)
Q Consensus         3 ~ILiV----DD~~~~r~~l~~~L~~~g~~v~~---a~~g~eAl~~~~~~~~pdlii~D~~mP~~----~~l~~~ir~~~~   71 (133)
                      ||||+    |....-++.+...+...||+|..   ..+.+|+.+.+..+. +++|.+-..=-+-    .++++.+|+. .
T Consensus       606 rillakmG~dgH~~ga~~iA~~F~d~GfeV~~~~~f~TpeE~a~aA~e~~-a~vvgics~d~~h~~lvp~l~~~Lk~~-g  683 (762)
T 2xij_A          606 RLLVAKMGQDGHDRGAKVIATGFADLGFDVDIGPLFQTPREVAQQAVDAD-VHAVGVSTLAAGHKTLVPELIKELNSL-G  683 (762)
T ss_dssp             EEEEECCSSCCCCHHHHHHHHHHHHTTCEEEECCTTCCHHHHHHHHHHTT-CSEEEEEECSSCHHHHHHHHHHHHHHT-T
T ss_pred             EEEEECCCCCCCCCCHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHHHHHHC-C
T ss_conf             59996578774410199999999857902852787789999999999769-999999268765688999999999966-9


Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCC-HH---HHHHHHHHHHH
Q ss_conf             88973999963899899999997699889976989-89---99999999999
Q gi|254780892|r   72 GTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RE---TLRFAMRELPQ  119 (133)
Q Consensus        72 ~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~-~~---~L~~~i~~~~~  119 (133)
                      .+++||+ +-|.--+++.....++|+++|+.---. .+   .+...+++.+.
T Consensus       684 ~~~i~Vv-vgGviP~~d~~~l~~aGV~~if~pg~~i~~~~~~i~~~i~~~~~  734 (762)
T 2xij_A          684 RPDILVM-CGGVIPPQDYEFLFEVGVSNVFGPGTRIPKAAVQVLDDIEKCLE  734 (762)
T ss_dssp             CTTSEEE-EEESCCGGGHHHHHHHTCCEEECTTCCHHHHHHHHHHHHHHHHH
T ss_pred             CCCCEEE-EECCCCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHHHHHHHHH
T ss_conf             9986799-80778878899999869887839998299999999999999998


No 106
>1qdl_B Protein (anthranilate synthase (TRPG-SUBUNIT)); tryptophan biosynthesis, glutamine amidotransferase, allosteric interaction, lyase; 2.50A {Sulfolobus solfataricus} SCOP: c.23.16.1
Probab=87.17  E-value=0.46  Score=25.41  Aligned_cols=91  Identities=18%  Similarity=0.121  Sum_probs=48.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-C-----HHHHHHHHCCCCCC
Q ss_conf             97799973998999999999998898999999979999999717999489970789987-7-----38999961434889
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-L-----EFIAHVRQMPLGTD   74 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-~-----~l~~~ir~~~~~~~   74 (133)
                      |+.+||||-...+-..+.++|+..|+++....+.+..++.+..-. ||.|++-= =|+. .     .....+.. ....+
T Consensus         1 ~~~~liiD~~dsft~Nl~~~l~~lG~~~~v~~~d~~~~~~~~~~~-~~gvilsg-Gp~~p~~~~~~~~~~~i~~-~~~~~   77 (195)
T 1qdl_B            1 MDLTLIIDNYDSFVYNIAQIVGELGSYPIVIRNDEISIKGIERID-PDRLIISP-GPGTPEKREDIGVSLDVIK-YLGKR   77 (195)
T ss_dssp             CCEEEEEECSCSSHHHHHHHHHHTTCEEEEEETTTSCHHHHHHHC-CSEEEECC-CSSCTTSHHHHTTHHHHHH-HHTTT
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCCHHHHHHCC-CCEEEECC-CCCCCCCCCCCCCCHHHHH-HHCCC
T ss_conf             988999978871799999999868992799808989999998619-89799889-9997433433443089999-85589


Q ss_pred             CEEEEEECCCCHHHHHHHHHCCCC
Q ss_conf             739999638998999999976998
Q gi|254780892|r   75 VFVYYLLMEVDFEKMIAGARAGAN   98 (133)
Q Consensus        75 ~pii~lT~~~~~~~~~~a~~~Ga~   98 (133)
                      +|++-+-    .....-+...|+.
T Consensus        78 ~PiLGIC----lG~Qll~~~~G~~   97 (195)
T 1qdl_B           78 TPILGVC----LGHQAIGYAFGAK   97 (195)
T ss_dssp             SCEEEET----HHHHHHHHHTTCE
T ss_pred             CCEEEEC----HHHHHHHHHCCCE
T ss_conf             9889982----6079999865999


No 107
>3fkq_A NTRC-like two-domain protein; RER070207001320, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: ATP 2PE; 2.10A {Eubacterium rectale}
Probab=85.11  E-value=1.9  Score=21.70  Aligned_cols=103  Identities=14%  Similarity=0.076  Sum_probs=68.7

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHH-CC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCE
Q ss_conf             97-799973998999999999998-89--899999997999999971799948997078998773899996143488973
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFND-FG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVF   76 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~-~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~p   76 (133)
                      |+ ++.|.|.+....+.+..+|.. .+  +++..+++.+...+...+ ..||++++|-.++.-.        .......+
T Consensus        20 Mki~l~i~d~d~~y~~~L~~~l~~~~~~~~~~~~fs~~e~l~~~~~~-~~~dvlli~~~~~~~~--------~~~~~~~~   90 (373)
T 3fkq_A           20 MKIKVALLDKDKEYLDRLTGVFNTKYADKLEVYSFTDEKNAIESVKE-YRIDVLIAEEDFNIDK--------SEFKRNCG   90 (373)
T ss_dssp             CCEEEEEECSCHHHHHHHHHHHHHHTTTTEEEEEESCHHHHHHHHHH-HTCSEEEEETTCCCCG--------GGGCSSCE
T ss_pred             CEEEEEEEECCHHHHHHHHHHHHHHCCCCEEEEEECCHHHHHHHHHC-CCCCEEEECCCCCHHH--------HHHHHCCC
T ss_conf             74789999677999999999985532784499994789999999860-7998999888656545--------54320366


Q ss_pred             EEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             999963899899999997699889976989899999999999
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
                      +.+++.....+      ..+....+.|+-+.+.+...+.+..
T Consensus        91 ~~~l~~~~~~~------~~~~~~~i~Kyq~~~~i~~~i~~~~  126 (373)
T 3fkq_A           91 LAYFTGTPGIE------LIKDEIAICKYQRVDVIFKQILGVY  126 (373)
T ss_dssp             EEEEESCTTCC------EETTEEEEETTSCHHHHHHHHHHHH
T ss_pred             EEEECCCCCCC------CCCCCCCHHCCCCHHHHHHHHHHHH
T ss_conf             27861678854------3345442012666889999999999


No 108
>1xm3_A Thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI, NESG, northeast structural genomics consortium; 1.80A {Bacillus subtilis} SCOP: c.1.31.1 PDB: 1tyg_A
Probab=83.33  E-value=2.3  Score=21.24  Aligned_cols=101  Identities=15%  Similarity=0.052  Sum_probs=68.1

Q ss_pred             HHHHHHHCCCEEE--EECCHHHHHHHHHHCCCCCEEEECCCCCCC--C-----HHHHHHHHCCCCCCCEEEEEECCCCHH
Q ss_conf             9999998898999--999979999999717999489970789987--7-----389999614348897399996389989
Q gi|254780892|r   17 GRHLFNDFGFMVF--EATSVCEAREFCEKELLPNYLVIDESMEGV--L-----EFIAHVRQMPLGTDVFVYYLLMEVDFE   87 (133)
Q Consensus        17 l~~~L~~~g~~v~--~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~-----~l~~~ir~~~~~~~~pii~lT~~~~~~   87 (133)
                      ..+.|-..||.|.  +-.|..-|-+...- ..  ..++=|--|=|  .     ..++.++.   ..++|||+=-|-+.+.
T Consensus       118 Aae~Lv~eGF~VlpY~~~D~v~akrLed~-Gc--~avMPlgsPIGSg~Gl~n~~~l~~i~e---~~~vPvIVDAGIG~pS  191 (264)
T 1xm3_A          118 ASEQLLEEGFIVLPYTSDDVVLARKLEEL-GV--HAIMPGASPIGSGQGILNPLNLSFIIE---QAKVPVIVDAGIGSPK  191 (264)
T ss_dssp             HHHHHHHTTCCEEEEECSCHHHHHHHHHH-TC--SCBEECSSSTTCCCCCSCHHHHHHHHH---HCSSCBEEESCCCSHH
T ss_pred             HHHHHHHCCCEEEEEECCCHHHHHHHHHC-CC--EEEEEECCCCCCCCCCCCHHHHHHHHH---CCCCCEEEECCCCCHH
T ss_conf             99999978987999607898999999976-99--199851340136877679899999996---6898889847989888


Q ss_pred             HHHHHHHCCCCEEEE-----CCCCHHHHHHHHHHHHHHHHH
Q ss_conf             999999769988997-----698989999999999999999
Q gi|254780892|r   88 KMIAGARAGANSFLL-----KPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        88 ~~~~a~~~Ga~~yl~-----KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      +..+||+.|++..|.     +--++..+..+++...+--+.
T Consensus       192 dAa~AMElG~DaVLvNTAIA~A~dPv~MA~A~~~AV~AGR~  232 (264)
T 1xm3_A          192 DAAYAMELGADGVLLNTAVSGADDPVKMARAMKLAVEAGRL  232 (264)
T ss_dssp             HHHHHHHTTCSEEEESHHHHTSSSHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHCCCCEEEECHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             99999974588998554656289989999999999999999


No 109
>2w6r_A Imidazole glycerol phosphate synthase subunit HISF; lyase, fusion protein, amino-acid biosynthesis cobalamin, precorrin, novel fold; 2.10A {Thermotoga maritima}
Probab=81.74  E-value=2.7  Score=20.88  Aligned_cols=70  Identities=20%  Similarity=0.102  Sum_probs=50.7

Q ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEE-CCCC
Q ss_conf             79999999717999489970789987-----7389999614348897399996389989999999769988997-6989
Q gi|254780892|r   34 VCEAREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLL-KPFN  106 (133)
Q Consensus        34 g~eAl~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~-KP~~  106 (133)
                      ..+.+..+.....-.+++.|+.--|+     .++++.+   .....+|+++-.|-++.++..++++.|+++.+. +-|.
T Consensus       158 ~~~~~~~~~~~g~geil~t~V~~DGt~~G~d~~l~~~i---~~~~~~piI~sGGi~s~~di~~l~~~g~~gvi~gs~~~  233 (266)
T 2w6r_A          158 LRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFV---RPLTTLPIIASGGAGKMEHFLEAFLAGADAALAASVFH  233 (266)
T ss_dssp             HHHHHHHHHHTTCSEEEEEETTTTTTCSCCCHHHHHHH---GGGCCSCEEEESCCCSHHHHHHHHHHTCSEEEESTTTC
T ss_pred             CHHHHHHHHCCCCCEEEEEEECCCCCCCCCCHHHHHHH---HHCCCCCEEEEECCCCHHHHHHHHHCCCCEEEEEEHHH
T ss_conf             02335433155858589988878798688767999999---86189778999479999999999978997999800556


No 110
>2ift_A Putative methylase HI0767; NESG, Y767_haein, structural genomics, PSI-2, protein structure initiative; 2.30A {Haemophilus influenzae} SCOP: c.66.1.46
Probab=80.87  E-value=2.8  Score=20.76  Aligned_cols=25  Identities=12%  Similarity=-0.048  Sum_probs=11.5

Q ss_pred             ECCHHHHHHHHHHCCCCCEEEECCCC
Q ss_conf             99979999999717999489970789
Q gi|254780892|r   31 ATSVCEAREFCEKELLPNYLVIDESM   56 (133)
Q Consensus        31 a~~g~eAl~~~~~~~~pdlii~D~~m   56 (133)
                      |.||.=++|.+.++.. .++++|.+-
T Consensus        62 aGSG~lglEAlSRGA~-~v~fVE~~~   86 (201)
T 2ift_A           62 AGSGSLGFEALSRQAK-KVTFLELDK   86 (201)
T ss_dssp             CTTCHHHHHHHHTTCS-EEEEECSCH
T ss_pred             CCCCHHHHHHHHCCCC-EEEEEEECH
T ss_conf             8828989999988993-999997405


No 111
>1ka9_F Imidazole glycerol phosphtate synthase; riken structural genomics/proteomics initiative, RSGI, structural genomics, transferase; 2.30A {Thermus thermophilus} SCOP: c.1.2.1
Probab=80.64  E-value=2.9  Score=20.65  Aligned_cols=66  Identities=18%  Similarity=0.045  Sum_probs=47.7

Q ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             79999999717999489970789987-----7389999614348897399996389989999999769988997
Q gi|254780892|r   34 VCEAREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        34 g~eAl~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                      ..+.+..+.....=.++++|+.--|+     .++++.++   ...++|+++-.|-...++..++.+.|+++.+.
T Consensus       154 ~~~~~~~~~~~g~~eiiltdi~~dGt~~G~d~~l~~~i~---~~~~~pii~sGGv~~~~dl~~l~~~g~~gviv  224 (252)
T 1ka9_F          154 AVEWAVKGVELGAGEILLTSMDRDGTKEGYDLRLTRMVA---EAVGVPVIASGGAGRMEHFLEAFQAGAEAALA  224 (252)
T ss_dssp             HHHHHHHHHHHTCCEEEEEETTTTTTCSCCCHHHHHHHH---HHCSSCEEEESCCCSHHHHHHHHHTTCSEEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHH---HHCCCCEEEECCCCCHHHHHHHHHCCCCEEEE
T ss_conf             999999998747988999862345766674167999998---51698799977989999999999789979998


No 112
>2v5j_A 2,4-dihydroxyhept-2-ENE-1,7-dioic acid aldolase; lyase, class II aldolase, homoprotocatechuate, aromatic degradation; 1.60A {Escherichia coli} PDB: 2v5k_A
Probab=78.93  E-value=3.3  Score=20.32  Aligned_cols=100  Identities=12%  Similarity=0.031  Sum_probs=66.9

Q ss_pred             HHHHHHHHHHCC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEEEECCCCHHHH
Q ss_conf             999999999889--8999999979999999717999489970789987--738999961434889739999638998999
Q gi|254780892|r   14 RKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKM   89 (133)
Q Consensus        14 r~~l~~~L~~~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~lT~~~~~~~~   89 (133)
                      .+.+++.|+.-.  +-+....+.....+.+.... +|-|++|..--..  .++...++........|++= -...+....
T Consensus        27 ~N~~k~~L~~G~~~~G~~~~~~sp~~~Ei~~~~G-fDfv~ID~EHg~~~~~~~~~~i~aa~~~~~~~iVR-vp~~~~~~i  104 (287)
T 2v5j_A           27 ENSFKAALKAGRPQIGLWLGLSSSYSAELLAGAG-FDWLLIDGEHAPNNVQTVLTQLQAIAPYPSQPVVR-PSWNDPVQI  104 (287)
T ss_dssp             CCHHHHHHHTTCCEEEEEECSCCHHHHHHHHTSC-CSEEEEESSSSSCCHHHHHHHHHHHTTSSSEEEEE-CSSSCHHHH
T ss_pred             HHHHHHHHHCCCCEEEEEECCCCHHHHHHHHCCC-CCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCEEE-CCCCCHHHH
T ss_conf             2899999987998799875789969999997389-89999806789899999999999875359973554-678999999


Q ss_pred             HHHHHCCCCEEEECCCC-HHHHHHHHH
Q ss_conf             99997699889976989-899999999
Q gi|254780892|r   90 IAGARAGANSFLLKPFN-RETLRFAMR  115 (133)
Q Consensus        90 ~~a~~~Ga~~yl~KP~~-~~~L~~~i~  115 (133)
                      .++++.||.+.+.--++ .++....++
T Consensus       105 ~r~LD~Ga~GIivP~V~s~eea~~~v~  131 (287)
T 2v5j_A          105 KQLLDVGTQTLLVPMVQNADEAREAVR  131 (287)
T ss_dssp             HHHHHTTCCEEEESCCCSHHHHHHHHH
T ss_pred             HHHHHCCCCEEEECCCCCHHHHHHHHH
T ss_conf             999837998679467599999999998


No 113
>1thf_D HISF protein; thermophIle, TIM-barrel, histidine biosynthesis, lyase, phosphate-binding sites; 1.45A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2a0n_A* 1gpw_A 1vh7_A 2rkx_A 3iio_A 3iip_A* 3iiv_A
Probab=76.46  E-value=3.9  Score=19.89  Aligned_cols=66  Identities=20%  Similarity=0.075  Sum_probs=49.8

Q ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             79999999717999489970789987-----7389999614348897399996389989999999769988997
Q gi|254780892|r   34 VCEAREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        34 g~eAl~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                      ..+.++.+.....=.++++|+.--|+     .++++.+   ......|+++-.+-++.++..++.+.|+++.+.
T Consensus       153 ~~~~~~~~~~~g~~eiiltdI~~dGt~~G~d~~~l~~i---~~~~~~pii~~GGv~s~~dl~~l~~~g~~gviv  223 (253)
T 1thf_D          153 LRDWVVEVEKRGAGEILLTSIDRDGTKSGYDTEMIRFV---RPLTTLPIIASGGAGKMEHFLEAFLAGADAALA  223 (253)
T ss_dssp             HHHHHHHHHHTTCSEEEEEETTTTTSCSCCCHHHHHHH---GGGCCSCEEEESCCCSHHHHHHHHHTTCSEEEE
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHH---HHCCCCCEEEECCCCCHHHHHHHHHCCCCEEEE
T ss_conf             99999998863799799997524576577540133455---524798789846989999999999789989998


No 114
>2bas_A YKUI protein; EAL domain, structural genom protein structure initiative, midwest center for structural genomics, MCSG, signaling protein; 2.61A {Bacillus subtilis} SCOP: c.1.33.1 d.110.6.2 PDB: 2w27_A*
Probab=75.36  E-value=4.2  Score=19.71  Aligned_cols=107  Identities=12%  Similarity=0.074  Sum_probs=67.7

Q ss_pred             CHHHHHHHHHHHHHCCCEEE--EECCHHHHHHHHHHCCCCCEEEECCCCC-CC------CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             98999999999998898999--9999799999997179994899707899-87------738999961434889739999
Q gi|254780892|r   10 SHIVRKVGRHLFNDFGFMVF--EATSVCEAREFCEKELLPNYLVIDESME-GV------LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus        10 ~~~~r~~l~~~L~~~g~~v~--~a~~g~eAl~~~~~~~~pdlii~D~~mP-~~------~~l~~~ir~~~~~~~~pii~l   80 (133)
                      +..........++..|+.+.  .+.+|..-++.+.. ..||.|=+|-.+= +.      -.+++.+-......++.+| .
T Consensus       155 d~~~l~~~l~~lr~~G~~IALDDfG~g~s~l~~l~~-l~pD~IKlD~sli~~~~~~~~~~~il~~Lv~la~~~g~~vI-a  232 (431)
T 2bas_A          155 DIEQLYHMLAYYRTYGIKIAVDNIGKESSNLDRIAL-LSPDLLKIDLQALKVSQPSPSYEHVLYSISLLARKIGAALL-Y  232 (431)
T ss_dssp             CHHHHHHHHHHHHTTTCEEEEEEETTTBCCHHHHHH-HCCSEEEEECTTTC----CCHHHHHHHHHHHHHHHHTCEEE-E
T ss_pred             CHHHHHHHHHHHHCCCCEEEEECCCCCCCHHHHHHH-CCCCEEEECHHHHHHHCCCHHHHHHHHHHHHHHHHCCCEEE-E
T ss_conf             699999999886457858999899998413999985-89999999989985240496689999999999998699899-9


Q ss_pred             ECCCCHHHHHHHHHCCCCEE----EECC----CCHHHHHHHHHHHH
Q ss_conf             63899899999997699889----9769----89899999999999
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSF----LLKP----FNRETLRFAMRELP  118 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~y----l~KP----~~~~~L~~~i~~~~  118 (133)
                      ++-.+.+....+.+.|++-+    +.||    +.++.+..++....
T Consensus       233 EGVEt~~ql~~l~~lGvd~~QG~yf~~P~~~~~~~~~~~~~l~~~~  278 (431)
T 2bas_A          233 EDIEANFQLQYAWRNGGRYFQGYYLVSPSETFLERDVLKQRLKTEF  278 (431)
T ss_dssp             ECCCSHHHHHHHHHTTEEEECSTTTCCCBSSCCCTTTTHHHHHHHH
T ss_pred             EECCCHHHHHHHHHCCCCEEECCCCCCCCCCCCCHHHHHHHHHHHH
T ss_conf             8189599999999759989645841217985005258999999999


No 115
>3c2e_A Nicotinate-nucleotide pyrophosphorylase; qprtase, prtase, BNA6, mechanism, cytoplasm, glycosyltransferase, nucleus; 1.90A {Saccharomyces cerevisiae} PDB: 3c2f_A* 3c2o_A* 3c2v_A* 3c2r_A*
Probab=74.22  E-value=3.6  Score=20.13  Aligned_cols=73  Identities=12%  Similarity=0.027  Sum_probs=49.4

Q ss_pred             EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             99999979999999717999489970789987-7389999614348897399996389989999999769988997
Q gi|254780892|r   28 VFEATSVCEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        28 v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                      ..++.+-.||.+.+.. . +|.|.+|-.-|.. -+..+.+|.......-..+..||.-+.+......+.|++.+-+
T Consensus       203 eVEv~~~~ea~~a~~~-g-~d~i~LDn~~~~~~k~~v~~l~~~~~~~~~v~ieaSGGI~~~ni~~ya~tGvD~Is~  276 (294)
T 3c2e_A          203 EVECLSEDEATEAIEA-G-ADVIMLDNFKGDGLKMCAQSLKNKWNGKKHFLLECSGGLNLDNLEEYLCDDIDIYST  276 (294)
T ss_dssp             EEECSSSHHHHHHHHH-T-CSEEECCC---------------------CCEEEEECCCCC------CCCSCSEEEC
T ss_pred             EECCCCHHHHHHHHHC-C-CCEEEECCCCHHHHHHHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEE
T ss_conf             9625458889999975-9-996632689979999999999877544885799998999999999999849899993


No 116
>2r6o_A Putative diguanylate cyclase/phosphodiesterase (ggdef & EAL domains); ggdef and EAL domains, structural genomics, PSI-2; 1.80A {Thiobacillus denitrificans atcc 25259} PDB: 3ii8_A* 3n3t_A*
Probab=74.01  E-value=4.5  Score=19.51  Aligned_cols=105  Identities=11%  Similarity=0.054  Sum_probs=70.2

Q ss_pred             CCHHHHHHHHHHHHHCCCEEE--EECCHHHHHHHHHHCCCCCEEEECCC----CCCC---CHHHHHHHHCCCCCCCEEEE
Q ss_conf             998999999999998898999--99997999999971799948997078----9987---73899996143488973999
Q gi|254780892|r    9 SSHIVRKVGRHLFNDFGFMVF--EATSVCEAREFCEKELLPNYLVIDES----MEGV---LEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         9 D~~~~r~~l~~~L~~~g~~v~--~a~~g~eAl~~~~~~~~pdlii~D~~----mP~~---~~l~~~ir~~~~~~~~pii~   79 (133)
                      |...... ....|+..|+.+.  .+.+|...++.+.. ..||.|=+|-.    +...   ..+++.+-......+++|| 
T Consensus       161 ~~~~~~~-~i~~L~~~G~~ialDdfg~~~~~~~~l~~-l~~d~VKid~~~i~~~~~~~~~~~~l~~ii~~a~~~~~~vI-  237 (294)
T 2r6o_A          161 MTDEVRT-CLDALRARGVRLALDDFGTGYSSLSYLSQ-LPFHGLKIDQSFVRKIPAHPSETQIVTTILALARGLGMEVV-  237 (294)
T ss_dssp             CCHHHHH-HHHHHHHHTCEEEEEEETSSCBCHHHHHH-SCCCEEEECHHHHTTTTTSHHHHHHHHHHHHHHHHTTCEEE-
T ss_pred             CHHHHHH-HHHHHHHCCCEEEEECCCCCCHHHHHHHH-CCCCCCCCCHHHHHHCCCCHHHHHHHHHHHHHHHHCCCEEE-
T ss_conf             5899999-99999970987998479997123899864-36432056599996223575679999999999998699899-


Q ss_pred             EECCCCHHHHHHHHHCCCCEE----EECCCCHHHHHHHHHH
Q ss_conf             963899899999997699889----9769898999999999
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSF----LLKPFNRETLRFAMRE  116 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~y----l~KP~~~~~L~~~i~~  116 (133)
                      .++-.+.+....+.+.|++-+    +.||...+++..-+++
T Consensus       238 aeGVEt~~~l~~l~~lGid~~QG~~~~~P~~~~~~~~~l~~  278 (294)
T 2r6o_A          238 AEGIETAQQYAFLRDRGCEFGQGNLMSTPQAADAFASLLDR  278 (294)
T ss_dssp             ECCCCSHHHHHHHHHTTCCEECSTTTCCCEEHHHHHHHHHH
T ss_pred             EEECCCHHHHHHHHHCCCCEEECCCCCCCCCHHHHHHHHHH
T ss_conf             98488299999999869999986901346999999999985


No 117
>3l9w_A Glutathione-regulated potassium-efflux system Pro linker, ancillary protein KEFF; potassium channel regulation, domains, antiport; HET: FMN AMP GSH; 1.75A {Escherichia coli} PDB: 3eyw_A* 3l9x_A*
Probab=70.88  E-value=5.4  Score=19.07  Aligned_cols=92  Identities=14%  Similarity=0.131  Sum_probs=46.0

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEEC-CHHHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             799973998999999999998898999999-979999999717999489970789987-738999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEAT-SVCEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~-~g~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~l   80 (133)
                      .+.++|.|+...+.    ++..|+.|.... +-.+.|+.+.-+. .+++++-..=+.. ..++..+|+.  .++++|+.-
T Consensus        29 ~vvvID~d~~~v~~----l~~~g~~vi~GDat~~~~L~~Agi~~-A~~vIia~~d~~~n~~i~~~ar~~--~p~~~Iiar  101 (413)
T 3l9w_A           29 KMVVLDHDPDHIET----LRKFGMKVFYGDATRMDLLESAGAAK-AEVLINAIDDPQTNLQLTEMVKEH--FPHLQIIAR  101 (413)
T ss_dssp             CEEEEECCHHHHHH----HHHTTCCCEESCTTCHHHHHHTTTTT-CSEEEECCSSHHHHHHHHHHHHHH--CTTCEEEEE
T ss_pred             CEEEEECCHHHHHH----HHHCCCCEEEECCCCHHHHHHCCCCC-CCEEEEEECCHHHHHHHHHHHHHH--CCCCEEEEE
T ss_conf             88999899999999----99779909996389999998569775-999999719889999999999997--899839999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             63899899999997699889976
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLK  103 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~K  103 (133)
                      +.  +.++.....++||+..+.-
T Consensus       102 a~--~~~~~~~L~~~Gad~Vi~e  122 (413)
T 3l9w_A          102 AR--DVDHYIRLRQAGVEKPERE  122 (413)
T ss_dssp             ES--SHHHHHHHHHTTCSSCEET
T ss_pred             EC--CHHHHHHHHHCCCCEEECC
T ss_conf             77--9999999997798999884


No 118
>2fhp_A Methylase, putative; alpha-beta-alpha sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Enterococcus faecalis V583} SCOP: c.66.1.46
Probab=69.58  E-value=5.7  Score=18.90  Aligned_cols=68  Identities=10%  Similarity=0.059  Sum_probs=46.3

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCE---EEEECCHHHHHHHHHH-CCCCCEEEECC--CCCCCCHHHHHHHHC
Q ss_conf             77999739989999999999988989---9999997999999971-79994899707--899877389999614
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFM---VFEATSVCEAREFCEK-ELLPNYLVIDE--SMEGVLEFIAHVRQM   69 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~---v~~a~~g~eAl~~~~~-~~~pdlii~D~--~mP~~~~l~~~ir~~   69 (133)
                      +++..||-|+...+.+++-++..+..   -....+...+++.+.. ...+|+|++|-  ......+++..+...
T Consensus        68 ~~v~~Ve~~~~~~~~~~~N~~~~~~~~~~~i~~~d~~~~l~~~~~~~~~fDlIflDPPY~~~~~~~~l~~i~~~  141 (187)
T 2fhp_A           68 DKSICIEKNFAALKVIKENIAITKEPEKFEVRKMDANRALEQFYEEKLQFDLVLLDPPYAKQEIVSQLEKMLER  141 (187)
T ss_dssp             SEEEEEESCHHHHHHHHHHHHHHTCGGGEEEEESCHHHHHHHHHHTTCCEEEEEECCCGGGCCHHHHHHHHHHT
T ss_pred             CEEEEEEECHHHHHHHHHHHHHCCCCCCCEEEEEEHHHHHHHHHHCCCCCCEEEECCCCCCHHHHHHHHHHHHC
T ss_conf             83589994246776766555420245641788610788877643026765359978987531799999999987


No 119
>1req_A Methylmalonyl-COA mutase; isomerase, intramolecular transferase; HET: B12 DCA; 2.00A {Propionibacterium freudenreichiisubsp} SCOP: c.1.19.1 c.23.6.1 PDB: 2req_A* 3req_A* 4req_A* 6req_A* 7req_A* 5req_A* 1e1c_A*
Probab=68.93  E-value=5.9  Score=18.82  Aligned_cols=96  Identities=13%  Similarity=0.047  Sum_probs=65.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEEE---CCHHHHHHHHHHCCCCCEEEECCCCCCC----CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             399899999999999889899999---9979999999717999489970789987----738999961434889739999
Q gi|254780892|r    8 DSSHIVRKVGRHLFNDFGFMVFEA---TSVCEAREFCEKELLPNYLVIDESMEGV----LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         8 DD~~~~r~~l~~~L~~~g~~v~~a---~~g~eAl~~~~~~~~pdlii~D~~mP~~----~~l~~~ir~~~~~~~~pii~l   80 (133)
                      |-...-|......+...||+|..-   .+.+++.+.+..+. +|+|++-..-.+-    .++++.+|+. ..+++||+ +
T Consensus       607 ~~h~~~ra~fA~~f~~~Gf~V~~~~~f~tpee~a~aa~es~-a~vv~ics~d~~y~~~vp~l~~~Lk~a-g~~~i~Vi-l  683 (727)
T 1req_A          607 DGHDRGQKVIATAYADLGFDVDVGPLFQTPEETARQAVEAD-VHVVGVSSLAGGHLTLVPALRKELDKL-GRPDILIT-V  683 (727)
T ss_dssp             CCCCHHHHHHHHHHHHHTCEEEECCTTBCHHHHHHHHHHTT-CSEEEEEECSSCHHHHHHHHHHHHHHT-TCTTSEEE-E
T ss_pred             CHHHHHHHHHHHHHHHCCCEEECCCCCCCHHHHHHHHHHCC-CCEEEEECCCCCHHHHHHHHHHHHHHC-CCCCCEEE-E
T ss_conf             24343599999999858961754888899999999999769-999999178745588999999999967-99885799-8


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             63899899999997699889976989
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLLKPFN  106 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~KP~~  106 (133)
                      -|.--.++.....++|+.+++..--+
T Consensus       684 gG~iP~~d~~~L~~aGV~~if~pgtn  709 (727)
T 1req_A          684 GGVIPEQDFDELRKDGAVEIYTPGTV  709 (727)
T ss_dssp             EESCCGGGHHHHHHTTEEEEECTTCC
T ss_pred             ECCCCHHHHHHHHHCCCCEEECCCCC
T ss_conf             07788787999997798868489980


No 120
>1ep3_A Dihydroorotate dehydrogenase B (PYRD subunit); heterotetramer, alpha-beta barrel, beta sandwich, FAD domain, alpha/beta NADP domain; HET: FMN FAD; 2.10A {Lactococcus lactis} SCOP: c.1.4.1 PDB: 1ep2_A* 1ep1_A*
Probab=66.01  E-value=6.8  Score=18.46  Aligned_cols=57  Identities=19%  Similarity=0.188  Sum_probs=39.4

Q ss_pred             HHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEE------CCCCHHHHHHHHHHHHHHH
Q ss_conf             89999614348897399996389989999999769988997------6989899999999999999
Q gi|254780892|r   62 FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLL------KPFNRETLRFAMRELPQMQ  121 (133)
Q Consensus        62 l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~------KP~~~~~L~~~i~~~~~~~  121 (133)
                      .+.++++   ..++|||...+-.+.++..+++.+||+....      .|+-...+...+.+.+...
T Consensus       232 ~v~~i~~---~~~ipIIg~GGI~s~~D~~~~l~~GAd~V~ig~~~~~~P~~~~~i~~~L~~~m~~~  294 (311)
T 1ep3_A          232 LIHQVAQ---DVDIPIIGMGGVANAQDVLEMYMAGASAVAVGTANFADPFVCPKIIDKLPELMDQY  294 (311)
T ss_dssp             HHHHHHT---TCSSCEEECSSCCSHHHHHHHHHHTCSEEEECTHHHHCTTHHHHHHHHHHHHHHHT
T ss_pred             HHHHHHH---CCCCCEEEECCCCCHHHHHHHHHCCCCEEEECHHHHCCCHHHHHHHHHHHHHHHHC
T ss_conf             9999863---35677797689599999999998199999962888629879999999999999983


No 121
>1mxs_A KDPG aldolase; 2-keto-3-deoxy-6-phosphogluconate aldolase, sulfate, beta- barrel, lyase; 2.20A {Pseudomonas putida} SCOP: c.1.10.1
Probab=64.30  E-value=7.3  Score=18.26  Aligned_cols=95  Identities=14%  Similarity=0.081  Sum_probs=52.3

Q ss_pred             HHHHHHHHHHCC-CEEEEECCHHHHHHH---HHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEEEEECCCCHHHH
Q ss_conf             999999999889-899999997999999---9717999489970789987738999961434889739999638998999
Q gi|254780892|r   14 RKVGRHLFNDFG-FMVFEATSVCEAREF---CEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKM   89 (133)
Q Consensus        14 r~~l~~~L~~~g-~~v~~a~~g~eAl~~---~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii~lT~~~~~~~~   89 (133)
                      ...+..+++... .-|....+.++|++.   +..+.. .++=+-++-|+..+.++.+++.  ++++- |-.-+--+.+..
T Consensus        16 ~~~i~~i~~~~~iipvi~~~~~~~a~~~a~al~~~Gi-~~iEitl~tp~a~e~i~~l~~~--~p~~~-iGaGTV~~~~~~   91 (225)
T 1mxs_A           16 AARIDAICEKARILPVITIAREEDILPLADALAAGGI-RTLEVTLRSQHGLKAIQVLREQ--RPELC-VGAGTVLDRSMF   91 (225)
T ss_dssp             HHHHHHHHHHHSEEEEECCSCGGGHHHHHHHHHHTTC-CEEEEESSSTHHHHHHHHHHHH--CTTSE-EEEECCCSHHHH
T ss_pred             HHHHHHHHHHCCEEEEEECCCHHHHHHHHHHHHHCCC-CEEEEECCCCHHHHHHHHHHHH--CCCCE-EEEEECCCHHHH
T ss_conf             9999999986987899975999999999999998799-8899958994099999999974--99707-865303679999


Q ss_pred             HHHHHCCCCEEEECC-CCHHHHHHH
Q ss_conf             999976998899769-898999999
Q gi|254780892|r   90 IAGARAGANSFLLKP-FNRETLRFA  113 (133)
Q Consensus        90 ~~a~~~Ga~~yl~KP-~~~~~L~~~  113 (133)
                      .++.++|| +|+.-| ++++.+..+
T Consensus        92 ~~a~~aGa-~FivsP~~~~~v~~~a  115 (225)
T 1mxs_A           92 AAVEAAGA-QFVVTPGITEDILEAG  115 (225)
T ss_dssp             HHHHHHTC-SSEECSSCCHHHHHHH
T ss_pred             HHHHHCCC-CEEECCCCCHHHHHHH
T ss_conf             99997799-8998898959999999


No 122
>1h5y_A HISF; histidine biosynthesis, TIM-barrel; 2.0A {Pyrobaculum aerophilum} SCOP: c.1.2.1
Probab=63.35  E-value=7.6  Score=18.16  Aligned_cols=67  Identities=19%  Similarity=0.134  Sum_probs=48.6

Q ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             79999999717999489970789987-----73899996143488973999963899899999997699889976
Q gi|254780892|r   34 VCEAREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLK  103 (133)
Q Consensus        34 g~eAl~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~K  103 (133)
                      ..+.++.+.....=.++++|+.--|+     .++++.+++   ....|+++-.|-.+.++..++.+.|+++.+.-
T Consensus       156 ~~~~~~~~~~~g~~eii~tdI~~dGt~~G~d~~~l~~i~~---~~~~pii~~GGv~~~~dl~~l~~~g~~gvivg  227 (253)
T 1h5y_A          156 AVKWAKEVEELGAGEILLTSIDRDGTGLGYDVELIRRVAD---SVRIPVIASGGAGRVEHFYEAAAAGADAVLAA  227 (253)
T ss_dssp             HHHHHHHHHHHTCSEEEEEETTTTTTCSCCCHHHHHHHHH---HCSSCEEEESCCCSHHHHHHHHHTTCSEEEES
T ss_pred             HHHHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHH---HCCCCEEEECCCCCHHHHHHHHHCCCCEEEEH
T ss_conf             9999999985799989997451478768768899999998---56998899759999999999997899689885


No 123
>3igs_A N-acetylmannosamine-6-phosphate 2-epimerase 2; energy metabolism, sugars, csgid, carbohydrate metabolism, isomerase; HET: MSE 16G; 1.50A {Salmonella enterica subsp}
Probab=62.55  E-value=7.9  Score=18.07  Aligned_cols=100  Identities=9%  Similarity=-0.075  Sum_probs=62.3

Q ss_pred             HHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCC---CCC-----CHHHHHHHHCCCCCCCEEEEEECCC
Q ss_conf             9999999998898999-999979999999717999489970789---987-----7389999614348897399996389
Q gi|254780892|r   14 RKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESM---EGV-----LEFIAHVRQMPLGTDVFVYYLLMEV   84 (133)
Q Consensus        14 r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~m---P~~-----~~l~~~ir~~~~~~~~pii~lT~~~   84 (133)
                      ...+.......|..+. ++.+.+++...... .. |+|-....=   ++.     .++.+..    ...++|+|.-++-.
T Consensus       118 ~~~~~~~~~~~g~~v~~~v~t~~~a~~a~~~-Ga-d~Igv~~~~~~~~~~~~~~~~~l~~~~----~~~~ipvia~GGI~  191 (232)
T 3igs_A          118 VEALLARIHHHHLLTMADCSSVDDGLACQRL-GA-DIIGTTMSGYTTPDTPEEPDLPLVKAL----HDAGCRVIAEGRYN  191 (232)
T ss_dssp             HHHHHHHHHHTTCEEEEECCSHHHHHHHHHT-TC-SEEECTTTTSSSSSCCSSCCHHHHHHH----HHTTCCEEEESCCC
T ss_pred             HHHHHHHHHHCCCEEEEECCCHHHHHHHHHC-CC-CEEEEECCCCCCCCCCCHHHHHHHHHH----HCCCCEEEEECCCC
T ss_conf             9999999975498699986999999999968-99-889973577877876703678899997----33782399858989


Q ss_pred             CHHHHHHHHHCCCCEEEECC--CCHHHHHHHHHHHHH
Q ss_conf             98999999976998899769--898999999999999
Q gi|254780892|r   85 DFEKMIAGARAGANSFLLKP--FNRETLRFAMRELPQ  119 (133)
Q Consensus        85 ~~~~~~~a~~~Ga~~yl~KP--~~~~~L~~~i~~~~~  119 (133)
                      ..++..+++++||+.++.=-  .++++...++.+.++
T Consensus       192 t~~d~~~~~~~GAd~V~vGsAi~~~~~i~~~~~~ai~  228 (232)
T 3igs_A          192 SPALAAEAIRYGAWAVTVGSAITRLEHICGWYNDALK  228 (232)
T ss_dssp             SHHHHHHHHHTTCSEEEECHHHHCHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHCCCCEEEECHHHCCHHHHHHHHHHHHH
T ss_conf             9999999998699999989477590999999999999


No 124
>2v82_A 2-dehydro-3-deoxy-6-phosphogalactonate aldolase; lyase, kdpgal; HET: KDP; 2.1A {Escherichia coli} PDB: 2v81_A*
Probab=62.00  E-value=8.1  Score=18.01  Aligned_cols=28  Identities=21%  Similarity=0.173  Sum_probs=16.9

Q ss_pred             CCCEEEEEECCCCHHHHHHHHHCCCCEEE
Q ss_conf             89739999638998999999976998899
Q gi|254780892|r   73 TDVFVYYLLMEVDFEKMIAGARAGANSFL  101 (133)
Q Consensus        73 ~~~pii~lT~~~~~~~~~~a~~~Ga~~yl  101 (133)
                      +++|++- ||--+.++..+.+++|+..+-
T Consensus       147 ~~i~~ip-tGGI~~~N~~~yl~aGa~~v~  174 (212)
T 2v82_A          147 SDIAVFA-VGGVTPENLAQWIDAGCAGAG  174 (212)
T ss_dssp             TTCEEEE-ESSCCTTTHHHHHHHTCSEEE
T ss_pred             CCCEEEE-ECCCCHHHHHHHHHCCCEEEE
T ss_conf             7877974-279998999999985996999


No 125
>2htm_A Thiazole biosynthesis protein THIG; thiamin biosynthesis, THIG, thermus thermophilus HB8, structural genomics, NPPSFA; 2.30A {Thermus thermophilus}
Probab=60.70  E-value=8.5  Score=17.87  Aligned_cols=105  Identities=8%  Similarity=-0.127  Sum_probs=66.9

Q ss_pred             HHHHHHHCCCEEEE-ECCHHHHHHHHHHCCCCCEEEECCCCCC--CCHH----HHHHHHCCCCCCCEEEEEECCCCHHHH
Q ss_conf             99999988989999-9997999999971799948997078998--7738----999961434889739999638998999
Q gi|254780892|r   17 GRHLFNDFGFMVFE-ATSVCEAREFCEKELLPNYLVIDESMEG--VLEF----IAHVRQMPLGTDVFVYYLLMEVDFEKM   89 (133)
Q Consensus        17 l~~~L~~~g~~v~~-a~~g~eAl~~~~~~~~pdlii~D~~mP~--~~~l----~~~ir~~~~~~~~pii~lT~~~~~~~~   89 (133)
                      ..+.|...||.|.- ..+.....+.+..-..  ..++=|-=|=  +.|+    ..++........+|+|+=-+-+.+.+.
T Consensus       116 Aae~Lv~~GF~VlpY~~~D~~~ak~Le~~Gc--~aVMPl~sPIGsg~Gi~n~~~l~i~i~~~~~~vPvivDAGIG~pSdA  193 (268)
T 2htm_A          116 AAERLIEEDFLVLPYMGPDLVLAKRLAALGT--ATVMPLAAPIGSGWGVRTRALLELFAREKASLPPVVVDAGLGLPSHA  193 (268)
T ss_dssp             HHHHHHHTTCEECCEECSCHHHHHHHHHHTC--SCBEEBSSSTTTCCCSTTHHHHHHHHHTTTTSSCBEEESCCCSHHHH
T ss_pred             HHHHHHHCCCEEEEECCCCHHHHHHHHHCCC--CEEEECHHHHCCCCCCCCHHHHHHHHHHHCCCCCEEEECCCCCHHHH
T ss_conf             9999985896899956878999999987698--67873242431576403887888999874577876863588998999


Q ss_pred             HHHHHCCCCEEEE-----CCCCHHHHHHHHHHHHHHHHH
Q ss_conf             9999769988997-----698989999999999999999
Q gi|254780892|r   90 IAGARAGANSFLL-----KPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        90 ~~a~~~Ga~~yl~-----KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      .+||+.|++..|+     |--++..+..+++...+--+.
T Consensus       194 a~aMElG~DaVLvNTAIa~a~dP~~MA~A~~~AV~aGr~  232 (268)
T 2htm_A          194 AEVMELGLDAVLVNTAIAEAQDPPAMAEAFRLAVEAGRK  232 (268)
T ss_dssp             HHHHHTTCCEEEESHHHHTSSSHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHCCCCEEEECHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999974798999763766379989999999999999999


No 126
>1x42_A Hypothetical protein PH0459; haloacid dehalogenase, structural genomics, NPPSFA; 2.00A {Pyrococcus horikoshii OT3} SCOP: c.108.1.1
Probab=59.15  E-value=9.1  Score=17.71  Aligned_cols=56  Identities=14%  Similarity=0.192  Sum_probs=28.0

Q ss_pred             CCCCCHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEE---E--------ECCCCHHHHHHHHHHH
Q ss_conf             998773899996143488973999963899899999997699889---9--------7698989999999999
Q gi|254780892|r   56 MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF---L--------LKPFNRETLRFAMREL  117 (133)
Q Consensus        56 mP~~~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~y---l--------~KP~~~~~L~~~i~~~  117 (133)
                      .||..++++.++     ...++.++|+.+........-..|..+|   +        .|| +++.+..++++.
T Consensus       102 ~pg~~~~L~~l~-----~~~~l~v~Tn~~~~~~~~~l~~~gl~~~fd~i~~s~~~~~~KP-~~~~~~~~~~~l  168 (232)
T 1x42_A          102 YPEVVEVLKSLK-----GKYHVGMITDSDTEYLMAHLDALGIKDLFDSITTSEEAGFFKP-HPRIFELALKKA  168 (232)
T ss_dssp             CTTHHHHHHHHB-----TTBEEEEEESSCHHHHHHHHHHHTCGGGCSEEEEHHHHTBCTT-SHHHHHHHHHHH
T ss_pred             CCCHHHHHHHHH-----HCCEEEEECCCCCCHHHHHHHHCCCCCCCCCCCCHHHCCCCCC-CHHHHHHHHHHC
T ss_conf             803999999974-----0782898527864101455540598441366676755488898-599999999991


No 127
>3c3p_A Methyltransferase; NP_951602.1, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; 1.90A {Geobacter sulfurreducens pca}
Probab=58.15  E-value=3.7  Score=20.04  Aligned_cols=62  Identities=11%  Similarity=0.180  Sum_probs=42.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCE--EE-EECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHH
Q ss_conf             7999739989999999999988989--99-99997999999971799948997078998773899996
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFM--VF-EATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVR   67 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~--v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir   67 (133)
                      +|.-+|-++...+..++.+...|+.  +. ...++.+   .......+|+|++|-..++..++...+.
T Consensus        83 ~v~~id~~~~~~~~ar~~~~~~g~~~~i~~~~gda~~---~~~~~~~fDlifiD~~~~~~~~~~~~~~  147 (210)
T 3c3p_A           83 RVVMIDPDRDNVEHARRMLHDNGLIDRVELQVGDPLG---IAAGQRDIDILFMDCDVFNGADVLERMN  147 (210)
T ss_dssp             EEEEEESCHHHHHHHHHHHHHHSGGGGEEEEESCHHH---HHTTCCSEEEEEEETTTSCHHHHHHHHG
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCCEEEEEECCHHH---CCCCCCCCCEEEECCCHHHHHHHHHHHH
T ss_conf             9999977510378999879872987326786134543---0223688678998575666799999986


No 128
>3dr5_A Putative O-methyltransferase; Q8NRD3, CGL1119, PF01596, CGR117, NESG, structural genomics, PSI-2, protein structure initiative; 2.25A {Corynebacterium glutamicum}
Probab=58.00  E-value=9.5  Score=17.59  Aligned_cols=63  Identities=11%  Similarity=0.079  Sum_probs=44.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCE---EE-EECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHH
Q ss_conf             7999739989999999999988989---99-9999799999997179994899707899877389999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFM---VF-EATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHV   66 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~---v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~i   66 (133)
                      +|.-||-++...+..+..+...|+.   +. ...++.+.+..+.. ..+|+|++|-.-++-.+.....
T Consensus        83 ~l~tIE~~~e~~~~Ar~~~~~ag~~~~rv~~i~gda~e~L~~l~~-~~fDlVfiD~~k~~y~~~~~~~  149 (221)
T 3dr5_A           83 TLTCIDPESEHQRQAKALFREAGYSPSRVRFLLSRPLDVMSRLAN-DSYQLVFGQVSPMDLKALVDAA  149 (221)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHTTCCGGGEEEECSCHHHHGGGSCT-TCEEEEEECCCTTTHHHHHHHH
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCCCEEEEECCCHHHHHHHHCC-CCCCEEEECCCHHHHHHHHHHH
T ss_conf             899998999999999999996688762467732778998787434-7877799758867718999998


No 129
>2g5c_A Prephenate dehydrogenase; TYRA, oxidoreductase; HET: NAD; 1.90A {Aquifex aeolicus VF5} SCOP: a.100.1.12 c.2.1.6
Probab=56.92  E-value=9.9  Score=17.48  Aligned_cols=67  Identities=12%  Similarity=0.184  Sum_probs=42.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCC--EEEEECCHHHHHHHHHHCCC---------------CCEEEECCCCCCCCHHH
Q ss_conf             97799973998999999999998898--99999997999999971799---------------94899707899877389
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGF--MVFEATSVCEAREFCEKELL---------------PNYLVIDESMEGVLEFI   63 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~--~v~~a~~g~eAl~~~~~~~~---------------pdlii~D~~mP~~~~l~   63 (133)
                      ||+|+|| .-=.+...+...|...|+  +|.......+.++.+.+...               +|+|++=..+....+++
T Consensus         1 Mk~I~Ii-G~G~mG~sla~~L~~~g~~~~V~~~d~~~~~~~~a~~~g~id~~~~~~~~~~~~~~dlvila~p~~~~~~~~   79 (281)
T 2g5c_A            1 MQNVLIV-GVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVEDFSPDFVMLSSPVRTFREIA   79 (281)
T ss_dssp             CCEEEEE-SCSHHHHHHHHHHHHTTCCSEEEEECSCHHHHHHHHHTTSCSEEESCGGGGGGTCCSEEEECSCHHHHHHHH
T ss_pred             CCEEEEE-CCCHHHHHHHHHHHHCCCCCEEEEEECCHHHHHHHHHCCCCCEECCCHHHHCCCCCCEEEECCCCHHHHHHH
T ss_conf             9789999-239899999999981699848999989999999999869976104635553145788899836804432156


Q ss_pred             HHHHH
Q ss_conf             99961
Q gi|254780892|r   64 AHVRQ   68 (133)
Q Consensus        64 ~~ir~   68 (133)
                      .++..
T Consensus        80 ~~l~~   84 (281)
T 2g5c_A           80 KKLSY   84 (281)
T ss_dssp             HHHHH
T ss_pred             HHHHH
T ss_conf             55531


No 130
>2a9v_A GMP synthase; NP_394403.1, , structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI; 2.24A {Thermoplasma acidophilum} SCOP: c.23.16.1
Probab=56.67  E-value=2  Score=21.62  Aligned_cols=76  Identities=12%  Similarity=0.070  Sum_probs=42.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCC---CCCHHHHHHHHCCCCCCCEE
Q ss_conf             977999739989999999999988989999999799999997179994899707899---87738999961434889739
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME---GVLEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP---~~~~l~~~ir~~~~~~~~pi   77 (133)
                      |.+|+|||--..+-..+.+.|+..|.++....+....-+ + . . +|.|++-=--+   ...+....+...-.....|+
T Consensus        13 m~~i~iiD~g~~~~~~i~r~L~~lG~~~~vv~~~~~~~~-l-~-~-~dgiIl~GG~~~~~~~~~~~~~l~~~~~~~~~Pi   88 (212)
T 2a9v_A           13 MLKIYVVDNGGQWTHREWRVLRELGVDTKIVPNDIDSSE-L-D-G-LDGLVLSGGAPNIDEELDKLGSVGKYIDDHNYPI   88 (212)
T ss_dssp             CCBEEEEEESCCTTCHHHHHHHHTTCBCCEEETTSCGGG-G-T-T-CSEEEEEEECSCGGGTGGGHHHHHHHHHHCCSCE
T ss_pred             CCEEEEEECCCCHHHHHHHHHHHCCCEEEEEECCCCHHH-H-H-C-CCEEEECCCCCCCCCCHHHHHHHHHHHHHCCCCE
T ss_conf             667999999876899999999978983899969799999-8-3-6-9919997999843434378999999998579989


Q ss_pred             EEE
Q ss_conf             999
Q gi|254780892|r   78 YYL   80 (133)
Q Consensus        78 i~l   80 (133)
                      +-+
T Consensus        89 LGI   91 (212)
T 2a9v_A           89 LGI   91 (212)
T ss_dssp             EEE
T ss_pred             EEE
T ss_conf             987


No 131
>1dxe_A 2-dehydro-3-deoxy-galactarate aldolase; class II aldolase; 1.8A {Escherichia coli} SCOP: c.1.12.5 PDB: 1dxf_A
Probab=56.21  E-value=10  Score=17.41  Aligned_cols=97  Identities=14%  Similarity=0.046  Sum_probs=64.1

Q ss_pred             HHHHHHHCC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHH
Q ss_conf             999999889--8999999979999999717999489970789987--738999961434889739999638998999999
Q gi|254780892|r   17 GRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAG   92 (133)
Q Consensus        17 l~~~L~~~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a   92 (133)
                      +++.|..-.  +-+..........+.+.... +|-|++|..--..  .++...++........|++ =....+.....++
T Consensus        10 lk~~l~~g~~~~G~~~~~~sp~~~ei~a~~G-~Dfv~iD~EHg~~~~~~~~~~i~a~~~~g~~~~V-Rvp~~~~~~i~~~   87 (256)
T 1dxe_A           10 FKAALAAKQVQIGCWSALSNPISTEVLGLAG-FDWLVLDGEHAPNDISTFIPQLMALKGSASAPVV-RVPTNEPVIIKRL   87 (256)
T ss_dssp             HHHHHHTTCCEEEEEECSCSHHHHHHHTTSC-CSEEEEESSSSSCCHHHHHHHHHHTTTCSSEEEE-ECSSSCHHHHHHH
T ss_pred             HHHHHHCCCCEEEEEECCCCHHHHHHHHHCC-CCEEEEECCCCCCCHHHHHHHHHHHHCCCCCCEE-ECCCCCHHHHHHH
T ss_conf             9999987996699875789979999998179-9989982687988677799999999717998388-5688999999998


Q ss_pred             HHCCCCEEEECCCC-HHHHHHHHH
Q ss_conf             97699889976989-899999999
Q gi|254780892|r   93 ARAGANSFLLKPFN-RETLRFAMR  115 (133)
Q Consensus        93 ~~~Ga~~yl~KP~~-~~~L~~~i~  115 (133)
                      ++.||.+.+.--++ .++....++
T Consensus        88 LD~Ga~GiivP~V~s~eea~~~v~  111 (256)
T 1dxe_A           88 LDIGFYNFLIPFVETKEEAELAVA  111 (256)
T ss_dssp             HHTTCCEEEESCCCSHHHHHHHHH
T ss_pred             HCCCCCEEEECCCCCHHHHHHHHH
T ss_conf             718989777278699999999997


No 132
>2gpy_A O-methyltransferase; structural genomics, PSI, protein structure initiative, NEW YORK SGX research center for structural genomics; HET: MSE; 1.90A {Bacillus halodurans c-125}
Probab=55.30  E-value=11  Score=17.32  Aligned_cols=66  Identities=12%  Similarity=0.100  Sum_probs=49.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCE--E-EEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHH
Q ss_conf             7999739989999999999988989--9-9999979999999717999489970789987738999961
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFM--V-FEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQ   68 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~--v-~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~   68 (133)
                      +|.-+|-++......+..+...|+.  | ....++.+.+..+.....+|+|++|...++..+....+..
T Consensus        80 ~v~tiD~~~~~~~~A~~~~~~~gl~~~I~~~~gda~d~l~~l~~~~~fD~ifiD~~k~~~~~~~~~~~~  148 (233)
T 2gpy_A           80 TIVSIERDERRYEEAHKHVKALGLESRIELLFGDALQLGEKLELYPLFDVLFIDAAKGQYRRFFDMYSP  148 (233)
T ss_dssp             EEEEECCCHHHHHHHHHHHHHTTCTTTEEEECSCGGGSHHHHTTSCCEEEEEEEGGGSCHHHHHHHHGG
T ss_pred             EEEEEEECHHHHHHHHHHHHHHHHCCCCEEEECCHHHHHHHHCCCCCCCEEEECCCHHHHHHHHHHHHH
T ss_conf             799997048999999999999742121126533287777751135776289972766768999999983


No 133
>1a53_A IGPS, indole-3-glycerolphosphate synthase; thermostable, TIM-barrel; HET: IGP; 2.00A {Sulfolobus solfataricus} SCOP: c.1.2.4 PDB: 1lbf_A* 1lbl_A* 1igs_A 1juk_A 1jul_A* 3hoj_A 2c3z_A 3b5v_A
Probab=53.96  E-value=11  Score=17.19  Aligned_cols=90  Identities=12%  Similarity=0.089  Sum_probs=60.3

Q ss_pred             HHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEEC-CCCCCC---CHHHHHHHHCCCCCCCEEEEEECCCC
Q ss_conf             8999999999998898999-999979999999717999489970-789987---73899996143488973999963899
Q gi|254780892|r   11 HIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVID-ESMEGV---LEFIAHVRQMPLGTDVFVYYLLMEVD   85 (133)
Q Consensus        11 ~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D-~~mP~~---~~l~~~ir~~~~~~~~pii~lT~~~~   85 (133)
                      ......+.......|.++. +++|.+|.-..+..+  +++|-+. .++-..   .+...++... ...++.+|.-||-..
T Consensus       138 ~~~l~~l~~~a~~lGle~LvEvh~~~El~~a~~~~--a~iIGINnRnL~t~~vd~~~~~~l~~~-ip~~~~~IaESGI~t  214 (247)
T 1a53_A          138 ERELESLLEYARSYGMEPLIEINDENDLDIALRIG--ARFIGINSRDLETLEINKENQRKLISM-IPSNVVKVAESGISE  214 (247)
T ss_dssp             HHHHHHHHHHHHTTTCCCEEEECSHHHHHHHHHTT--CSEEEEESBCTTTCCBCHHHHHHHHHH-SCTTSEEEEESCCCC
T ss_pred             HHHHHHHHHHHHHHCCEEEEEECCHHHHHHHHHCC--CCEEEEECCCHHHCCCCHHHHHHHHHH-CCCCCEEEEECCCCC
T ss_conf             88899999999984987577737999999998189--984987141143204476789999963-888987999647999


Q ss_pred             HHHHHHHHHCCCCEEEEC
Q ss_conf             899999997699889976
Q gi|254780892|r   86 FEKMIAGARAGANSFLLK  103 (133)
Q Consensus        86 ~~~~~~a~~~Ga~~yl~K  103 (133)
                      .++..+..+.|+++||.-
T Consensus       215 ~ed~~~l~~~G~davLIG  232 (247)
T 1a53_A          215 RNEIEELRKLGVNAFLIG  232 (247)
T ss_dssp             HHHHHHHHHTTCCEEEEC
T ss_pred             HHHHHHHHHCCCCEEEEC
T ss_conf             999999997799999989


No 134
>1o4u_A Type II quinolic acid phosphoribosyltransferase; TM1645, structural genomics, JCSG, PSI, protein structure initiative; 2.50A {Thermotoga maritima} SCOP: c.1.17.1 d.41.2.1
Probab=52.71  E-value=12  Score=17.07  Aligned_cols=68  Identities=9%  Similarity=0.070  Sum_probs=40.7

Q ss_pred             EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEE
Q ss_conf             99999979999999717999489970789987-73899996143488973999963899899999997699889
Q gi|254780892|r   28 VFEATSVCEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF  100 (133)
Q Consensus        28 v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~y  100 (133)
                      ..++.+-.||.+.+.. . +|.|.+|-.-|.. -+..+.+|..  .+.+ .+..||.-+.+...+....|++-+
T Consensus       197 ~vEv~~l~ea~~a~~~-g-~d~I~LDn~~~~~i~~~v~~l~~~--~~~v-~ieaSGGI~~~ni~~ya~~GVD~I  265 (285)
T 1o4u_A          197 EVEVENLEDALRAVEA-G-ADIVMLDNLSPEEVKDISRRIKDI--NPNV-IVEVSGGITEENVSLYDFETVDVI  265 (285)
T ss_dssp             EEEESSHHHHHHHHHT-T-CSEEEEESCCHHHHHHHHHHHHHH--CTTS-EEEEEECCCTTTGGGGCCTTCCEE
T ss_pred             EEEECHHHHHHHHHHC-C-CCEEECCCCCHHHHHHHHHHHHHH--CCCE-EEEEECCCCHHHHHHHHHCCCCEE
T ss_conf             9973329999999976-9-999942899878899999999975--8977-999989997999999986598999


No 135
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis}
Probab=52.17  E-value=12  Score=17.02  Aligned_cols=32  Identities=19%  Similarity=0.257  Sum_probs=28.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             97799973998999999999998898999999
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEAT   32 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~   32 (133)
                      ||+|||.=.+=.+...+.+.|...|++|....
T Consensus         1 MK~ILItGg~GfIG~~l~~~L~~~g~~V~~~d   32 (330)
T 2c20_A            1 MNSILICGGAGYIGSHAVKKLVDEGLSVVVVD   32 (330)
T ss_dssp             -CEEEEETTTSHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             99899887898899999999997839899997


No 136
>1geq_A Tryptophan synthase alpha-subunit; hyperthermophIle, X-RAY analysis, stability, calorimetry lyase; 2.00A {Pyrococcus furiosus} SCOP: c.1.2.4 PDB: 1wdw_A* 2dzu_A 2dzp_A 2e09_A 2dzw_A 2dzs_A 2dzv_A 2dzt_A 2dzx_A
Probab=52.06  E-value=12  Score=17.01  Aligned_cols=101  Identities=14%  Similarity=0.058  Sum_probs=66.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEE--EC-CHHHHHHHHHHCCCCCEEEECCCCC--CC-----CHHHHHHHHCCCC
Q ss_conf             7999739989999999999988989999--99-9799999997179994899707899--87-----7389999614348
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFE--AT-SVCEAREFCEKELLPNYLVIDESME--GV-----LEFIAHVRQMPLG   72 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~--a~-~g~eAl~~~~~~~~pdlii~D~~mP--~~-----~~l~~~ir~~~~~   72 (133)
                      -++++|....-.+.+...+...|.....  +. +..+-++.+.+... .-|-+--.+.  |.     .++...++...+.
T Consensus       111 g~iipDlp~ee~~~~~~~~~~~gl~~i~lvsptt~~~ri~~i~~~s~-gfiY~vs~~GvTG~~~~~~~~~~~~i~~iK~~  189 (248)
T 1geq_A          111 GILVVDLPVFHAKEFTEIAREEGIKTVFLAAPNTPDERLKVIDDMTT-GFVYLVSLYGTTGAREEIPKTAYDLLRRAKRI  189 (248)
T ss_dssp             EEEETTCCGGGHHHHHHHHHHHTCEEEEEECTTCCHHHHHHHHHHCS-SEEEEECCC-------CCCHHHHHHHHHHHHH
T ss_pred             EEEECCCCHHHHHHHHHHHHCCCCCEEEEECCCCHHHHHHHHHHCCC-CEEEEECCCCCCCCCCCCCHHHHHHHHHHHCC
T ss_conf             78605788667666765652169515898578881999987763489-71798414555787754320257788875104


Q ss_pred             CCCEEEEEECCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             89739999638998999999976998899769
Q gi|254780892|r   73 TDVFVYYLLMEVDFEKMIAGARAGANSFLLKP  104 (133)
Q Consensus        73 ~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP  104 (133)
                      .+.|+++=-|-.+.++..+.++.||++.+.--
T Consensus       190 t~~Pv~vGFGI~t~e~v~~~~~~~ADGVIVGS  221 (248)
T 1geq_A          190 CRNKVAVGFGVSKREHVVSLLKEGANGVVVGS  221 (248)
T ss_dssp             CSSCEEEESCCCSHHHHHHHHHTTCSEEEECH
T ss_pred             CCCCEEEEECCCCHHHHHHHHHCCCCEEEECH
T ss_conf             67863798246999999999874899999888


No 137
>1i1q_B Anthranilate synthase component II; tryptophan biosynthesis, lyase; HET: TRP; 1.90A {Salmonella typhimurium} SCOP: c.23.16.1 PDB: 1i7q_B 1i7s_B*
Probab=51.87  E-value=12  Score=16.99  Aligned_cols=89  Identities=8%  Similarity=-0.004  Sum_probs=49.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECC---HHHHHHHHHHCCCCCEEEECC--CCCCCC-HHHHHHHHCCCCCCCE
Q ss_conf             7999739989999999999988989999999---799999997179994899707--899877-3899996143488973
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATS---VCEAREFCEKELLPNYLVIDE--SMEGVL-EFIAHVRQMPLGTDVF   76 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~---g~eAl~~~~~~~~pdlii~D~--~mP~~~-~l~~~ir~~~~~~~~p   76 (133)
                      +||+||--..+-..+.++|+..|++|....+   ....++.+.. ..||.|++-=  .-|... ......+..  ...+|
T Consensus         2 ~iliiD~~dSFt~Niv~~l~~~g~~v~V~~~~~~~~~~~~~~~~-~~~dgiILsgGPg~p~~~~~~~~~~~~~--~~~iP   78 (192)
T 1i1q_B            2 DILLLDNIDSFTWNLADQLRTNGHNVVIYRNHIPAQTLIDRLAT-MKNPVLMLSPGPGVPSEAGCMPELLTRL--RGKLP   78 (192)
T ss_dssp             EEEEEECSCSSHHHHHHHHHHTTCEEEEEETTSCSHHHHHHHTT-CSSEEEEECCCSSCGGGSTTHHHHHHHH--BTTBC
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHH-CCCCEEEEECCCCCCCCCCCCHHHHHHH--HCCCC
T ss_conf             39999788827999999999789907999899877367999983-4969699819998714331337999998--56998


Q ss_pred             EEEEECCCCHHHHHHHHHCCCC
Q ss_conf             9999638998999999976998
Q gi|254780892|r   77 VYYLLMEVDFEKMIAGARAGAN   98 (133)
Q Consensus        77 ii~lT~~~~~~~~~~a~~~Ga~   98 (133)
                      ++-+-    .....-|...|+.
T Consensus        79 iLGIC----~G~Q~la~~~Gg~   96 (192)
T 1i1q_B           79 IIGIC----LGHQAIVEAYGGY   96 (192)
T ss_dssp             EEEET----HHHHHHHHHTSCC
T ss_pred             HHHHC----HHHHHHHHHCCCE
T ss_conf             14538----7679999874988


No 138
>1y0e_A Putative N-acetylmannosamine-6-phosphate 2- epimerase; mannac-6-P epimerase, NANE, structural genomics, protein structure initiative; 1.95A {Staphylococcus aureus subsp} SCOP: c.1.2.5
Probab=51.82  E-value=12  Score=16.98  Aligned_cols=74  Identities=11%  Similarity=-0.003  Sum_probs=48.0

Q ss_pred             EEEECCHHHHHHHHHHCCCCCEEEECCCCC-C-----CC--HHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCE
Q ss_conf             999999799999997179994899707899-8-----77--389999614348897399996389989999999769988
Q gi|254780892|r   28 VFEATSVCEAREFCEKELLPNYLVIDESME-G-----VL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANS   99 (133)
Q Consensus        28 v~~a~~g~eAl~~~~~~~~pdlii~D~~mP-~-----~~--~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~   99 (133)
                      +....+.+++...... . .|.|..-..-. +     ..  .....++......++|++.-.+-.+.++..+++++||+.
T Consensus       123 ~~~~~t~~~a~~~~~~-g-~d~i~~~~~~~~~~~~~~~~~~~~~~~v~~~~~~~~iPvia~GGI~t~ed~~~al~~GAdg  200 (223)
T 1y0e_A          123 MADIATVEEAKNAARL-G-FDYIGTTLHGYTSYTQGQLLYQNDFQFLKDVLQSVDAKVIAEGNVITPDMYKRVMDLGVHC  200 (223)
T ss_dssp             EEECSSHHHHHHHHHT-T-CSEEECTTTTSSTTSTTCCTTHHHHHHHHHHHHHCCSEEEEESSCCSHHHHHHHHHTTCSE
T ss_pred             ECCCCCHHHHHHHHHC-C-CCEEEECCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCEEEECCCCCHHHHHHHHHCCCCE
T ss_conf             5487999999999975-9-9969976778853356887655479999999842899789868989999999999869999


Q ss_pred             EEEC
Q ss_conf             9976
Q gi|254780892|r  100 FLLK  103 (133)
Q Consensus       100 yl~K  103 (133)
                      .+.=
T Consensus       201 V~vG  204 (223)
T 1y0e_A          201 SVVG  204 (223)
T ss_dssp             EEEC
T ss_pred             EEEC
T ss_conf             9984


No 139
>1n8p_A Cystathionine gamma-lyase; three open alpha/beta structures; HET: PLP; 2.60A {Saccharomyces cerevisiae} SCOP: c.67.1.3
Probab=51.49  E-value=12  Score=16.95  Aligned_cols=88  Identities=11%  Similarity=0.032  Sum_probs=48.5

Q ss_pred             HHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECC------CCCCCCHHHHHHHHCCCCCCCEEEEEECCCC
Q ss_conf             9999999999988989999999799999997179994899707------8998773899996143488973999963899
Q gi|254780892|r   12 IVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE------SMEGVLEFIAHVRQMPLGTDVFVYYLLMEVD   85 (133)
Q Consensus        12 ~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~------~mP~~~~l~~~ir~~~~~~~~pii~lT~~~~   85 (133)
                      -.+..+...+..+|.++..+....++++...+... .+|++--      .+||.-.+.+..++.....++++|+=.. -.
T Consensus       105 ~t~~~~~~~l~~~gi~~~~~d~~~~~~~~~i~~~t-klv~~EspsNP~l~v~Di~~ia~~a~~~~a~~~i~lvVDNT-~a  182 (393)
T 1n8p_A          105 GTHRYFTKVANAHGVETSFTNDLLNDLPQLIKENT-KLVWIETPTNPTLKVTDIQKVADLIKKHAAGQDVILVVDNT-FL  182 (393)
T ss_dssp             HHHHHHHHTSTTTCSCCEEESSHHHHHHHHSCSSE-EEEEECSSCTTTCCCCCHHHHHHHHHHHTTTTTCEEEEECT-TT
T ss_pred             CCHHHHHHHHCCCCEEEEEEECCHHHHHHHHCCCC-CEEEECCCCCCCCCCCCHHHHHHHHHHCCCCCCCEEEEECC-CC
T ss_conf             50344444430273599998414679999747687-28982478997664232566666543022357836999565-45


Q ss_pred             HHHHHHHHHCCCCEEE
Q ss_conf             8999999976998899
Q gi|254780892|r   86 FEKMIAGARAGANSFL  101 (133)
Q Consensus        86 ~~~~~~a~~~Ga~~yl  101 (133)
                      .....+.++.||+=.+
T Consensus       183 tP~~~~Pl~~GADiVv  198 (393)
T 1n8p_A          183 SPYISNPLNFGADIVV  198 (393)
T ss_dssp             HHHHCCGGGGTCSEEE
T ss_pred             CCCCCCCHHCCCCEEE
T ss_conf             6035783121898899


No 140
>3ggo_A Prephenate dehydrogenase; TYRA, HPP, NADH, alpha-beta, oxidoreductase; HET: NAI ENO; 2.15A {Aquifex aeolicus} PDB: 3ggg_D* 3ggp_A*
Probab=51.38  E-value=12  Score=16.94  Aligned_cols=68  Identities=12%  Similarity=0.170  Sum_probs=48.1

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCC--EEEEECCHHHHHHHHHHCC---------------CCCEEEECCCCCCCCHHH
Q ss_conf             97799973998999999999998898--9999999799999997179---------------994899707899877389
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGF--MVFEATSVCEAREFCEKEL---------------LPNYLVIDESMEGVLEFI   63 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~--~v~~a~~g~eAl~~~~~~~---------------~pdlii~D~~mP~~~~l~   63 (133)
                      ||+|+|| .-=.+...+...|...|+  +|.......+.++.+.+..               .+|+|++-.-.....+++
T Consensus        33 Mk~I~II-GlG~mG~siA~~L~~~g~~~~V~g~D~~~~~~~~a~~~g~id~~~~~~~~~~~~~~dlIilavP~~~~~~vl  111 (314)
T 3ggo_A           33 MQNVLIV-GVGFMGGSFAKSLRRSGFKGKIYGYDINPESISKAVDLGIIDEGTTSIAKVEDFSPDFVMLSSPVRTFREIA  111 (314)
T ss_dssp             CSEEEEE-SCSHHHHHHHHHHHHTTCCSEEEEECSCHHHHHHHHHTTSCSEEESCTTGGGGGCCSEEEECSCGGGHHHHH
T ss_pred             CCEEEEE-EECHHHHHHHHHHHCCCCCCEEEEEECCHHHHHHHHHCCCCCCCCCCHHHHHCCCCCEEEECCCHHHHHHHH
T ss_conf             8779998-208899999999980699988999979999999999869975114898887256888899835504321045


Q ss_pred             HHHHHC
Q ss_conf             999614
Q gi|254780892|r   64 AHVRQM   69 (133)
Q Consensus        64 ~~ir~~   69 (133)
                      ..+...
T Consensus       112 ~~l~~~  117 (314)
T 3ggo_A          112 KKLSYI  117 (314)
T ss_dssp             HHHHHH
T ss_pred             HHHHHH
T ss_conf             543111


No 141
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae}
Probab=50.84  E-value=12  Score=16.89  Aligned_cols=85  Identities=12%  Similarity=0.087  Sum_probs=53.7

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEEC--------CHHHHHHHHHHCCCC--CEEEECCCCCCCCHHHHHHHHCCCCCCCEEEE
Q ss_conf             98999999999998898999999--------979999999717999--48997078998773899996143488973999
Q gi|254780892|r   10 SHIVRKVGRHLFNDFGFMVFEAT--------SVCEAREFCEKELLP--NYLVIDESMEGVLEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus        10 ~~~~r~~l~~~L~~~g~~v~~a~--------~g~eAl~~~~~~~~p--dlii~D~~mP~~~~l~~~ir~~~~~~~~pii~   79 (133)
                      +...+..+...++....-++.-.        ....|...+.+....  ...+.  ..+++.++...+......+.+|-||
T Consensus         2 s~e~~~~v~~~i~~~~Vvvfskgt~~~P~Cp~c~~ak~lL~~~gi~~~~~~~~--~~~~~~~~~~~l~~~tg~~TvPqIF   79 (121)
T 3gx8_A            2 STEIRKAIEDAIESAPVVLFMKGTPEFPKCGFSRATIGLLGNQGVDPAKFAAY--NVLEDPELREGIKEFSEWPTIPQLY   79 (121)
T ss_dssp             CHHHHHHHHHHHHSCSEEEEESBCSSSBCTTHHHHHHHHHHHHTBCGGGEEEE--ECTTCHHHHHHHHHHHTCCSSCEEE
T ss_pred             CHHHHHHHHHHHHHCCEEEEECCCCCCCCCHHHHHHHHHHHHCCCCCEEEEEE--CCCCCHHHHHHHHHCCCCCCCCEEE
T ss_conf             87999999999840988999788899998877999999998739986268875--5778999999876302356688388


Q ss_pred             EECC--CCHHHHHHHHHCC
Q ss_conf             9638--9989999999769
Q gi|254780892|r   80 LLME--VDFEKMIAGARAG   96 (133)
Q Consensus        80 lT~~--~~~~~~~~a~~~G   96 (133)
                      +-+.  ++.+...+..+.|
T Consensus        80 I~G~~IGG~d~l~~l~~~G   98 (121)
T 3gx8_A           80 VNKEFIGGCDVITSMARSG   98 (121)
T ss_dssp             ETTEEEESHHHHHHHHHHT
T ss_pred             ECCEEECCHHHHHHHHHCC
T ss_conf             9998987889999999869


No 142
>3gjy_A Spermidine synthase; APC62791, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.47A {Corynebacterium glutamicum atcc 13032}
Probab=50.27  E-value=13  Score=16.84  Aligned_cols=84  Identities=12%  Similarity=0.110  Sum_probs=53.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHH---CCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-------CHHHHHHHHCCC
Q ss_conf             7799973998999999999998---898999999979999999717999489970789987-------738999961434
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFND---FGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-------LEFIAHVRQMPL   71 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~---~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-------~~l~~~ir~~~~   71 (133)
                      .++.+||=|+.+....++.+.-   ...++ ...++.+.+...... .+|+|++|.--+..       .|+.+.++..-.
T Consensus       114 ~~v~~VEidp~vi~~ar~~f~~~~~~rv~v-~~~Da~~~l~~~~~~-~~D~Iv~D~f~~~~~p~~l~t~ef~~~~~~~L~  191 (317)
T 3gjy_A          114 SRNTVVELDAELARLSREWFDIPRAPRVKI-RVDDARMVAESFTPA-SRDVIIRDVFAGAITPQNFTTVEFFEHCHRGLA  191 (317)
T ss_dssp             CEEEEEESCHHHHHHHHHHSCCCCTTTEEE-EESCHHHHHHTCCTT-CEEEEEECCSTTSCCCGGGSBHHHHHHHHHHEE
T ss_pred             CEEEEEECCHHHHHHHHHHCCCCCCCCEEE-EECCHHHHHHHCCCC-CCCEEEEECCCCCCCCCCCCCHHHHHHHHHHCC
T ss_conf             869999798899999998679988997689-978499999750557-887799957887667632167999999997418


Q ss_pred             CCCCEEEEEECCCCHH
Q ss_conf             8897399996389989
Q gi|254780892|r   72 GTDVFVYYLLMEVDFE   87 (133)
Q Consensus        72 ~~~~pii~lT~~~~~~   87 (133)
                      ...+-++=+.+..+..
T Consensus       192 pgG~lvvN~~~~~~~~  207 (317)
T 3gjy_A          192 PGGLYVANCGDHSDLR  207 (317)
T ss_dssp             EEEEEEEEEEECTTCH
T ss_pred             CCCEEEEECCCCCCHH
T ss_conf             9838999877888738


No 143
>2pv7_A T-protein [includes: chorismate mutase (EC 5.4.99.5) (CM) and prephenate dehydrogenase...; 1574749, chorismate mutase type II; HET: MSE TYR NAD; 2.00A {Haemophilus influenzae} SCOP: a.100.1.12 c.2.1.6
Probab=49.74  E-value=13  Score=16.79  Aligned_cols=65  Identities=11%  Similarity=0.086  Sum_probs=40.9

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHH-HHHHHCCCCCEEEECCCCCCCCHHHHHHH
Q ss_conf             97799973998999999999998898999999979999-99971799948997078998773899996
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAR-EFCEKELLPNYLVIDESMEGVLEFIAHVR   67 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl-~~~~~~~~pdlii~D~~mP~~~~l~~~ir   67 (133)
                      |+||.||=.-=.+...+.+.|...||+|.......... +.+.. . .|+|++-.-.....+++.++.
T Consensus        21 ~~ki~iIGG~G~mG~sla~~l~~~G~~V~~~d~~~~~~~~~~~~-~-aD~VilavP~~~~~~~l~~~~   86 (298)
T 2pv7_A           21 IHKIVIVGGYGKLGGLFARYLRASGYPISILDREDWAVAESILA-N-ADVVIVSVPINLTLETIERLK   86 (298)
T ss_dssp             CCCEEEETTTSHHHHHHHHHHHTTTCCEEEECTTCGGGHHHHHT-T-CSEEEECSCGGGHHHHHHHHG
T ss_pred             CCEEEEEECCCHHHHHHHHHHHHCCCEEEEECCCCHHHHHHHHC-C-CCEEEEECCHHHHHHHHHHHH
T ss_conf             88389992698678999999996899599974980432899875-9-999999096999978789875


No 144
>1yxy_A Putative N-acetylmannosamine-6-phosphate 2- epimerase; structural genomics, PSI, protein structure initiative; 1.60A {Streptococcus pyogenes} SCOP: c.1.2.5
Probab=49.63  E-value=13  Score=16.78  Aligned_cols=87  Identities=8%  Similarity=-0.077  Sum_probs=52.9

Q ss_pred             HHHHHHHHHHC-CCEE-EEECCHHHHHHHHHHCCCCCEEEECCCCCC------CCHHHHHHHHCCCCCCCEEEEEECCCC
Q ss_conf             99999999988-9899-999997999999971799948997078998------773899996143488973999963899
Q gi|254780892|r   14 RKVGRHLFNDF-GFMV-FEATSVCEAREFCEKELLPNYLVIDESMEG------VLEFIAHVRQMPLGTDVFVYYLLMEVD   85 (133)
Q Consensus        14 r~~l~~~L~~~-g~~v-~~a~~g~eAl~~~~~~~~pdlii~D~~mP~------~~~l~~~ir~~~~~~~~pii~lT~~~~   85 (133)
                      ...++..-..+ +..+ ..+.+..++...... . .|.|.+...=-+      ........+ ......+|+|.-.+-.+
T Consensus       121 ~~~~~~~~~~~~~~~v~~~v~t~~~~~~~~~~-g-~d~i~~~~~~~~~~~~~~~~~~~~~~~-~~~~~~ipvia~GGI~~  197 (234)
T 1yxy_A          121 ASFIRQVKEKYPNQLLMADISTFDEGLVAHQA-G-IDFVGTTLSGYTPYSRQEAGPDVALIE-ALCKAGIAVIAEGKIHS  197 (234)
T ss_dssp             HHHHHHHHHHCTTCEEEEECSSHHHHHHHHHT-T-CSEEECTTTTSSTTSCCSSSCCHHHHH-HHHHTTCCEEEESCCCS
T ss_pred             HHHHHHHHHCCCCCEEEECCCCHHHHHHHHHC-C-CCEEEECCCCCCCCCCCCCHHHHHHHH-HHHCCCCCEEEECCCCC
T ss_conf             99999997427996687337999999999974-9-998984164465777677416799999-87147981898799999


Q ss_pred             HHHHHHHHHCCCCEEEEC
Q ss_conf             899999997699889976
Q gi|254780892|r   86 FEKMIAGARAGANSFLLK  103 (133)
Q Consensus        86 ~~~~~~a~~~Ga~~yl~K  103 (133)
                      .++..+++++||+.++.=
T Consensus       198 ~~d~~~al~~GAdgV~vG  215 (234)
T 1yxy_A          198 PEEAKKINDLGVAGIVVG  215 (234)
T ss_dssp             HHHHHHHHTTCCSEEEEC
T ss_pred             HHHHHHHHHCCCCEEEEC
T ss_conf             999999998699999989


No 145
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reductase family; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp}
Probab=49.34  E-value=13  Score=16.75  Aligned_cols=80  Identities=10%  Similarity=-0.096  Sum_probs=50.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCC--CCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEE
Q ss_conf             977999739989999999999988989999999799999997179--99489970789987-738999961434889739
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKEL--LPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~--~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pi   77 (133)
                      |.+|||.=-+.=+-..+...|-..|++|..+....+.++...+..  ....+.+|+.=++. ..+...+.+.  ...+-+
T Consensus         3 mg~VlITGassGIG~aia~~la~~G~~V~~~~r~~~~l~~~~~~~~~~~~~~~~Dv~~~~~~~~~~~~~~~~--~g~idi   80 (235)
T 3l6e_A            3 LGHIIVTGAGSGLGRALTIGLVERGHQVSMMGRRYQRLQQQELLLGNAVIGIVADLAHHEDVDVAFAAAVEW--GGLPEL   80 (235)
T ss_dssp             CCEEEEESTTSHHHHHHHHHHHHTTCEEEEEESCHHHHHHHHHHHGGGEEEEECCTTSHHHHHHHHHHHHHH--HCSCSE
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHCCCCEEEEECCCCCHHHHHHHHHHHHHH--CCCCEE
T ss_conf             898999887459999999999987998999989899999999973996699985789999999999999997--799569


Q ss_pred             EEEEC
Q ss_conf             99963
Q gi|254780892|r   78 YYLLM   82 (133)
Q Consensus        78 i~lT~   82 (133)
                      ++-.+
T Consensus        81 linnA   85 (235)
T 3l6e_A           81 VLHCA   85 (235)
T ss_dssp             EEEEC
T ss_pred             EEECC
T ss_conf             99788


No 146
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9
Probab=49.14  E-value=13  Score=16.73  Aligned_cols=92  Identities=8%  Similarity=-0.063  Sum_probs=49.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECC-HHHHHHHHHHCCCCCEEEECCCCCC-C--CHHHHHHHHCCCCCCCEEE
Q ss_conf             7999739989999999999988989999999-7999999971799948997078998-7--7389999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATS-VCEAREFCEKELLPNYLVIDESMEG-V--LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~-g~eAl~~~~~~~~pdlii~D~~mP~-~--~~l~~~ir~~~~~~~~pii   78 (133)
                      .+.+||.++.........+...|+.+....- -.+.|+.+.-+. .+.|++-.  |+ .  ...+..+|..  .+.++++
T Consensus        28 ~v~vId~~~e~~~~~~~~~~~~~~~vi~GD~~~~~~L~~a~i~~-a~~vi~~t--~~d~~n~~~~l~~r~~--~~~~~ii  102 (153)
T 1id1_A           28 NVTVISNLPEDDIKQLEQRLGDNADVIPGDSNDSSVLKKAGIDR-CRAILALS--DNDADNAFVVLSAKDM--SSDVKTV  102 (153)
T ss_dssp             CEEEEECCCHHHHHHHHHHHCTTCEEEESCTTSHHHHHHHTTTT-CSEEEECS--SCHHHHHHHHHHHHHH--TSSSCEE
T ss_pred             CEEEEECCHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHCCCCC-CCEEEECC--CCHHHHHHHHHHHHHH--CCCCEEE
T ss_conf             88999788677899999854389879991679999997579883-38999986--9879999999999997--8998399


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEE
Q ss_conf             99638998999999976998899
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFL  101 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl  101 (133)
                      ..+.  +.+.......+|++..+
T Consensus       103 a~~~--~~~~~~~l~~~G~d~vi  123 (153)
T 1id1_A          103 LAVS--DSKNLNKIKMVHPDIIL  123 (153)
T ss_dssp             EECS--SGGGHHHHHTTCCSEEE
T ss_pred             EEEC--CHHHHHHHHHCCCCEEE
T ss_conf             9988--98999999977989999


No 147
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomerase; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2
Probab=48.61  E-value=13  Score=16.68  Aligned_cols=32  Identities=13%  Similarity=0.069  Sum_probs=28.0

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             97799973998999999999998898999999
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEAT   32 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~   32 (133)
                      |+||||.=-.=.+...+...|-..|++|....
T Consensus         1 M~KILVTGgtGfIG~~lv~~Ll~~g~~V~~~d   32 (347)
T 1orr_A            1 MAKLLITGGCGFLGSNLASFALSQGIDLIVFD   32 (347)
T ss_dssp             -CEEEEETTTSHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             98899928874899999999997839899997


No 148
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2
Probab=48.60  E-value=13  Score=16.68  Aligned_cols=32  Identities=13%  Similarity=0.130  Sum_probs=24.4

Q ss_pred             CCEE-EEECCCHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             9779-9973998999999999998898999999
Q gi|254780892|r    1 MDSL-LLVDSSHIVRKVGRHLFNDFGFMVFEAT   32 (133)
Q Consensus         1 m~~I-LiVDD~~~~r~~l~~~L~~~g~~v~~a~   32 (133)
                      |+++ ||-=-.=.+...+...|-+.||+|..+.
T Consensus        23 Mkk~~LITGatGfIGs~l~~~Ll~~g~~V~~~~   55 (375)
T 1t2a_A           23 MRNVALITGITGQDGSYLAEFLLEKGYEVHGIV   55 (375)
T ss_dssp             -CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             987699960862899999999997849899997


No 149
>3kts_A Glycerol uptake operon antiterminator regulatory protein; structural genomics, PSI-2, protein structure initiative; HET: UNL; 2.75A {Listeria monocytogenes str}
Probab=48.27  E-value=14  Score=16.65  Aligned_cols=81  Identities=12%  Similarity=0.075  Sum_probs=49.4

Q ss_pred             HHHHHHHHHCCCEEE----EECC--HHHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEEECCCCHH
Q ss_conf             999999998898999----9999--79999999717999489970789987-7389999614348897399996389989
Q gi|254780892|r   15 KVGRHLFNDFGFMVF----EATS--VCEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYLLMEVDFE   87 (133)
Q Consensus        15 ~~l~~~L~~~g~~v~----~a~~--g~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~lT~~~~~~   87 (133)
                      ..+-+.....|.-+.    ...|  -+.+++.+++ ..||+|=+   |||. ...++.+++.   .++|+|.=-=-.+.+
T Consensus        91 ~~~I~~Ak~~Gl~tIqR~FliDS~al~~~~~~i~~-~~PD~VEi---LPG~~p~~I~~i~~~---~~~PiIAGGLI~~ke  163 (192)
T 3kts_A           91 GNAIMKAKQHKMLAIQRLFMIDSSAYNKGVALIQK-VQPDCIEL---LPGIIPEQVQKMTQK---LHIPVIAGGLIETSE  163 (192)
T ss_dssp             HHHHHHHHHTTCEEEEEEECCSHHHHHHHHHHHHH-HCCSEEEE---ECTTCHHHHHHHHHH---HCCCEEEESSCCSHH
T ss_pred             HHHHHHHHHCCCEEEEEEEEEEHHHHHHHHHHHHH-CCCCEEEE---CCHHHHHHHHHHHHH---CCCCEEEECCCCCHH
T ss_conf             99999999779907976634427689999999854-79899998---866789999999974---699999766728899


Q ss_pred             HHHHHHHCCCCEEEE
Q ss_conf             999999769988997
Q gi|254780892|r   88 KMIAGARAGANSFLL  102 (133)
Q Consensus        88 ~~~~a~~~Ga~~yl~  102 (133)
                      +..+|+++||...=+
T Consensus       164 dV~~aL~aGA~aVST  178 (192)
T 3kts_A          164 QVNQVIASGAIAVTT  178 (192)
T ss_dssp             HHHHHHTTTEEEEEE
T ss_pred             HHHHHHHCCCEEEEC
T ss_conf             999999859979987


No 150
>1jvn_A Glutamine, bifunctional histidine biosynthesis protein hishf; substrate channeling, amidotransferase, TIM-barrel AS A substrate tunnel; HET: 143; 2.10A {Saccharomyces cerevisiae} SCOP: c.1.2.1 c.23.16.1 PDB: 1ox4_B* 1ox5_A* 1ox6_A 1ox4_A
Probab=47.69  E-value=14  Score=16.59  Aligned_cols=76  Identities=20%  Similarity=0.131  Sum_probs=48.6

Q ss_pred             HHHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHH-CCCCEEEEC------
Q ss_conf             999999717999489970789987-----73899996143488973999963899899999997-699889976------
Q gi|254780892|r   36 EAREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGAR-AGANSFLLK------  103 (133)
Q Consensus        36 eAl~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~-~Ga~~yl~K------  103 (133)
                      +.+..+++...-.+++.|+.--|+     +++++.++.   ...+|||.-.|-+..++..+++. .|+++.+.-      
T Consensus       456 ~~~~~~~~~GaGEIlltsId~DGt~~G~Dl~l~~~i~~---~~~iPvIasGG~g~~~di~~~~~~~~~~av~~~s~fh~~  532 (555)
T 1jvn_A          456 ELTRACEALGAGEILLNCIDKDGSNSGYDLELIEHVKD---AVKIPVIASSGAGVPEHFEEAFLKTRADACLGAGMFHRG  532 (555)
T ss_dssp             HHHHHHHHTTCCEEEECCGGGTTTCSCCCHHHHHHHHH---HCSSCEEECSCCCSHHHHHHHHHHSCCSEEEESHHHHTT
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHH---HCCCCEEEECCCCCHHHHHHHHHHCCCEEEEEEHHHHCC
T ss_conf             99999996699899996254778888769999999997---589899997898999999999986897499880066779


Q ss_pred             CCCHHHHHHHH
Q ss_conf             98989999999
Q gi|254780892|r  104 PFNRETLRFAM  114 (133)
Q Consensus       104 P~~~~~L~~~i  114 (133)
                      -++..++...+
T Consensus       533 ~~~i~~~K~~L  543 (555)
T 1jvn_A          533 EFTVNDVKEYL  543 (555)
T ss_dssp             SCCHHHHHHHH
T ss_pred             CCCHHHHHHHH
T ss_conf             98999999999


No 151
>2is8_A Molybdopterin biosynthesis enzyme, MOAB; globular alpha/beta fold, structural genomics, NPPSFA; 1.64A {Thermus thermophilus HB8}
Probab=46.12  E-value=15  Score=16.45  Aligned_cols=47  Identities=6%  Similarity=-0.050  Sum_probs=31.2

Q ss_pred             CHHHHHHHHHHHHHCCCEEE---EECCHHH----HHHHHHHCCCCCEEEECCCC
Q ss_conf             98999999999998898999---9999799----99999717999489970789
Q gi|254780892|r   10 SHIVRKVGRHLFNDFGFMVF---EATSVCE----AREFCEKELLPNYLVIDESM   56 (133)
Q Consensus        10 ~~~~r~~l~~~L~~~g~~v~---~a~~g~e----Al~~~~~~~~pdlii~D~~m   56 (133)
                      ...+...+.+.|+.+||+|.   .+.|..+    ++..+.+...+|+||+-=-.
T Consensus        19 ~D~ng~~l~~~L~~~G~~v~~~~iv~Dd~~~i~~~l~~~~~~~~~DlVittGG~   72 (164)
T 2is8_A           19 QDTTHLAIREVLAGGPFEVAAYELVPDEPPMIKKVLRLWADREGLDLILTNGGT   72 (164)
T ss_dssp             CCCHHHHHHHHHTTSSEEEEEEEEECSCHHHHHHHHHHHHHTSCCSEEEEESCC
T ss_pred             ECCCHHHHHHHHHHCCCEEEEEEEECCCHHHHHHHHHHHHHCCCCCEEEECCCC
T ss_conf             365099999999968998989999798889999999999845498689967861


No 152
>1rj9_A FTSY, signal recognition protein; SRP-GTPase domain, heterodimer, nucleotide twinning, protein-protein complex, protein transport; HET: GCP; 1.90A {Thermus aquaticus} SCOP: a.24.13.1 c.37.1.10 PDB: 2q9c_A* 2q9b_A* 2q9a_A* 1okk_D* 2iyl_D* 2cnw_D* 2j7p_D*
Probab=45.86  E-value=15  Score=16.42  Aligned_cols=93  Identities=6%  Similarity=0.073  Sum_probs=56.4

Q ss_pred             HHHHHHHHHHHCCCEEEEECCHHHHH-------HHHHHCCCCCEEEECC--CCCCCCHHHHHHHH--------CCCCCCC
Q ss_conf             99999999998898999999979999-------9997179994899707--89987738999961--------4348897
Q gi|254780892|r   13 VRKVGRHLFNDFGFMVFEATSVCEAR-------EFCEKELLPNYLVIDE--SMEGVLEFIAHVRQ--------MPLGTDV   75 (133)
Q Consensus        13 ~r~~l~~~L~~~g~~v~~a~~g~eAl-------~~~~~~~~pdlii~D~--~mP~~~~l~~~ir~--------~~~~~~~   75 (133)
                      -.+.++.+.+..|..++.+.++.+..       .......+ |+|++|-  .+|.-.++..+++.        .+..+.-
T Consensus       145 a~eQL~~~a~~~~v~~~~~~~~~d~~~~~~~~~~~~~~~~~-d~iliDTaGr~~~~~~l~~el~~~~~~~~~~~~~~p~e  223 (304)
T 1rj9_A          145 GGTQLSEWGKRLSIPVIQGPEGTDSAALAYDAVQAMKARGY-DLLFVDTAGRLHTKHNLMEELKKVKRAIAKADPEEPKE  223 (304)
T ss_dssp             TTHHHHHHHHHHTCCEECCCTTCCHHHHHHHHHHHHHHHTC-SEEEECCCCCCTTCHHHHHHHHHHHHHHHHHCTTCCSE
T ss_pred             HHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHHCCC-CEEEECCHHCCCCHHHHHHHHHHHHHHHHHCCCCCCCE
T ss_conf             67899985655685079668872078778999999998699-98997504303103778877788887765326789855


Q ss_pred             EEEEEECCCCHHHHHHHHH----CCCCEEEECCCC
Q ss_conf             3999963899899999997----699889976989
Q gi|254780892|r   76 FVYYLLMEVDFEKMIAGAR----AGANSFLLKPFN  106 (133)
Q Consensus        76 pii~lT~~~~~~~~~~a~~----~Ga~~yl~KP~~  106 (133)
                      +++++++....+...++..    .|.++.+.--++
T Consensus       224 ~~LVl~a~~~~~~~~~~~~~~~~~~~~~~IlTKlD  258 (304)
T 1rj9_A          224 VWLVLDAVTGQNGLEQAKKFHEAVGLTGVIVTKLD  258 (304)
T ss_dssp             EEEEEETTBCTHHHHHHHHHHHHHCCSEEEEECTT
T ss_pred             EEEEEECCCCCHHHHHHHHHHHCCCCCEEEEECCC
T ss_conf             89996110383567799998742799779997246


No 153
>2vws_A YFAU, 2-keto-3-deoxy sugar aldolase; lyase, escherichia coli K-12 protein YFAU, degradation of homoprotocatechuate, class II aldolase; 1.39A {Escherichia coli} PDB: 2vwt_A
Probab=45.40  E-value=15  Score=16.38  Aligned_cols=98  Identities=11%  Similarity=0.075  Sum_probs=62.7

Q ss_pred             HHHHHHHHCC--CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCC--CCHHHHHHHHCCCCCCCEEEEEECCCCHHHHHH
Q ss_conf             9999999889--899999997999999971799948997078998--773899996143488973999963899899999
Q gi|254780892|r   16 VGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIA   91 (133)
Q Consensus        16 ~l~~~L~~~g--~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~--~~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~   91 (133)
                      .+++-|..-.  +-+..........+.+.... +|-|++|..--.  ..++...++........|++ --...+.....+
T Consensus         8 ~lk~kL~~g~~~~G~~~~~~sp~~~e~l~~~G-~Dfv~iD~EHg~~~~~~~~~~i~a~~~~g~~~~v-Rvp~~~~~~i~r   85 (267)
T 2vws_A            8 PFKERLRKGEVQIGLWLSSTTAYMAEIAATSG-YDWLLIDGEHAPNTIQDLYHQLQAVAPYASQPVI-RPVEGSKPLIKQ   85 (267)
T ss_dssp             HHHHHHHTTCCEEEEEECSCCHHHHHHHHTTC-CSEEEEETTTSCCCHHHHHHHHHHHTTSSSEEEE-ECSSCCHHHHHH
T ss_pred             HHHHHHHCCCCEEEEEECCCCHHHHHHHHHCC-CCEEEECCCCCCCCHHHHHHHHHHHHCCCCCCEE-EECCCCHHHHHH
T ss_conf             99999987998799887899979999998379-8999981668988899999999886146997458-714784799999


Q ss_pred             HHHCCCCEEEECCCCH-HHHHHHHH
Q ss_conf             9976998899769898-99999999
Q gi|254780892|r   92 GARAGANSFLLKPFNR-ETLRFAMR  115 (133)
Q Consensus        92 a~~~Ga~~yl~KP~~~-~~L~~~i~  115 (133)
                      +++.||.+.+.--++- ++....++
T Consensus        86 ~LD~Ga~GIivP~v~s~eea~~~v~  110 (267)
T 2vws_A           86 VLDIGAQTLLIPMVDTAEQARQVVS  110 (267)
T ss_dssp             HHHTTCCEEEECCCCSHHHHHHHHH
T ss_pred             HHHCCCCEEEECCCCCHHHHHHHHH
T ss_conf             9838998899899499999999999


No 154
>2z6i_A Trans-2-enoyl-ACP reductase II; fatty acid synthesis, antibiotics, oxidoreductase, flavoprotein; HET: FMN; 1.70A {Streptococcus pneumoniae} PDB: 2z6j_A*
Probab=44.88  E-value=15  Score=16.33  Aligned_cols=81  Identities=19%  Similarity=0.156  Sum_probs=57.2

Q ss_pred             HHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCC-------CHHHHHHHHCCCCCCCEEEEEECCCCHHH
Q ss_conf             9999998898999-999979999999717999489970789987-------73899996143488973999963899899
Q gi|254780892|r   17 GRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGV-------LEFIAHVRQMPLGTDVFVYYLLMEVDFEK   88 (133)
Q Consensus        17 l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-------~~l~~~ir~~~~~~~~pii~lT~~~~~~~   88 (133)
                      +-+.+...|..|. .+.+..+|...... . +|.+++.-.--||       ..++.+++.   ..++|+|.--+-.+...
T Consensus       102 ~~~~~~~~g~~v~~~v~~~~~A~~a~~~-g-~D~lv~qG~eaGGH~g~~~~~~L~~~v~~---~~~vPviaAGGI~dg~~  176 (332)
T 2z6i_A          102 YMERFHEAGIIVIPVVPSVALAKRMEKI-G-ADAVIAEGMEAGGHIGKLTTMTLVRQVAT---AISIPVIAAGGIADGEG  176 (332)
T ss_dssp             THHHHHHTTCEEEEEESSHHHHHHHHHT-T-CSCEEEECTTSSEECCSSCHHHHHHHHHH---HCSSCEEEESSCCSHHH
T ss_pred             HHHHHHHHCCEEEECCCCHHHHHHHHHH-C-CCEEEEECCCCCCCCCCCCCHHHHHHHHH---HCCCCEEEECCCCCHHH
T ss_conf             9999997098898558788999999986-8-99899867876788755651125567775---06843575233542889


Q ss_pred             HHHHHHCCCCEEEE
Q ss_conf             99999769988997
Q gi|254780892|r   89 MIAGARAGANSFLL  102 (133)
Q Consensus        89 ~~~a~~~Ga~~yl~  102 (133)
                      ...++..||+....
T Consensus       177 ~aaal~lGA~gV~~  190 (332)
T 2z6i_A          177 AAAGFMLGAEAVQV  190 (332)
T ss_dssp             HHHHHHTTCSEEEE
T ss_pred             HHHHHHCCCCEEEE
T ss_conf             99999759763223


No 155
>1to3_A Putative aldolase YIHT; beta-alpha barrel, structural genomics, PSI, protein structure initiative; 2.70A {Salmonella typhimurium} SCOP: c.1.10.1
Probab=44.82  E-value=15  Score=16.33  Aligned_cols=63  Identities=16%  Similarity=0.068  Sum_probs=38.2

Q ss_pred             HHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHHCCCCCCCEEEEEECCCCH----HHHHHHHHCCCCEEEE
Q ss_conf             99999717999489970789987-----738999961434889739999638998----9999999769988997
Q gi|254780892|r   37 AREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQMPLGTDVFVYYLLMEVDF----EKMIAGARAGANSFLL  102 (133)
Q Consensus        37 Al~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~----~~~~~a~~~Ga~~yl~  102 (133)
                      |.+.+.. .-.|++-  |..|+.     .+.+...+........|+|++++....    +....|+++|+.+|+.
T Consensus       182 a~r~~~e-~G~Di~K--~~~P~~~~~~~~~~~~~~~~~~~~~~~p~vvLggg~~~e~f~~~l~~A~~aGa~G~~~  253 (304)
T 1to3_A          182 AAKELGD-SGADLYK--VEMPLYGKGARSDLLTASQRLNGHINMPWVILSSGVDEKLFPRAVRVAMEAGASGFLA  253 (304)
T ss_dssp             HHHHHTT-SSCSEEE--ECCGGGGCSCHHHHHHHHHHHHHTCCSCEEECCTTSCTTTHHHHHHHHHHTTCCEEEE
T ss_pred             HHHHHHH-CCCCEEE--EECCCCCCHHHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHCCCEEEEE
T ss_conf             9999987-3998799--9788775322468999999985158994899828989899999999999769939985


No 156
>3c85_A Putative glutathione-regulated potassium-efflux system protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633}
Probab=44.64  E-value=16  Score=16.31  Aligned_cols=91  Identities=5%  Similarity=-0.057  Sum_probs=47.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCH-HHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             79997399899999999999889899999997-9999999717999489970789987-738999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSV-CEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g-~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~l   80 (133)
                      .+++||.|+...+.    +...|+.+....-. .+.|+........+++++-..=+.. .-.+..+|..  .++++|+..
T Consensus        65 ~~vviD~d~~~v~~----l~~~g~~~v~gD~~d~~~L~~a~~~~~a~~vi~~~~~~~~n~~~~~~~r~~--~~~~~Iiar  138 (183)
T 3c85_A           65 ISLGIEIREEAAQQ----HRSEGRNVISGDATDPDFWERILDTGHVKLVLLAMPHHQGNQTALEQLQRR--NYKGQIAAI  138 (183)
T ss_dssp             CEEEEESCHHHHHH----HHHTTCCEEECCTTCHHHHHTBCSCCCCCEEEECCSSHHHHHHHHHHHHHT--TCCSEEEEE
T ss_pred             EEEEEECCHHHHHH----HHCCCCEEEECCCCCHHHHHHHCCCCCCCEEEECCCCHHHHHHHHHHHHHH--CCCCEEEEE
T ss_conf             69999388188788----630461389868999999997149676749998168407999999999987--899479999


Q ss_pred             ECCCCHHHHHHHHHCCCCEEE
Q ss_conf             638998999999976998899
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFL  101 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl  101 (133)
                      +.  +.++.....++||+..+
T Consensus       139 a~--~~~~~~~L~~~Gad~Vv  157 (183)
T 3c85_A          139 AE--YPDQLEGLLESGVDAAF  157 (183)
T ss_dssp             ES--SHHHHHHHHHHTCSEEE
T ss_pred             EC--CHHHHHHHHHCCCCEEE
T ss_conf             77--99999999986999999


No 157
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant 1; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 1.90A {Ehrlichia chaffeensis}
Probab=44.08  E-value=16  Score=16.26  Aligned_cols=83  Identities=6%  Similarity=0.036  Sum_probs=41.8

Q ss_pred             HHHHHCCCEEEEECCHH-HHH-HHHHH---CCCCCEEEECCCC----CCCCHHHHHHHHCCCCCCCEEEEEECCCCHHHH
Q ss_conf             99998898999999979-999-99971---7999489970789----987738999961434889739999638998999
Q gi|254780892|r   19 HLFNDFGFMVFEATSVC-EAR-EFCEK---ELLPNYLVIDESM----EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKM   89 (133)
Q Consensus        19 ~~L~~~g~~v~~a~~g~-eAl-~~~~~---~~~pdlii~D~~m----P~~~~l~~~ir~~~~~~~~pii~lT~~~~~~~~   89 (133)
                      ..|+..|+.+..++++. +.+ ..+..   ..++|-++.--..    |+-.-+...+++....+.=-++++.  +...+.
T Consensus       113 ~~L~~~g~~~~i~Tn~~~~~~~~~l~~~~l~~~Fd~i~~~~~~~~~KP~~~~~~~~~~~~~~~p~~~~~~Vg--Ds~~Di  190 (231)
T 3kzx_A          113 DTLKENNITMAIVSNKNGERLRSEIHHKNLTHYFDSIIGSGDTGTIKPSPEPVLAALTNINIEPSKEVFFIG--DSISDI  190 (231)
T ss_dssp             HHHHHTTCEEEEEEEEEHHHHHHHHHHTTCGGGCSEEEEETSSSCCTTSSHHHHHHHHHHTCCCSTTEEEEE--SSHHHH
T ss_pred             HHHHHCCCCEEEECCCCCCHHHHHHHHHHHCCCCCEEEEECCCCCCCCCHHHHHHHHHHCCCCHHHCEEEEE--CCHHHH
T ss_conf             999978992899659963048999999741244454886021225789899999999991989357459993--888889


Q ss_pred             HHHHHCCCCEEEEC
Q ss_conf             99997699889976
Q gi|254780892|r   90 IAGARAGANSFLLK  103 (133)
Q Consensus        90 ~~a~~~Ga~~yl~K  103 (133)
                      ..|.++|...+...
T Consensus       191 ~aA~~~G~~~v~v~  204 (231)
T 3kzx_A          191 QSAIEAGCLPIKYG  204 (231)
T ss_dssp             HHHHHTTCEEEEEC
T ss_pred             HHHHHCCCEEEEEC
T ss_conf             99998499899989


No 158
>3czc_A RMPB; alpha/beta sandwich, phosphotransferase system, transferase, transport; 2.02A {Streptococcus mutans}
Probab=44.00  E-value=16  Score=16.25  Aligned_cols=79  Identities=16%  Similarity=0.101  Sum_probs=53.7

Q ss_pred             CCEEEEECC-----CHHHHHHHHHHHHHCCCE-E-EEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCC
Q ss_conf             977999739-----989999999999988989-9-999997999999971799948997078998773899996143488
Q gi|254780892|r    1 MDSLLLVDS-----SHIVRKVGRHLFNDFGFM-V-FEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGT   73 (133)
Q Consensus         1 m~~ILiVDD-----~~~~r~~l~~~L~~~g~~-v-~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~   73 (133)
                      |.|||+|=.     +...+.-+++.|...|+. + ....+-.++-...  .. +|+|++-..+.+-.         +...
T Consensus        18 m~KIlvvCgsGigTS~ml~~kik~~l~e~gi~~v~v~~~~~~~~~~~~--~~-~DiIitt~~l~~~~---------~~~~   85 (110)
T 3czc_A           18 MVKVLTACGNGMGSSMVIKMKVENALRQLGVSDIESASCSVGEAKGLA--SN-YDIVVASNHLIHEL---------DGRT   85 (110)
T ss_dssp             CEEEEEECCCCHHHHHHHHHHHHHHHHHTTCCCEEEEEECHHHHHHHG--GG-CSEEEEETTTGGGT---------TTSC
T ss_pred             CEEEEEECCCCCCHHHHHHHHHHHHHHHCCCCEEEEEEECHHHHHCCC--CC-CEEEEECHHHHHHH---------CCCC
T ss_conf             208999999970299999999999999859970599980177642676--89-36999880676774---------1568


Q ss_pred             CCEEEEEECCCCHHHHHH
Q ss_conf             973999963899899999
Q gi|254780892|r   74 DVFVYYLLMEVDFEKMIA   91 (133)
Q Consensus        74 ~~pii~lT~~~~~~~~~~   91 (133)
                      ..|++.++..-+.+...+
T Consensus        86 ~~~vi~l~~~ld~~el~e  103 (110)
T 3czc_A           86 NGKLIGLDNLMDDNEIKT  103 (110)
T ss_dssp             SSEEEEESSTTCHHHHHH
T ss_pred             CCCEEEEECCCCHHHHHH
T ss_conf             886899967899899999


No 159
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica}
Probab=43.85  E-value=16  Score=16.23  Aligned_cols=32  Identities=13%  Similarity=0.077  Sum_probs=28.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             97799973998999999999998898999999
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEAT   32 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~   32 (133)
                      ||||||.=-+=.+...+.+.|...|++|....
T Consensus        21 MkkVLVTGasGfiG~~lv~~L~~~g~~V~~id   52 (333)
T 2q1w_A           21 MKKVFITGICGQIGSHIAELLLERGDKVVGID   52 (333)
T ss_dssp             CCEEEEETTTSHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             78799907887899999999997829899997


No 160
>3bw2_A 2-nitropropane dioxygenase; TIM barrel, oxidoreductase; HET: FMN; 2.10A {Streptomyces ansochromogenes} PDB: 3bw4_A* 3bw3_A*
Probab=43.83  E-value=16  Score=16.23  Aligned_cols=84  Identities=18%  Similarity=0.084  Sum_probs=54.5

Q ss_pred             HHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCC---------------CHHHHHHHHCCCCCCCEEEEE
Q ss_conf             9999998898999-999979999999717999489970789987---------------738999961434889739999
Q gi|254780892|r   17 GRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGV---------------LEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus        17 l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~---------------~~l~~~ir~~~~~~~~pii~l   80 (133)
                      +...+...|..|. .+.+..+|...... . +|.|++.-.--||               ......+.+.....++|||.=
T Consensus       137 ~i~~lk~~g~~v~~~v~s~~~a~~a~~~-g-~D~iv~qG~eAGGH~g~~~~~~~~~~~~~~~~~l~~~v~~~~~iPviaA  214 (369)
T 3bw2_A          137 VIARLRRAGTLTLVTATTPEEARAVEAA-G-ADAVIAQGVEAGGHQGTHRDSSEDDGAGIGLLSLLAQVREAVDIPVVAA  214 (369)
T ss_dssp             HHHHHHHTTCEEEEEESSHHHHHHHHHT-T-CSEEEEECTTCSEECCCSSCCGGGTTCCCCHHHHHHHHHHHCSSCEEEE
T ss_pred             HHHHHHHCCCEEEEECCCHHHHHHHHHH-C-CCEEEEECCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEEE
T ss_conf             9999997695598505889999999981-8-9844410555677888776644344444108889999997569978962


Q ss_pred             ECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             6389989999999769988997
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                      -+-.+.+....++..||+....
T Consensus       215 GGI~~g~~iaaaLalGAdgV~~  236 (369)
T 3bw2_A          215 GGIMRGGQIAAVLAAGADAAQL  236 (369)
T ss_dssp             SSCCSHHHHHHHHHTTCSEEEE
T ss_pred             CCCCCHHHHHHHHHCCCCEEEE
T ss_conf             4777999999999539787998


No 161
>1izc_A Macrophomate synthase intermolecular diels- alderase; TIM-barrel, pyruvate Mg(II) complex, lyase; 1.70A {Macrophoma commelinae} SCOP: c.1.12.5
Probab=43.72  E-value=16  Score=16.22  Aligned_cols=102  Identities=17%  Similarity=0.196  Sum_probs=62.2

Q ss_pred             HHHHHHHHHHHCC---CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC--CHH---HHHHHHCCCCCCCEEEEEECCC
Q ss_conf             9999999999889---8999999979999999717999489970789987--738---9999614348897399996389
Q gi|254780892|r   13 VRKVGRHLFNDFG---FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF---IAHVRQMPLGTDVFVYYLLMEV   84 (133)
Q Consensus        13 ~r~~l~~~L~~~g---~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~~l---~~~ir~~~~~~~~pii~lT~~~   84 (133)
                      .|+-+++.+...|   +-+...-......+.+.... +|-|++|+.---+  .++   +..++.......+|+ +--...
T Consensus        28 ~~~~l~~~~~~~~~~~~G~~~~~ps~~~ae~~a~~G-~D~v~iD~EHg~~~~~~l~~~i~a~~~~~~~~~~~i-VRvp~~  105 (339)
T 1izc_A           28 LRQALKDAMADPSKTLMGVAHGIPSTFVTKVLAATK-PDFVWIDVEHGMFNRLELHDAIHAAQHHSEGRSLVI-VRVPKH  105 (339)
T ss_dssp             HHHHHHHHHHCGGGCEEEEEECSCCHHHHHHHHHTC-CSEEEEETTTSCCCHHHHHHHHHHHHHHTTTCSEEE-EECCTT
T ss_pred             HHHHHHHHHHCCCCCEEEEEECCCCHHHHHHHHCCC-CCEEEECCCCCCCCHHHHHHHHHHHHHHCCCCCCEE-EECCCC
T ss_conf             999999987557984898731589969999997699-899998578899999999999999998478998618-848988


Q ss_pred             CHHHHHHHHHCCCCEEEECCCC-HHHHHHHHHH
Q ss_conf             9899999997699889976989-8999999999
Q gi|254780892|r   85 DFEKMIAGARAGANSFLLKPFN-RETLRFAMRE  116 (133)
Q Consensus        85 ~~~~~~~a~~~Ga~~yl~KP~~-~~~L~~~i~~  116 (133)
                      +.....++++.||.+.+.--++ .++....++.
T Consensus       106 ~~~~i~~~LD~Ga~GIivP~V~s~eeA~~~V~a  138 (339)
T 1izc_A          106 DEVSLSTALDAGAAGIVIPHVETVEEVREFVKE  138 (339)
T ss_dssp             CHHHHHHHHHHTCSEEEETTCCCHHHHHHHHHH
T ss_pred             CHHHHHHHHHCCCCEEEECCCCCHHHHHHHHHH
T ss_conf             879999997179998997786999999999997


No 162
>1vch_A Phosphoribosyltransferase-related protein; structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.94A {Thermus thermophilus} SCOP: c.61.1.1
Probab=43.54  E-value=16  Score=16.21  Aligned_cols=18  Identities=22%  Similarity=-0.062  Sum_probs=6.6

Q ss_pred             ECCCCHHHHHHHHHCCCC
Q ss_conf             638998999999976998
Q gi|254780892|r   81 LMEVDFEKMIAGARAGAN   98 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~   98 (133)
                      ||.+-.....-..++||.
T Consensus       132 TG~Tl~a~~~~l~~aGa~  149 (175)
T 1vch_A          132 SGETMRAMEKMVLRAGGH  149 (175)
T ss_dssp             SSHHHHHHHHHHHHTTCE
T ss_pred             CCHHHHHHHHHHHHCCCE
T ss_conf             688899999999986997


No 163
>3l6u_A ABC-type sugar transport system periplasmic component; structural genomics, nysgrc, target 11006S, PSI-2, protein structure initiative; 1.90A {Exiguobacterium sibiricum}
Probab=42.48  E-value=17  Score=16.11  Aligned_cols=65  Identities=11%  Similarity=-0.048  Sum_probs=32.4

Q ss_pred             HHHHHHHHHHHCCCEEEEECCH------HHHHHHHHHCCCCCEEEECCCCCC-CCHHHHHHHHCCCCCCCEEEEEEC
Q ss_conf             9999999999889899999997------999999971799948997078998-773899996143488973999963
Q gi|254780892|r   13 VRKVGRHLFNDFGFMVFEATSV------CEAREFCEKELLPNYLVIDESMEG-VLEFIAHVRQMPLGTDVFVYYLLM   82 (133)
Q Consensus        13 ~r~~l~~~L~~~g~~v~~a~~g------~eAl~~~~~~~~pdlii~D~~mP~-~~~l~~~ir~~~~~~~~pii~lT~   82 (133)
                      ....+...+...||++....+.      .+.++.+.+.. +|.||+--.-++ ....++++++    ..+|||.+..
T Consensus        26 ~~~~i~~~a~~~Gy~~~~~~~~~~~~~~~~~i~~li~~~-~DgIii~~~~~~~~~~~l~~~~~----~giPVV~~~~   97 (293)
T 3l6u_A           26 LINAFKAEAKANKYEALVATSQNSRISEREQILEFVHLK-VDAIFITTLDDVYIGSAIEEAKK----AGIPVFAIDR   97 (293)
T ss_dssp             HHHHHHHHHHHTTCEEEEEECSSCHHHHHHHHHHHHHTT-CSEEEEECSCTTTTHHHHHHHHH----TTCCEEEESS
T ss_pred             HHHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCC-CCEEEEECCCCCCHHHHHHHHHH----CCCCEEECCC
T ss_conf             999999999986998999979999899999999999769-99999943322013899999998----6997997177


No 164
>2jbm_A Nicotinate-nucleotide pyrophosphorylase; NAD, enzyme, metabolism, transferase, polymorphism, glycosyltransferase, pyridine nucleotide biosynthesis; HET: SRT; 2.0A {Homo sapiens}
Probab=41.83  E-value=17  Score=16.05  Aligned_cols=69  Identities=10%  Similarity=-0.008  Sum_probs=38.7

Q ss_pred             EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEE
Q ss_conf             99999979999999717999489970789987-738999961434889739999638998999999976998899
Q gi|254780892|r   28 VFEATSVCEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFL  101 (133)
Q Consensus        28 v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl  101 (133)
                      ..++.+-+||.+.+.. . +|.|.+|-.=|.. -+..+.++..  .+++. |..||.-+.+...+....|++.+-
T Consensus       201 evEv~~~~ea~~a~~~-g-~d~I~LDn~s~e~l~~~v~~l~~~--~~~v~-ieaSGGI~~~ni~~ya~~GVD~is  270 (299)
T 2jbm_A          201 EVECSSLQEAVQAAEA-G-ADLVLLDNFKPEELHPTATVLKAQ--FPSVA-VEASGGITLDNLPQFCGPHIDVIS  270 (299)
T ss_dssp             EEEESSHHHHHHHHHT-T-CSEEEEESCCHHHHHHHHHHHHHH--CTTSE-EEEESSCCTTTHHHHCCTTCCEEE
T ss_pred             EEECCCHHHHHHHHHC-C-CCEEEEECCCHHHHHHHHHHHHCC--CCCEE-EEEECCCCHHHHHHHHHCCCCEEE
T ss_conf             9704889999999972-9-999998088999999999998464--89769-999899999999999972989998


No 165
>2agk_A 1-(5-phosphoribosyl)-5-[(5-phosphoribosylamino) methylideneamino] imidazole-4-carboxamide...; TIM alpha/beta barrel; HET: CIT; 1.30A {Saccharomyces cerevisiae}
Probab=41.65  E-value=17  Score=16.03  Aligned_cols=69  Identities=9%  Similarity=0.065  Sum_probs=45.4

Q ss_pred             HHHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHH-CCCCCCCEEEEEECCCCHHHHHHH--HHCCCCEEEE-CC
Q ss_conf             999999717999489970789987-----738999961-434889739999638998999999--9769988997-69
Q gi|254780892|r   36 EAREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQ-MPLGTDVFVYYLLMEVDFEKMIAG--ARAGANSFLL-KP  104 (133)
Q Consensus        36 eAl~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~-~~~~~~~pii~lT~~~~~~~~~~a--~~~Ga~~yl~-KP  104 (133)
                      +.+..+.+...-.++++|+.--|+     +++++.+.. .+..+++||+.--+-++.++..+.  +..|+.+.+. |-
T Consensus       161 ~~~~~~~~~g~~eii~TdI~rDGt~~G~dl~l~~~i~~~~~~~~~ipvIasGGv~s~~Dl~~l~~l~~g~~gviiG~A  238 (260)
T 2agk_A          161 ADTFRELRKYTNEFLIHAADVEGLCGGIDELLVSKLFEWTKDYDDLKIVYAGGAKSVDDLKLVDELSHGKVDLTFGSS  238 (260)
T ss_dssp             HHHHHHHTTTCSEEEEEC-------CCCCHHHHHHHHHHHTTCSSCEEEEESCCCCTHHHHHHHHHHTTCEEEECCTT
T ss_pred             HHHHHHHHCCCCEEEEEEECCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHCCCCCCEEEEEHH
T ss_conf             999998724866798767503012678679999999998555799419999488999999999852699832997721


No 166
>3bo9_A Putative nitroalkan dioxygenase; TM0800, structural genomics, joint center for structural genomics, JCSG, protein structure initiative; HET: MSE 2PE; 2.71A {Thermotoga maritima MSB8}
Probab=41.54  E-value=17  Score=16.02  Aligned_cols=83  Identities=16%  Similarity=0.026  Sum_probs=57.6

Q ss_pred             HHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCC----CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHH
Q ss_conf             9999998898999-999979999999717999489970789987----73899996143488973999963899899999
Q gi|254780892|r   17 GRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGV----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIA   91 (133)
Q Consensus        17 l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~----~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~   91 (133)
                      +.+.++..|..+. .+.+..+|...... . +|.++.--.=-||    ......+.......++|||.-.+-.+......
T Consensus       116 ~i~~~~~~gi~v~~~v~s~~~A~~a~~~-g-~D~lV~qG~eAGGH~~~~~~~~l~~~~~~~~~iPviaAGGI~dg~~~aa  193 (326)
T 3bo9_A          116 YIRELKENGTKVIPVVASDSLARMVERA-G-ADAVIAEGMESGGHIGEVTTFVLVNKVSRSVNIPVIAAGGIADGRGMAA  193 (326)
T ss_dssp             HHHHHHHTTCEEEEEESSHHHHHHHHHT-T-CSCEEEECTTSSEECCSSCHHHHHHHHHHHCSSCEEEESSCCSHHHHHH
T ss_pred             HHHHHHHCCCEEEEECCCHHHHHHHHHC-C-CCEEEEECCCCCCCCCCCCHHHHHHHHHHHCCCCEEEECCCCCHHHHHH
T ss_conf             9999974698899955999999999872-8-9889963687667888775577766677642566698657678899999


Q ss_pred             HHHCCCCEEE
Q ss_conf             9976998899
Q gi|254780892|r   92 GARAGANSFL  101 (133)
Q Consensus        92 a~~~Ga~~yl  101 (133)
                      ++..||+...
T Consensus       194 alalGA~gv~  203 (326)
T 3bo9_A          194 AFALGAEAVQ  203 (326)
T ss_dssp             HHHHTCSEEE
T ss_pred             HHHCCCCCCC
T ss_conf             9955976241


No 167
>1wv2_A Thiazole moeity, thiazole biosynthesis protein THIG; structural genomics, protein structure initiative, PSI; 2.90A {Pseudomonas aeruginosa} SCOP: c.1.31.1
Probab=41.09  E-value=18  Score=15.98  Aligned_cols=105  Identities=10%  Similarity=-0.088  Sum_probs=70.5

Q ss_pred             HHHHHHHHHHCCCEEEE-ECCHHHHHHHHHHCCCCCEEEECCCCCCC--C-----HHHHHHHHCCCCCCCEEEEEECCCC
Q ss_conf             99999999988989999-99979999999717999489970789987--7-----3899996143488973999963899
Q gi|254780892|r   14 RKVGRHLFNDFGFMVFE-ATSVCEAREFCEKELLPNYLVIDESMEGV--L-----EFIAHVRQMPLGTDVFVYYLLMEVD   85 (133)
Q Consensus        14 r~~l~~~L~~~g~~v~~-a~~g~eAl~~~~~~~~pdlii~D~~mP~~--~-----~l~~~ir~~~~~~~~pii~lT~~~~   85 (133)
                      ---..+.|-..||.|.. +.+....-..++.-..  ..++.|-=|=|  -     ..++.++.   ...+|+|+=-|-+.
T Consensus       124 tl~Aa~~Lvk~gF~VlpY~~dD~~~ak~L~d~Gc--~avMPlgsPIGSg~Gi~n~~~l~~i~~---~~~vpviVDAGIG~  198 (265)
T 1wv2_A          124 TLKAAEQLVKDGFDVMVYTSDDPIIARQLAEIGC--IAVMPLAGLIGSGLGICNPYNLRIILE---EAKVPVLVDAGVGT  198 (265)
T ss_dssp             HHHHHHHHHTTTCEEEEEECSCHHHHHHHHHSCC--SEEEECSSSTTCCCCCSCHHHHHHHHH---HCSSCBEEESCCCS
T ss_pred             HHHHHHHHHHCCCEEEECCCCCHHHHHHHHHCCC--EEECCCCCCCCCCCCCCCHHHHHHHHH---CCCCEEEEECCCCC
T ss_conf             9999999997897796247846999999875496--375448321011246367789999985---38952997468897


Q ss_pred             HHHHHHHHHCCCCEEEE-----CCCCHHHHHHHHHHHHHHHHH
Q ss_conf             89999999769988997-----698989999999999999999
Q gi|254780892|r   86 FEKMIAGARAGANSFLL-----KPFNRETLRFAMRELPQMQKS  123 (133)
Q Consensus        86 ~~~~~~a~~~Ga~~yl~-----KP~~~~~L~~~i~~~~~~~~~  123 (133)
                      +.+..+||+.|+++.|+     |--++.....+++...+--+.
T Consensus       199 pSdAa~aMElG~DaVLvNTAIa~a~dP~~MA~A~~~AV~AGR~  241 (265)
T 1wv2_A          199 ASDAAIAMELGCEAVLMNTAIAHAKDPVMMAEAMKHAIVAGRL  241 (265)
T ss_dssp             HHHHHHHHHHTCSEEEESHHHHTSSSHHHHHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHCCCCEEEECHHHHCCCCHHHHHHHHHHHHHHHHH
T ss_conf             8899999971488898532756389989999999999999999


No 168
>2qm3_A Predicted methyltransferase; putative methyltransferase, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.05A {Pyrococcus furiosus dsm 3638}
Probab=41.08  E-value=18  Score=15.98  Aligned_cols=75  Identities=11%  Similarity=0.101  Sum_probs=42.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCE-EE-EECCHHHHHHHHHHCCCCCEEEECCCCCC----CCHHHHHHHHCCCCCCC
Q ss_conf             77999739989999999999988989-99-99997999999971799948997078998----77389999614348897
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFM-VF-EATSVCEAREFCEKELLPNYLVIDESMEG----VLEFIAHVRQMPLGTDV   75 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~-v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~----~~~l~~~ir~~~~~~~~   75 (133)
                      ++|..||=++.....+++.+...|.. +. ...+..+.+..... ..+|+|++|-  |-    ...++.+..+.......
T Consensus       196 ~~V~~vDi~~~~l~~a~~~a~~~g~~~i~~~~~d~~~~~~~~~~-~~fD~v~~dp--p~~~~~~~~~l~r~~~~l~~~g~  272 (373)
T 2qm3_A          196 KRIAVLDIDERLTKFIEKAANEIGYEDIEIFTFDLRKPLPDYAL-HKFDTFITDP--PETLEAIRAFVGRGIATLKGPRC  272 (373)
T ss_dssp             SEEEEECSCHHHHHHHHHHHHHHTCCCEEEECCCTTSCCCTTTS-SCBSEEEECC--CSSHHHHHHHHHHHHHTBCSTTC
T ss_pred             CEEEEEECCHHHHHHHHHHHHHHCCCCEEEEECHHHHHHHHHCC-CCCCEEEECC--CCCCCCHHHHHHHHHHHHCCCCC
T ss_conf             98999979799999999999981997439985308663245407-8889899899--98644277999999998456762


Q ss_pred             EEEE
Q ss_conf             3999
Q gi|254780892|r   76 FVYY   79 (133)
Q Consensus        76 pii~   79 (133)
                      -+++
T Consensus       273 ~~~~  276 (373)
T 2qm3_A          273 AGYF  276 (373)
T ss_dssp             EEEE
T ss_pred             EEEE
T ss_conf             7999


No 169
>1qo2_A Molecule: N-((5-phosphoribosyl)-formimino)-5-aminoimidazol- 4-carboxamid ribonucleotid...; isomerase, histidine biosynthesis; 1.85A {Thermotoga maritima} SCOP: c.1.2.1 PDB: 2cff_A 2w79_A
Probab=40.80  E-value=17  Score=16.04  Aligned_cols=61  Identities=7%  Similarity=-0.029  Sum_probs=33.8

Q ss_pred             CHHHHHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCC
Q ss_conf             979999999717999489970789987-----7389999614348897399996389989999999769
Q gi|254780892|r   33 SVCEAREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAG   96 (133)
Q Consensus        33 ~g~eAl~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~G   96 (133)
                      +..+.++.+.....-.++++|+.--|+     .++++.+++   ..++|+++--|-.+.++..++.+.|
T Consensus       145 ~~~~~~~~~~~~g~~eiil~~id~dGt~~G~d~~ll~~i~~---~~~~pii~~GGv~s~~dl~~l~~~g  210 (241)
T 1qo2_A          145 DPVSLLKRLKEYGLEEIVHTEIEKDGTLQEHDFSLTKKIAI---EAEVKVLAAGGISSENSLKTAQKVH  210 (241)
T ss_dssp             CHHHHHHHHHTTTCCEEEEEETTHHHHTCCCCHHHHHHHHH---HHTCEEEEESSCCSHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHCCCCEEEEEEHHHHHHHCCCCHHHHHHHHH---HCCCCEEEECCCCCHHHHHHHHHCC
T ss_conf             48999999754156349974154344414898799999997---4897399985999999999999736


No 170
>3bwc_A Spermidine synthase; SAM, SGPP, structural genomics, PSI, protein structure initiative; HET: MSE SAM; 2.30A {Trypanosoma cruzi strain cl brener} PDB: 3bwb_A*
Probab=40.70  E-value=18  Score=15.94  Aligned_cols=66  Identities=14%  Similarity=0.057  Sum_probs=46.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHC-------CCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-------CHHHHHHH
Q ss_conf             77999739989999999999988-------98999999979999999717999489970789987-------73899996
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDF-------GFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-------LEFIAHVR   67 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~-------g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-------~~l~~~ir   67 (133)
                      ++|-+||=|+.+-+..+..+...       ..+ ....+|.+-+..... ..+|+|++|..-|.+       .++.+.++
T Consensus       120 ~~v~~VEID~~Vi~~~~~~~p~~~~~~~dprv~-iii~D~~~~l~~~~~-~~yDvIi~D~~dp~~~~~~L~t~eFy~~~~  197 (304)
T 3bwc_A          120 EHCDLVDIDGEVMEQSKQHFPQISRSLADPRAT-VRVGDGLAFVRQTPD-NTYDVVIIDTTDPAGPASKLFGEAFYKDVL  197 (304)
T ss_dssp             CEEEEEESCHHHHHHHHHHCHHHHGGGGCTTEE-EEESCHHHHHHSSCT-TCEEEEEEECC---------CCHHHHHHHH
T ss_pred             CEEEEEECCHHHHHHHHHHCHHHHCCCCCCCEE-EEECHHHHHHHHCCC-CCCCEEEEECCCCCCCHHHHCCHHHHHHHH
T ss_conf             279998058899999998654430111498648-998669999974634-687689990899887257654299999999


Q ss_pred             HC
Q ss_conf             14
Q gi|254780892|r   68 QM   69 (133)
Q Consensus        68 ~~   69 (133)
                      +.
T Consensus       198 ~~  199 (304)
T 3bwc_A          198 RI  199 (304)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             98


No 171
>3e05_A Precorrin-6Y C5,15-methyltransferase (decarboxylating); porphyrin metabolism, S-adenosyl-methionine, structural genomics; 1.80A {Geobacter metallireducens gs-15}
Probab=40.30  E-value=17  Score=16.02  Aligned_cols=63  Identities=14%  Similarity=0.042  Sum_probs=39.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEE--EECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHH
Q ss_conf             799973998999999999998898999--999979999999717999489970789987738999961
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVF--EATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQ   68 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~--~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~   68 (133)
                      +|.=+|-|+......++-++..|..-.  ...+..+++   .....||.|+++...+...+++..+..
T Consensus        66 ~V~aiD~~~~~~~~a~~n~~~~g~~~~~~~~g~~~~~~---~~~~~~D~i~i~~~~~~~~~~l~~~~~  130 (204)
T 3e05_A           66 RIFALERNPQYLGFIRDNLKKFVARNVTLVEAFAPEGL---DDLPDPDRVFIGGSGGMLEEIIDAVDR  130 (204)
T ss_dssp             EEEEEECCHHHHHHHHHHHHHHTCTTEEEEECCTTTTC---TTSCCCSEEEESCCTTCHHHHHHHHHH
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCEEEEEECCCCCCC---CCCCCCCEEEECCCCCCHHHHHHHHHH
T ss_conf             79999499999999999999819985899734532345---435787699990655235899999998


No 172
>2fpo_A Methylase YHHF; structural genomics, putative methyltransferase, PSI, protein structure initiative, midwest center for structural genomics; HET: MSE; 2.05A {Escherichia coli K12} SCOP: c.66.1.46
Probab=40.00  E-value=18  Score=15.87  Aligned_cols=50  Identities=10%  Similarity=0.054  Sum_probs=25.9

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCE--EEEECCHHHHHHHHHH-CCCCCEEEECC
Q ss_conf             77999739989999999999988989--9999997999999971-79994899707
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFM--VFEATSVCEAREFCEK-ELLPNYLVIDE   54 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~--v~~a~~g~eAl~~~~~-~~~pdlii~D~   54 (133)
                      +++..||-|......+++-++..+..  .....+.   +..+.. +..+|+|++|-
T Consensus        78 ~~v~fVE~~~~a~~~l~~N~~~~~~~~~~ii~~d~---~~~l~~~~~~fDlIflDP  130 (202)
T 2fpo_A           78 AGATLIEMDRAVSQQLIKNLATLKAGNARVVNSNA---MSFLAQKGTPHNIVFVDP  130 (202)
T ss_dssp             SEEEEECSCHHHHHHHHHHHHHTTCCSEEEECSCH---HHHHSSCCCCEEEEEECC
T ss_pred             CEEEEEEECCCHHHHHHHHHHHHCCCCCEEEECCH---HHHHHHCCCCCCEEEECC
T ss_conf             88689997033356788789874635535995324---565541277666899769


No 173
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli O157} SCOP: c.108.1.6
Probab=39.87  E-value=18  Score=15.86  Aligned_cols=16  Identities=31%  Similarity=0.335  Sum_probs=7.4

Q ss_pred             HHHHHHHHHCCCCEEE
Q ss_conf             8999999976998899
Q gi|254780892|r   86 FEKMIAGARAGANSFL  101 (133)
Q Consensus        86 ~~~~~~a~~~Ga~~yl  101 (133)
                      ..+...|.++|+..+.
T Consensus       177 ~~Di~aA~~~G~~~i~  192 (226)
T 1te2_A          177 VNGMIASKAARMRSIV  192 (226)
T ss_dssp             HHHHHHHHHTTCEEEE
T ss_pred             HHHHHHHHHCCCEEEE
T ss_conf             9899999993998999


No 174
>1r8j_A KAIA; circadian clock protein; 2.03A {Synechococcus elongatus pcc 7942} SCOP: a.186.1.1 c.23.1.5 PDB: 1m2e_A 1m2f_A
Probab=39.72  E-value=19  Score=15.85  Aligned_cols=108  Identities=9%  Similarity=0.024  Sum_probs=67.8

Q ss_pred             EEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHC-CCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEEEEEC
Q ss_conf             99973998999999999998898999999979999999717-99948997078998773899996143488973999963
Q gi|254780892|r    4 LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE-LLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYYLLM   82 (133)
Q Consensus         4 ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~-~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii~lT~   82 (133)
                      |-+.=-++...+.+++.|...-|.+....++++-++.++++ ..+|++++-..-|....+...+...  +--.|+|++..
T Consensus        12 I~lll~s~~Laq~c~qwL~~dRY~l~~~~s~~efle~Le~~~e~IDCLVl~~~~~~l~~~~~qL~~~--GlLLPaVvvg~   89 (289)
T 1r8j_A           12 ICIWVESTAILQDCQRALSADRYQLQVCESGEMLLEYAQTHRDQIDCLILVAANPSFRAVVQQLCFE--GVVVPAIVVGD   89 (289)
T ss_dssp             EEEECCCHHHHHHHHHHTCSTTEEEEEECSHHHHHHHHHHSTTSCSEEEEETTSTTHHHHHHHHHHT--TCCCCEEEESC
T ss_pred             EEEEECCHHHHHHHHHHCCCCCEEEEECCCHHHHHHHHHHCCCCCCEEEEEECCCCHHHHHHHHHHC--CCCCCEEEECC
T ss_conf             0246388899999998677885599844878899999984745677799971587428999999965--85355799615


Q ss_pred             CCCHHHHHHHHHCCCCEE----EECCCCH-HHHHHHHHH
Q ss_conf             899899999997699889----9769898-999999999
Q gi|254780892|r   83 EVDFEKMIAGARAGANSF----LLKPFNR-ETLRFAMRE  116 (133)
Q Consensus        83 ~~~~~~~~~a~~~Ga~~y----l~KP~~~-~~L~~~i~~  116 (133)
                      ......   .-..|-..|    +.-|.+. +.|-..|.+
T Consensus        90 ~~~~~~---~e~~~~~~YH~aEV~L~~dQLeqL~~~ID~  125 (289)
T 1r8j_A           90 RDSEDP---DEPAKEQLYHSAELHLGIHQLEQLPYQVDA  125 (289)
T ss_dssp             CC---------CCSSCSSBTTCEEECTTCGGGHHHHHHH
T ss_pred             CCCCCC---CCCCCCEEEEEEEEECCHHHHHHHHHHHHH
T ss_conf             777888---788862454422687676449885789999


No 175
>3cbg_A O-methyltransferase; cyanobacterium; HET: SAH FER 4FE; 2.00A {Synechocystis SP}
Probab=38.29  E-value=20  Score=15.71  Aligned_cols=65  Identities=8%  Similarity=0.085  Sum_probs=49.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCE---EEEECCHHHHHHHHHHC---CCCCEEEECCCCCCCCHHHHHHH
Q ss_conf             7999739989999999999988989---99999979999999717---99948997078998773899996
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFM---VFEATSVCEAREFCEKE---LLPNYLVIDESMEGVLEFIAHVR   67 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~---v~~a~~g~eAl~~~~~~---~~pdlii~D~~mP~~~~l~~~ir   67 (133)
                      +|.-+|-++......+..+...|+.   .....++.+.++.+...   ..+|+|++|-.-.+-........
T Consensus        99 ~v~tiE~~~~~~~~A~~~~~~ag~~~~i~~~~g~a~e~l~~l~~~~~~~~fD~iFiDadK~~y~~y~~~~~  169 (232)
T 3cbg_A           99 QIIACDQDPNATAIAKKYWQKAGVAEKISLRLGPALATLEQLTQGKPLPEFDLIFIDADKRNYPRYYEIGL  169 (232)
T ss_dssp             EEEEEESCHHHHHHHHHHHHHHTCGGGEEEEESCHHHHHHHHHTSSSCCCEEEEEECSCGGGHHHHHHHHH
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCCCCEEEEECCHHHHHHHHHHCCCCCCCEEEEEECCHHHHHHHHHHHH
T ss_conf             89999767414899999999869986289996258999999973256776018996088888999999999


No 176
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, protein structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12}
Probab=37.49  E-value=20  Score=15.64  Aligned_cols=88  Identities=15%  Similarity=0.166  Sum_probs=50.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCH--HHHHHHHHHCCCCCEEEECCCCCCC---CHHHHHHHHCCCCCCCEE
Q ss_conf             79997399899999999999889899999997--9999999717999489970789987---738999961434889739
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSV--CEAREFCEKELLPNYLVIDESMEGV---LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g--~eAl~~~~~~~~pdlii~D~~mP~~---~~l~~~ir~~~~~~~~pi   77 (133)
                      .+.+||.|+.....+    ...|+.+.. .++  .+.|+.+.-+. .+.+++-  +|+-   .-.+..+|..  .+++++
T Consensus        32 ~vvvId~d~~~~~~~----~~~g~~~i~-GD~~~~~~L~~a~i~~-a~~vi~~--~~~d~~n~~~~~~~r~l--~p~~~i  101 (140)
T 3fwz_A           32 PLVVIETSRTRVDEL----RERGVRAVL-GNAANEEIMQLAHLEC-AKWLILT--IPNGYEAGEIVASARAK--NPDIEI  101 (140)
T ss_dssp             CEEEEESCHHHHHHH----HHTTCEEEE-SCTTSHHHHHHTTGGG-CSEEEEC--CSCHHHHHHHHHHHHHH--CSSSEE
T ss_pred             CEEEEECCCHHHHHH----HHCCCEEEE-CCCCCHHHHHHHCHHH-HCEEEEC--CCCHHHHHHHHHHHHHH--CCCCEE
T ss_conf             789998880775015----653965885-1589999999727445-1899998--79889999999999997--899849


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             9996389989999999769988997
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                      +.-+  .+.+......++|++..+.
T Consensus       102 iar~--~~~~~~~~l~~~G~~~vi~  124 (140)
T 3fwz_A          102 IARA--HYDDEVAYITERGANQVVM  124 (140)
T ss_dssp             EEEE--SSHHHHHHHHHTTCSEEEE
T ss_pred             EEEE--CCHHHHHHHHHCCCCEEEC
T ss_conf             9998--7999999999779899998


No 177
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; 15025322, structural genomics, JCSG, protein structure initiative, PSI; HET: NAI UNL; 2.05A {Clostridium acetobutylicum atcc 824} SCOP: c.2.1.2
Probab=37.33  E-value=20  Score=15.62  Aligned_cols=56  Identities=13%  Similarity=0.065  Sum_probs=37.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCH------HHHHHHHHHCCCCCEEEECCCCC
Q ss_conf             9779997399899999999999889899999997------99999997179994899707899
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSV------CEAREFCEKELLPNYLVIDESME   57 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g------~eAl~~~~~~~~pdlii~D~~mP   57 (133)
                      || |||.=-+=.....+...|...|++|....-.      .+.++.+.....||.|+--...+
T Consensus        13 MK-ILItGatGfIG~~lv~~L~~~g~~V~~~~r~~~dl~~~~~v~~~~~~~~~d~vi~~a~~~   74 (292)
T 1vl0_A           13 MK-ILITGANGQLGREIQKQLKGKNVEVIPTDVQDLDITNVLAVNKFFNEKKPNVVINCAAHT   74 (292)
T ss_dssp             EE-EEEESTTSHHHHHHHHHHTTSSEEEEEECTTTCCTTCHHHHHHHHHHHCCSEEEECCCCC
T ss_pred             CE-EEEECCCCHHHHHHHHHHHHCCCEEEEEECHHCCCCCHHHHHHHHHHCCCCEEEECCCCC
T ss_conf             75-899899988999999999868798999323125778999999999864997999886335


No 178
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A*
Probab=36.96  E-value=17  Score=16.12  Aligned_cols=32  Identities=6%  Similarity=-0.006  Sum_probs=25.1

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEEC
Q ss_conf             97799973998999999999998898999999
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEAT   32 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~   32 (133)
                      ||||+|.=-+-.+...+.+.|-..|++|....
T Consensus         3 ~kkIlV~GatG~iG~~l~~~ll~~g~~V~~~~   34 (206)
T 1hdo_A            3 VKKIAIFGATGQTGLTTLAQAVQAGYEVTVLV   34 (206)
T ss_dssp             CCEEEEESTTSHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEE
T ss_conf             88899999986899999999997869899998


No 179
>1ws6_A Methyltransferase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.50A {Thermus thermophilus HB8} SCOP: c.66.1.46
Probab=36.84  E-value=21  Score=15.57  Aligned_cols=51  Identities=10%  Similarity=-0.068  Sum_probs=33.3

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEE-EECCHHHHHHHHH-HCCCCCEEEEC
Q ss_conf             799973998999999999998898999-9999799999997-17999489970
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCE-KELLPNYLVID   53 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~-~~~~pdlii~D   53 (133)
                      ++..||-|+...+.+++-++..|++.. ...++...+.... ....+|+|++|
T Consensus        65 ~vv~vD~~~~ai~~~~~N~~~~g~~~~v~~~~~d~~~~~~~~~~~~fDlI~~D  117 (171)
T 1ws6_A           65 EAVLVEKDPEAVRLLKENVRRTGLGARVVALPVEVFLPEAKAQGERFTVAFMA  117 (171)
T ss_dssp             EEEEECCCHHHHHHHHHHHHHHTCCCEEECSCHHHHHHHHHHTTCCEEEEEEC
T ss_pred             CCCCEECCHHHHHHHHHHHHHCCCCCEEEEEEHHHHHHHHHHCCCCEEEEEEC
T ss_conf             53006068789999998788606655599977898755555338855799987


No 180
>1t5b_A Acyl carrier protein phosphodiesterase; structural genomics, FMN, alpha/beta/alpha sandwich, PSI, protein structure initiative; HET: FMN; 1.40A {Salmonella typhimurium} SCOP: c.23.5.3 PDB: 1tik_A 2z98_A* 2d5i_A* 1v4b_A* 2z9b_A* 2z9c_A* 2z9d_A*
Probab=36.68  E-value=21  Score=15.56  Aligned_cols=30  Identities=13%  Similarity=0.121  Sum_probs=20.7

Q ss_pred             CCEEEEECCCH-----HHHHHHHHHHHH-----CCCEEEE
Q ss_conf             97799973998-----999999999998-----8989999
Q gi|254780892|r    1 MDSLLLVDSSH-----IVRKVGRHLFND-----FGFMVFE   30 (133)
Q Consensus         1 m~~ILiVDD~~-----~~r~~l~~~L~~-----~g~~v~~   30 (133)
                      |++||+++.++     .++.+...+++.     .|.+|..
T Consensus         1 M~kiL~i~gS~r~~~S~s~~L~~~f~~~~~~~~~~~eV~~   40 (201)
T 1t5b_A            1 MSKVLVLKSSILAGYSQSGQLTDYFIEQWREKHVADEITV   40 (201)
T ss_dssp             CCEEEEEECCSSGGGCHHHHHHHHHHHHHHHHCTTCEEEE
T ss_pred             CCEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEE
T ss_conf             9728999778999868999999999999997598998999


No 181
>3ff4_A Uncharacterized protein; structural genomics, PSI- 2, protein structure initiative, midwest center for structural genomics; 2.10A {Cytophaga hutchinsonii atcc 33406}
Probab=35.65  E-value=11  Score=17.30  Aligned_cols=96  Identities=7%  Similarity=-0.065  Sum_probs=48.6

Q ss_pred             CCEEEEECCCHH---HHHHHHHHHHHCCCEEEEECCHHHHH------HHHHHCCCCCEEEECCCCC--CCCHHHHHHHHC
Q ss_conf             977999739989---99999999998898999999979999------9997179994899707899--877389999614
Q gi|254780892|r    1 MDSLLLVDSSHI---VRKVGRHLFNDFGFMVFEATSVCEAR------EFCEKELLPNYLVIDESME--GVLEFIAHVRQM   69 (133)
Q Consensus         1 m~~ILiVDD~~~---~r~~l~~~L~~~g~~v~~a~~g~eAl------~~~~~~~~pdlii~D~~mP--~~~~l~~~ir~~   69 (133)
                      ||++.||=-++.   ....+-+.|...||+++-..--.+-+      .-+.....||+++  +-.|  ...++++++.+.
T Consensus         4 ~K~iaVvGaS~~~~k~g~~v~~~L~~~G~~V~pVnP~~~~I~G~~~~~sl~~p~~iD~v~--i~~p~~~~~~~v~e~~~~   81 (122)
T 3ff4_A            4 MKKTLILGATPETNRYAYLAAERLKSHGHEFIPVGRKKGEVLGKTIINERPVIEGVDTVT--LYINPQNQLSEYNYILSL   81 (122)
T ss_dssp             CCCEEEETCCSCTTSHHHHHHHHHHHHTCCEEEESSSCSEETTEECBCSCCCCTTCCEEE--ECSCHHHHGGGHHHHHHH
T ss_pred             CCEEEEEEECCCCCCHHHHHHHHHHHCCCEEEEECCCCCCCCEEEEEECCCCCCCCCEEE--EEECHHHHHHHHHHHHHC
T ss_conf             664999966699998299999999978998999888776100058997455678875799--995889989999999853


Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             348897399996389989999999769988997
Q gi|254780892|r   70 PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        70 ~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                        ... -+++-+|-.+.+....|.++|.. ++.
T Consensus        82 --g~k-~vw~q~G~~~e~~~~~a~~~Gi~-vi~  110 (122)
T 3ff4_A           82 --KPK-RVIFNPGTENEELEEILSENGIE-PVI  110 (122)
T ss_dssp             --CCS-EEEECTTCCCHHHHHHHHHTTCE-EEE
T ss_pred             --CCC-EEEEECCCCCHHHHHHHHHCCCE-EEC
T ss_conf             --999-99993698799999999996997-995


No 182
>3iv3_A Tagatose 1,6-diphosphate aldolase 2; TIM barrel, phosphate binding, tagatose-bisphosphate aldolase, D-tagatose-1,6-bisphosphate aldolase; HET: MSE; 1.80A {Streptococcus mutans} PDB: 3mhf_A 3mhg_A 3jrk_A 3kao_A*
Probab=35.54  E-value=22  Score=15.45  Aligned_cols=66  Identities=24%  Similarity=0.221  Sum_probs=42.5

Q ss_pred             HHHHHHH-CCCCCEEEECCCCC-----C---C------CHHHHHHHHCCCCCCCEEEEEECCCCHHHHH----HHHHCCC
Q ss_conf             9999971-79994899707899-----8---7------7389999614348897399996389989999----9997699
Q gi|254780892|r   37 AREFCEK-ELLPNYLVIDESME-----G---V------LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMI----AGARAGA   97 (133)
Q Consensus        37 Al~~~~~-~~~pdlii~D~~mP-----~---~------~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~----~a~~~Ga   97 (133)
                      |+..+.. +.-||++=+.+--.     +   +      .+.....+.......+|+|++++....+...    .|+++|+
T Consensus       193 a~~~~~~~e~g~Di~K~e~p~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~P~VvLg~G~~~e~f~~~l~~A~~aGa  272 (332)
T 3iv3_A          193 AMKVFSAERFGIDVLKVEVPVNMVYVEGFAEGEVVYSKEEAAQAFREQEASTDLPYIYLSAGVSAELFQETLVFAHKAGA  272 (332)
T ss_dssp             HHHHHTSGGGCCSEEEECCSSCGGGBTTTCSSCCCBCHHHHHHHHHHHHHTCSSCEEEECTTCCHHHHHHHHHHHHHHTC
T ss_pred             HHHHHHHCCCCCCEEEECCCCCHHHHHHCCCCCCCCCHHHHHHHHHHHHCCCCCCEEEECCCCCHHHHHHHHHHHHHHCC
T ss_conf             99999846769988981289877665302321000247999999999751479838998399898999999999998299


Q ss_pred             --CEEEE
Q ss_conf             --88997
Q gi|254780892|r   98 --NSFLL  102 (133)
Q Consensus        98 --~~yl~  102 (133)
                        .+|+.
T Consensus       273 ~~sGf~~  279 (332)
T 3iv3_A          273 KFNGVLC  279 (332)
T ss_dssp             CCCEEEE
T ss_pred             CCEEEEE
T ss_conf             9638983


No 183
>3k1z_A Haloacid dehalogenase-like hydrolase domain- containing protein 3; HDHD3, structural genomics, structural genomics consortium, SGC; 1.55A {Homo sapiens}
Probab=34.71  E-value=22  Score=15.37  Aligned_cols=21  Identities=19%  Similarity=0.184  Sum_probs=12.1

Q ss_pred             CCCCHHHHHHHHHCCCCEEEE
Q ss_conf             389989999999769988997
Q gi|254780892|r   82 MEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        82 ~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                      |.+-..+..-|.++|...++.
T Consensus       185 GD~~~~Di~~A~~aG~~tv~v  205 (263)
T 3k1z_A          185 GDNYLCDYQGPRAVGMHSFLV  205 (263)
T ss_dssp             ESCHHHHTHHHHTTTCEEEEE
T ss_pred             EECCHHHHHHHHHCCCEEEEE
T ss_conf             958788899999819989998


No 184
>1u0t_A Inorganic polyphosphate/ATP-NAD kinase; alpha-beta, beta sandwich, structural genomics, PSI, protein structure initiative; 2.30A {Mycobacterium tuberculosis} SCOP: e.52.1.1 PDB: 1u0r_A 1y3i_A* 1y3h_A
Probab=34.43  E-value=23  Score=15.34  Aligned_cols=103  Identities=13%  Similarity=0.057  Sum_probs=53.1

Q ss_pred             CEEEEEC-----CCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHH--------CCCCCEEEEC--------CCCC-CC
Q ss_conf             7799973-----99899999999999889899999997999999971--------7999489970--------7899-87
Q gi|254780892|r    2 DSLLLVD-----SSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--------ELLPNYLVID--------ESME-GV   59 (133)
Q Consensus         2 ~~ILiVD-----D~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~--------~~~pdlii~D--------~~mP-~~   59 (133)
                      +||+||=     .-......+.+.|...|+++....+..........        ....+.+-.+        +-.- ||
T Consensus         5 r~v~lv~~~~k~~a~~~a~~~~~~L~~~g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DlvivlGG   84 (307)
T 1u0t_A            5 RSVLLVVHTGRDEATETARRVEKVLGDNKIALRVLSAEAVDRGSLHLAPDDMRAMGVEIEVVDADQHAADGCELVLVLGG   84 (307)
T ss_dssp             CEEEEEESSSGGGGSHHHHHHHHHHHTTTCEEEEEC-----------------------------------CCCEEEEEC
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEEEECHHHHCCCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCEEEEECC
T ss_conf             89999980999899999999999999789989998431331465446741122037532102465344456458999768


Q ss_pred             CHH-HHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             738-999961434889739999638998999999976998899769898999999999999
Q gi|254780892|r   60 LEF-IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        60 ~~l-~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      +|. ++..|.. ...++||+-+..             |-.+|+.- ++++++...+.+++.
T Consensus        85 DGT~L~aa~~~-~~~~~PilGIN~-------------G~lGFL~~-~~~~~~~~~l~~~~~  130 (307)
T 1u0t_A           85 DGTFLRAAELA-RNASIPVLGVNL-------------GRIGFLAE-AEAEAIDAVLEHVVA  130 (307)
T ss_dssp             HHHHHHHHHHH-HHHTCCEEEEEC-------------SSCCSSCS-EEGGGHHHHHHHHHH
T ss_pred             CHHHHHHHHHH-CCCCCEEEEECC-------------CCCCEEEC-CCHHHHHHHHHHHHH
T ss_conf             77899999974-646983999758-------------97217303-650558999999871


No 185
>1wa3_A 2-keto-3-deoxy-6-phosphogluconate aldolase; KDPG, pyruvate, lyase; 1.9A {Thermotoga maritima} SCOP: c.1.10.1 PDB: 1vlw_A
Probab=34.39  E-value=23  Score=15.34  Aligned_cols=23  Identities=17%  Similarity=-0.021  Sum_probs=11.3

Q ss_pred             CCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             39989999999999988989999
Q gi|254780892|r    8 DSSHIVRKVGRHLFNDFGFMVFE   30 (133)
Q Consensus         8 DD~~~~r~~l~~~L~~~g~~v~~   30 (133)
                      -++.....-+.+.|-..|+.+.+
T Consensus        18 ~~~~~~a~~~~~al~~~Gi~~iE   40 (205)
T 1wa3_A           18 ANSVEEAKEKALAVFEGGVHLIE   40 (205)
T ss_dssp             CSSHHHHHHHHHHHHHTTCCEEE
T ss_pred             CCCHHHHHHHHHHHHHCCCCEEE
T ss_conf             98999999999999987998899


No 186
>3o9z_A Lipopolysaccaride biosynthesis protein WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD AKG; 1.45A {Thermus thermophilus} PDB: 3oa0_A*
Probab=34.35  E-value=23  Score=15.33  Aligned_cols=106  Identities=13%  Similarity=0.198  Sum_probs=48.8

Q ss_pred             CCEEEEEC-CCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCC-HHHHHHHHCCCCCCCEEE
Q ss_conf             97799973-9989999999999988989999999799999997179994899707899877-389999614348897399
Q gi|254780892|r    1 MDSLLLVD-SSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-EFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVD-D~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~-~l~~~ir~~~~~~~~pii   78 (133)
                      |+|+.||= --..-...++. +...+.....+.+..+..........-.-.+.+   |..+ .+...+..  ..+++-+|
T Consensus         3 m~r~~iIG~~G~i~~~h~~a-l~~~~~~~v~~~d~~~~~~~~~~~~~~a~~~~~---~~~~~~~~~~~~~--~~~~iD~V   76 (312)
T 3o9z_A            3 MTRFALTGLAGYIAPRHLKA-IKEVGGVLVASLDPATNVGLVDSFFPEAEFFTE---PEAFEAYLEDLRD--RGEGVDYL   76 (312)
T ss_dssp             CCEEEEECTTSSSHHHHHHH-HHHTTCEEEEEECSSCCCGGGGGTCTTCEEESC---HHHHHHHHHHHHH--TTCCCSEE
T ss_pred             CEEEEEECCCCHHHHHHHHH-HHHCCCCEEEEECCHHHHHHHHHCHHHHHHHCC---CCCCCHHHHHHHH--CCCCCEEE
T ss_conf             53999998898999999999-970899589998670356675515888987144---2351418898750--27996599


Q ss_pred             EEECCCC--HHHHHHHHHCCCCEEEECCCC--HHHHHH
Q ss_conf             9963899--899999997699889976989--899999
Q gi|254780892|r   79 YLLMEVD--FEKMIAGARAGANSFLLKPFN--RETLRF  112 (133)
Q Consensus        79 ~lT~~~~--~~~~~~a~~~Ga~~yl~KP~~--~~~L~~  112 (133)
                      ++++.+.  .+...+|+++|-.=|+.||+.  .++...
T Consensus        77 ~I~tp~~~H~~~~~~al~~gk~Vl~EKP~a~~~~e~~~  114 (312)
T 3o9z_A           77 SIASPNHLHYPQIRMALRLGANALSEKPLVLWPEEIAR  114 (312)
T ss_dssp             EECSCGGGHHHHHHHHHHTTCEEEECSSSCSCHHHHHH
T ss_pred             EECCCCHHHHHHHHHHHHCCCCEEEECCCCCCHHHHHH
T ss_conf             99899578999999999719948980487587778778


No 187
>1wv9_A Rhodanese homolog TT1651; CDC25, phosphatase, sulfurtransferase, structural genomics, NPPSFA; 2.00A {Thermus thermophilus}
Probab=33.97  E-value=17  Score=16.06  Aligned_cols=66  Identities=11%  Similarity=0.033  Sum_probs=30.8

Q ss_pred             CHHHHHHHHHHCCCCCEEEECCCCCC---------C--CHHHHHHH-HCCCCCCCEEEEEECCCCHHH--HHHHHHCCCC
Q ss_conf             97999999971799948997078998---------7--73899996-143488973999963899899--9999976998
Q gi|254780892|r   33 SVCEAREFCEKELLPNYLVIDESMEG---------V--LEFIAHVR-QMPLGTDVFVYYLLMEVDFEK--MIAGARAGAN   98 (133)
Q Consensus        33 ~g~eAl~~~~~~~~pdlii~D~~mP~---------~--~~l~~~ir-~~~~~~~~pii~lT~~~~~~~--~~~a~~~Ga~   98 (133)
                      +.++.-+++.+    +.+|+|+.-|.         .  .. ...+. .....++-|||+.-..+....  .....+.|.+
T Consensus         5 ~p~el~~~l~~----~~~liDvR~~~e~~~ghi~ga~~ip-~~~l~~~~~~~~~~~iv~~C~~g~rs~~aa~~L~~~G~~   79 (94)
T 1wv9_A            5 RPEELPALLEE----GVLVVDVRPADRRSTPLPFAAEWVP-LEKIQKGEHGLPRRPLLLVCEKGLLSQVAALYLEAEGYE   79 (94)
T ss_dssp             CGGGHHHHHHT----TCEEEECCCC--CCSCCSSCCEECC-HHHHTTTCCCCCSSCEEEECSSSHHHHHHHHHHHHHTCC
T ss_pred             CHHHHHHHHHC----CCEEEECCCHHHHHCCCCCCCCCCC-CHHHHHHHHHHCCCCEEEECCCCCCHHHHHHHHHHCCCC
T ss_conf             99999999859----9889979238996638616743176-020677754403444367779982499999999986993


Q ss_pred             EEEEC
Q ss_conf             89976
Q gi|254780892|r   99 SFLLK  103 (133)
Q Consensus        99 ~yl~K  103 (133)
                      -|..+
T Consensus        80 ~~~l~   84 (94)
T 1wv9_A           80 AMSLE   84 (94)
T ss_dssp             EEEET
T ss_pred             EEEEC
T ss_conf             99954


No 188
>3oa2_A WBPB; oxidoreductase, sugar biosynthesis, dehydrogenase; HET: NAD; 1.50A {Pseudomonas aeruginosa}
Probab=33.96  E-value=23  Score=15.30  Aligned_cols=102  Identities=17%  Similarity=0.228  Sum_probs=49.7

Q ss_pred             CCEEEEECC-CHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCE-EEECCCCCCCCHHHHHHHHCCCCCCCEEE
Q ss_conf             977999739-9899999999999889899999997999999971799948-99707899877389999614348897399
Q gi|254780892|r    1 MDSLLLVDS-SHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY-LVIDESMEGVLEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD-~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdl-ii~D~~mP~~~~l~~~ir~~~~~~~~pii   78 (133)
                      |||+.|+=- -..-+..+. .++..|.....+.+..+......... +.. ...+  .|.........+ .....++-+|
T Consensus         3 Mk~~~iIG~~G~ig~~H~~-a~~~~~~~~v~~~d~~~~~~~~~~~~-~~~~~~~~--~~~~~~~~~~~~-~~~~~~iD~V   77 (318)
T 3oa2_A            3 MKNFALIGAAGYIAPRHMR-AIKDTGNCLVSAYDINDSVGIIDSIS-PQSEFFTE--FEFFLDHASNLK-RDSATALDYV   77 (318)
T ss_dssp             CCEEEEETTTSSSHHHHHH-HHHHTTCEEEEEECSSCCCGGGGGTC-TTCEEESS--HHHHHHHHHHHT-TSTTTSCCEE
T ss_pred             CCEEEEECCCCHHHHHHHH-HHHHCCCCEEEEEECCHHHHHHHCCC-HHHHHHHH--CCCCHHHHHHHH-HHCCCCCCEE
T ss_conf             3199999699889999999-99728994899994866776663150-66776322--034000440887-7158996099


Q ss_pred             EEECCCC--HHHHHHHHHCCCCEEEECCCCH
Q ss_conf             9963899--8999999976998899769898
Q gi|254780892|r   79 YLLMEVD--FEKMIAGARAGANSFLLKPFNR  107 (133)
Q Consensus        79 ~lT~~~~--~~~~~~a~~~Ga~~yl~KP~~~  107 (133)
                      ++++...  .+....|+++|-.=|+.||+..
T Consensus        78 ~I~tp~~~H~~~~~~al~~gk~v~~EKPla~  108 (318)
T 3oa2_A           78 SICSPNYLHYPHIAAGLRLGCDVICEKPLVP  108 (318)
T ss_dssp             EECSCGGGHHHHHHHHHHTTCEEEECSSCCS
T ss_pred             EECCCHHHHHHHHHHHHHCCCEEEEECCCCC
T ss_conf             9859849999999999975991999457734


No 189
>2bdq_A Copper homeostasis protein CUTC; alpha beta protein, structural genomics, PSI, protein structure initiative; 2.30A {Streptococcus agalactiae}
Probab=33.74  E-value=23  Score=15.27  Aligned_cols=74  Identities=12%  Similarity=0.098  Sum_probs=36.6

Q ss_pred             EECCHHHHHHHHHHCCCCCEEEECCCCCCC----CHHHHHHHHCCCCCCCEEEEEE-CCC------C------HHHHHHH
Q ss_conf             999979999999717999489970789987----7389999614348897399996-389------9------8999999
Q gi|254780892|r   30 EATSVCEAREFCEKELLPNYLVIDESMEGV----LEFIAHVRQMPLGTDVFVYYLL-MEV------D------FEKMIAG   92 (133)
Q Consensus        30 ~a~~g~eAl~~~~~~~~pdlii~D~~mP~~----~~l~~~ir~~~~~~~~pii~lT-~~~------~------~~~~~~a   92 (133)
                      ++.|.++|....+.+.. .+=|+.-..-||    .++++.+++.-....+||.+|- ..+      .      .++...+
T Consensus         7 cv~~~~~~~~A~~~Gad-RiELc~~l~~GGlTPs~~~i~~~~~~~~~~~ipV~vMIRPr~g~F~y~~~e~~~m~~dI~~~   85 (224)
T 2bdq_A            7 CAENLTDLTRLDKAIIS-RVELCDNLAVGGTTPSYGVIKEANQYLHEKGISVAVMIRPRGGNFVYNDLELRIMEEDILRA   85 (224)
T ss_dssp             EEETTTTGGGCCTTTCC-EEEEEBCGGGTCBCCCHHHHHHHHHHHHHTTCEEEEECCSSSSCSCCCHHHHHHHHHHHHHH
T ss_pred             EECCHHHHHHHHHCCCC-EEEECCCCCCCCCCCCHHHHHHHHHHHCCCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             96999999999983999-89984765668979999999999986033799869996138998676889999999999999


Q ss_pred             HHCCCCEEEECC
Q ss_conf             976998899769
Q gi|254780892|r   93 ARAGANSFLLKP  104 (133)
Q Consensus        93 ~~~Ga~~yl~KP  104 (133)
                      .++||+.+..-.
T Consensus        86 ~~~GadgiVfG~   97 (224)
T 2bdq_A           86 VELESDALVLGI   97 (224)
T ss_dssp             HHTTCSEEEECC
T ss_pred             HHHCCCCEEEEE
T ss_conf             981998027987


No 190
>1y0b_A Xanthine phosphoribosyltransferase; purine metabolism, structural genomics, PSI, protein structure initative; HET: G4P; 1.80A {Bacillus subtilis} SCOP: c.61.1.1 PDB: 2fxv_A*
Probab=33.65  E-value=23  Score=15.26  Aligned_cols=11  Identities=18%  Similarity=0.036  Sum_probs=3.7

Q ss_pred             CCCEE-EEECCH
Q ss_conf             89899-999997
Q gi|254780892|r   24 FGFMV-FEATSV   34 (133)
Q Consensus        24 ~g~~v-~~a~~g   34 (133)
                      .++.+ .....+
T Consensus        52 ~~~d~Ivg~~~~   63 (197)
T 1y0b_A           52 DGITKIVTIESS   63 (197)
T ss_dssp             TTCCEEEEETTT
T ss_pred             CCCCEEEEECCC
T ss_conf             999899986621


No 191
>1qv9_A F420-dependent methylenetetrahydromethanopterin dehydrogenase; monomer: alpha/beta domain, helix bundle, trimer of dimers, oxidoreductase; HET: MSE; 1.54A {Methanopyrus kandleri} SCOP: c.127.1.1 PDB: 1u6i_A 1u6j_A 1u6k_A* 3iqe_A* 3iqf_A* 3iqz_A*
Probab=33.43  E-value=23  Score=15.24  Aligned_cols=80  Identities=8%  Similarity=0.026  Sum_probs=50.2

Q ss_pred             HCCCEEEEECCHH-----HH-------HHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEEECCCCHHHH
Q ss_conf             8898999999979-----99-------9999717999489970789987-738999961434889739999638998999
Q gi|254780892|r   23 DFGFMVFEATSVC-----EA-------REFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYLLMEVDFEKM   89 (133)
Q Consensus        23 ~~g~~v~~a~~g~-----eA-------l~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~lT~~~~~~~~   89 (133)
                      +.+..+..+.+|.     ++       +.++. ...||.++.  .-||. .-.=+..|..-...++|.|++|-..... .
T Consensus        30 RedI~vrv~gsGaKm~pe~~e~~~~~~~~~~~-~~~pDf~I~--isPN~~~PGP~~ARE~l~~~~iP~IvI~D~p~~K-~  105 (283)
T 1qv9_A           30 REDVEFRVVGTSVKMDPECVEAAVEMALDIAE-DFEPDFIVY--GGPNPAAPGPSKAREMLADSEYPAVIIGDAPGLK-V  105 (283)
T ss_dssp             CSSEEEEEEECTTCCSHHHHHHHHHHHHHHHH-HHCCSEEEE--ECSCTTSHHHHHHHHHHHTSSSCEEEEEEGGGGG-G
T ss_pred             CCCCEEEEECCCCCCCHHHHHHHHHHHHHHHH-HCCCCEEEE--ECCCCCCCCCHHHHHHHHHCCCCEEEECCCCCHH-H
T ss_conf             36864999526777797899999988777887-408998999--7899889995679999974799879982786344-6


Q ss_pred             HHHHHCCCCEEEECCCC
Q ss_conf             99997699889976989
Q gi|254780892|r   90 IAGARAGANSFLLKPFN  106 (133)
Q Consensus        90 ~~a~~~Ga~~yl~KP~~  106 (133)
                      ..+++....+|+.=|.+
T Consensus       106 kd~l~~~g~GYIivk~D  122 (283)
T 1qv9_A          106 KDEMEEQGLGYILVKPD  122 (283)
T ss_dssp             HHHHHHTTCEEEEETTS
T ss_pred             HHHHHHCCCCEEEEECC
T ss_conf             89998659847998367


No 192
>1xj5_A Spermidine synthase 1; structural genomics, protein structure initiative, CESG, AT1G23820, putrescine aminopropyl transferase, SPDS1; 2.70A {Arabidopsis thaliana} SCOP: c.66.1.17 PDB: 2q41_A
Probab=33.07  E-value=24  Score=15.21  Aligned_cols=67  Identities=13%  Similarity=0.181  Sum_probs=47.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHC--CC----EEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-------CHHHHHHHH
Q ss_conf             77999739989999999999988--98----999999979999999717999489970789987-------738999961
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDF--GF----MVFEATSVCEAREFCEKELLPNYLVIDESMEGV-------LEFIAHVRQ   68 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~--g~----~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-------~~l~~~ir~   68 (133)
                      .+|-+||=|+.+-+..++.+...  ++    -.....+|.+-+....+ ..+|+||+|..=|.+       .++.+.+++
T Consensus       145 ~~v~~VEID~~Vi~~a~~~fp~~~~~~~dprv~iii~Dg~~~l~~~~~-~~yDvIIvD~~dp~~~~~~L~t~eFy~~~~~  223 (334)
T 1xj5_A          145 EQIDMCEIDKMVVDVSKQFFPDVAIGYEDPRVNLVIGDGVAFLKNAAE-GSYDAVIVDSSDPIGPAKELFEKPFFQSVAR  223 (334)
T ss_dssp             CEEEEEESCHHHHHHHHHHCHHHHGGGGSTTEEEEESCHHHHHHTSCT-TCEEEEEECCCCTTSGGGGGGSHHHHHHHHH
T ss_pred             CCCEEECCCHHHHHHHHHHHHHHCCCCCCCCEEEEECCHHHHHHHCCC-CCCCEEEEECCCCCCCCHHHCCHHHHHHHHH
T ss_conf             533575058999999997534430235799879998627999751533-5667799978998873143368999999997


Q ss_pred             C
Q ss_conf             4
Q gi|254780892|r   69 M   69 (133)
Q Consensus        69 ~   69 (133)
                      .
T Consensus       224 ~  224 (334)
T 1xj5_A          224 A  224 (334)
T ss_dssp             H
T ss_pred             H
T ss_conf             5


No 193
>3dez_A OPRT, oprtase, orotate phosphoribosyltransferase; glycosyltransferase, MAGN pyrimidine biosynthesis; 2.40A {Streptococcus mutans}
Probab=32.72  E-value=16  Score=16.32  Aligned_cols=65  Identities=12%  Similarity=0.004  Sum_probs=26.6

Q ss_pred             EEEEC-CCCCCC--CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHH
Q ss_conf             89970-789987--738999961434889739999638998999999976998899769898999999999
Q gi|254780892|r   49 YLVID-ESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE  116 (133)
Q Consensus        49 lii~D-~~mP~~--~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~  116 (133)
                      ++++| +.--|+  .+.+..+|+. ...-+-++++-.+....-....-+.|.. +. --++.++|.+.+.+
T Consensus       152 VlIVEDViTTGgSileai~~l~~~-G~~V~~v~vivDR~~~g~~~~l~~~Gv~-~~-sL~t~~dll~~l~~  219 (243)
T 3dez_A          152 MVIIEDLISTGGSVLDAVAAAQRE-GADVLGVVAIFTYELPKATANFEKASVK-LV-TLSNYSELIKVAKV  219 (243)
T ss_dssp             EEEEEEEESSSHHHHHHHHHHHHT-TCEEEEEEEEEECCCHHHHHHHHHHTCC-EE-ESSCHHHHHHHHHH
T ss_pred             EEEEEEEECCCCCHHHHHHHHHHC-CCEEEEEEEEEECCCCHHHHHHHHCCCC-EE-EECCHHHHHHHHHH
T ss_conf             999851145674458999999987-9979999999988862179999966997-99-94859999999998


No 194
>3l0g_A Nicotinate-nucleotide pyrophosphorylase; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ALS collaborative crystallography; 2.05A {Ehrlichia chaffeensis}
Probab=32.56  E-value=24  Score=15.16  Aligned_cols=65  Identities=12%  Similarity=0.102  Sum_probs=42.1

Q ss_pred             EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEE
Q ss_conf             99999979999999717999489970789987-73899996143488973999963899899999997699889
Q gi|254780892|r   28 VFEATSVCEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF  100 (133)
Q Consensus        28 v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~y  100 (133)
                      ..++.+-+++.+.+..  -+|.|++|-.-|.. -+..+.++     +.+ .+..||.-+.+...+..+.|++-+
T Consensus       211 eVEv~~~~~~~~a~~~--gad~ImLDn~~~~~~~~~v~~i~-----~~v-~ieaSGGI~~~ni~~yA~~GVD~I  276 (300)
T 3l0g_A          211 AIECDNISQVEESLSN--NVDMILLDNMSISEIKKAVDIVN-----GKS-VLEVSGCVNIRNVRNIALTGVDYI  276 (300)
T ss_dssp             EEEESSHHHHHHHHHT--TCSEEEEESCCHHHHHHHHHHHT-----TSS-EEEEESSCCTTTHHHHHTTTCSEE
T ss_pred             EEEECCHHHHHHHHHC--CCEEEECCCCCHHHHHHHHHHHC-----CCE-EEEEECCCCHHHHHHHHHCCCCEE
T ss_conf             9993769998876414--86488608999899999999857-----967-999979999999999997599999


No 195
>3dqq_A Putative tRNA synthase; structural genomics, csgid, unknown function, center for structural genomics of infectious diseases; 2.70A {Salmonella typhimurium}
Probab=32.53  E-value=24  Score=15.15  Aligned_cols=30  Identities=7%  Similarity=0.010  Sum_probs=14.9

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             977999739989999999999988989999
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFE   30 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~   30 (133)
                      |.||+|+.||.+=..-.-..|...|+++..
T Consensus         2 M~ki~iiADDlTGA~dt~~~~~~~G~~t~v   31 (421)
T 3dqq_A            2 MLKIGVIADDFTGATDIASFLVENGMPTVQ   31 (421)
T ss_dssp             CCCEEEEESSHHHHHHHHHHHHHTTCCEEE
T ss_pred             CEEEEEEECCCCCHHHHHHHHHHCCCEEEE
T ss_conf             718999933852189999999987983999


No 196
>3jr2_A Hexulose-6-phosphate synthase SGBH; 3-keto-L-gulonate-6-phosphate decarboxylase, ULAD, niaid, csgid, Mg-bound, biosynthetic protein; HET: MSE; 1.80A {Vibrio cholerae} PDB: 3ieb_A*
Probab=32.34  E-value=24  Score=15.13  Aligned_cols=22  Identities=9%  Similarity=-0.014  Sum_probs=9.6

Q ss_pred             ECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             6389989999999769988997
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                      ++.-+.+...++.+.||+-++.
T Consensus       172 ~gGi~~~~~~~~~~~GaD~iVv  193 (218)
T 3jr2_A          172 TGGIVPEDIYLFEGIKTKTFIA  193 (218)
T ss_dssp             ESSCCGGGGGGGTTSCEEEEEE
T ss_pred             CCCCCCCCHHHHHHCCCCEEEE
T ss_conf             7996825799999849999998


No 197
>1qpo_A Quinolinate acid phosphoribosyl transferase; type II prtase, de novo NAD biosynthesis, PRPP, quinolinic acid; 2.40A {Mycobacterium tuberculosis H37RV} SCOP: c.1.17.1 d.41.2.1 PDB: 1qpn_A 1qpq_A* 1qpr_A*
Probab=32.33  E-value=24  Score=15.13  Aligned_cols=69  Identities=10%  Similarity=0.067  Sum_probs=42.5

Q ss_pred             EEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEE
Q ss_conf             99999979999999717999489970789987-738999961434889739999638998999999976998899
Q gi|254780892|r   28 VFEATSVCEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFL  101 (133)
Q Consensus        28 v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl  101 (133)
                      ..++.+-+|+.+.+..  .+|.|.+|-.-|.. -+..+.++..  .+++ .+..||.-+.+......+.|++.+-
T Consensus       198 ~vEv~~~~e~~~a~~~--gad~imLDn~~pe~~~~~v~~~~~~--~~~v-~ieaSGGI~~~ni~~ya~~GVD~Is  267 (284)
T 1qpo_A          198 EVEVDSLEQLDAVLPE--KPELILLDNFAVWQTQTAVQRRDSR--APTV-MLESSGGLSLQTAATYAETGVDYLA  267 (284)
T ss_dssp             EEEESSHHHHHHHGGG--CCSEEEEETCCHHHHHHHHHHHHHH--CTTC-EEEEESSCCTTTHHHHHHTTCSEEE
T ss_pred             EEEECCHHHHHHHHHH--CCCEEEECCCCHHHHHHHHHHHHCC--CCCE-EEEEECCCCHHHHHHHHHCCCCEEE
T ss_conf             9998149988888751--3328995688979999999997376--9947-9999899989999999866989998


No 198
>1o57_A PUR operon repressor; purine operon repressor, helix-turn-helix domain, phosphoribosyltranseferases, domain recombination, DNA binding; HET: EPE P6G 2PE PG4 1PE; 2.20A {Bacillus subtilis} SCOP: a.4.5.40 c.61.1.1 PDB: 1p4a_A*
Probab=32.07  E-value=25  Score=15.11  Aligned_cols=16  Identities=13%  Similarity=0.239  Sum_probs=9.7

Q ss_pred             HHHHHHHHHHCCCEEE
Q ss_conf             9999999998898999
Q gi|254780892|r   14 RKVGRHLFNDFGFMVF   29 (133)
Q Consensus        14 r~~l~~~L~~~g~~v~   29 (133)
                      ..+++..|+..|+...
T Consensus        44 ~~i~~~~~~~~~~g~i   59 (291)
T 1o57_A           44 LTIIKQTFEQQGIGTL   59 (291)
T ss_dssp             HHHHHHHHHHTTSEEE
T ss_pred             HHHHHHHHHHCCCCEE
T ss_conf             9999998754488709


No 199
>2px0_A Flagellar biosynthesis protein FLHF; SRP GTPase, flagellum, protein transport, biosynthetic protein; HET: GNP; 3.00A {Bacillus subtilis} PDB: 2px3_A*
Probab=31.56  E-value=25  Score=15.06  Aligned_cols=103  Identities=9%  Similarity=-0.000  Sum_probs=59.5

Q ss_pred             EEEEECCC---HHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECC--CCCCCCHHHHHHHHCC--CCCCC
Q ss_conf             79997399---89999999999988989999999799999997179994899707--8998773899996143--48897
Q gi|254780892|r    3 SLLLVDSS---HIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE--SMEGVLEFIAHVRQMP--LGTDV   75 (133)
Q Consensus         3 ~ILiVDD~---~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~--~mP~~~~l~~~ir~~~--~~~~~   75 (133)
                      ++.+|.=|   ..-.+.++.+-+..|..+..+.+..+.-.........|+|++|-  ..|.-.+...+++...  ..+.-
T Consensus       136 ~v~lit~Dt~R~~A~eQLk~~a~~l~vp~~~~~~~~~l~~a~~~~~~~d~vlIDTaGr~~~~~~~~~eL~~~~~~~~~~~  215 (296)
T 2px0_A          136 KIAFITTDTYRIAAVEQLKTYAELLQAPLEVCYTKEEFQQAKELFSEYDHVFVDTAGRNFKDPQYIDELKETIPFESSIQ  215 (296)
T ss_dssp             CEEEEECCCSSTTHHHHHHHHHTTTTCCCCBCSSHHHHHHHHHHGGGSSEEEEECCCCCTTSHHHHHHHHHHSCCCTTEE
T ss_pred             CEEEEECCCCCHHHHHHHHHHHHHCCCCCCEEECHHHHHHHHHHHCCCCEEEEECCCCCCCCCCHHHHHHHHHHHHCCCE
T ss_conf             06999807997689999999997417985045556669999987224888999688843122217999999751316861


Q ss_pred             EEEEEECCCCHHHHHHHHH----CCCCEE-EECCCC
Q ss_conf             3999963899899999997----699889-976989
Q gi|254780892|r   76 FVYYLLMEVDFEKMIAGAR----AGANSF-LLKPFN  106 (133)
Q Consensus        76 pii~lT~~~~~~~~~~a~~----~Ga~~y-l~KP~~  106 (133)
                      .++++++....+...++..    .+.++. ++| ++
T Consensus       216 ~~LVl~a~~~~~~~~~~~~~~~~~~~~~lilTK-LD  250 (296)
T 2px0_A          216 SFLVLSATAKYEDMKHIVKRFSSVPVNQYIFTK-ID  250 (296)
T ss_dssp             EEEEEETTBCHHHHHHHTTTTSSSCCCEEEEEC-TT
T ss_pred             EEEEEECCCCCHHHHHHHHHHCCCCCCEEEEEE-EC
T ss_conf             699975787613599999996169998899981-14


No 200
>3hut_A Putative branched-chain amino acid ABC transporter; extracellular ligand-binding receptor,transport protein; 1.93A {Rhodospirillum rubrum atcc 11170}
Probab=31.48  E-value=25  Score=15.05  Aligned_cols=101  Identities=18%  Similarity=0.119  Sum_probs=61.8

Q ss_pred             CEEEE-ECCCHH---HHHHHHHHHHHCCCEEEE---E----CCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCC
Q ss_conf             77999-739989---999999999988989999---9----997999999971799948997078998773899996143
Q gi|254780892|r    2 DSLLL-VDSSHI---VRKVGRHLFNDFGFMVFE---A----TSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMP   70 (133)
Q Consensus         2 ~~ILi-VDD~~~---~r~~l~~~L~~~g~~v~~---a----~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~   70 (133)
                      +++.+ ..|+..   ....++..++..|+++..   .    .+-...++.+.+.. ||+|++-..-++...+++++++. 
T Consensus       140 k~~~i~~~~~~~g~~~~~~~~~~~~~~g~~v~~~~~~~~~~~d~~~~~~~l~~~~-~d~v~~~~~~~~~~~~~~~~~~~-  217 (358)
T 3hut_A          140 TSVAVIGVTTDWGLSSAQAFRKAFELRGGAVVVNEEVPPGNRRFDDVIDEIEDEA-PQAIYLAMAYEDAAPFLRALRAR-  217 (358)
T ss_dssp             CEEEEEEESSHHHHHHHHHHHHHHHHTTCEEEEEEEECTTCCCCHHHHHHHHHHC-CSEEEEESCHHHHHHHHHHHHHT-
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCHHHHHHHHHHCC-CCEEEEECCHHHHHHHHHHHHHC-
T ss_conf             1599960577176999999997787539879999970798646799999998569-89999967708999999999974-


Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCC
Q ss_conf             48897399996389989999999769988997698
Q gi|254780892|r   71 LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF  105 (133)
Q Consensus        71 ~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~  105 (133)
                       ..+++++..++..+.+....+...+-.-|..-|+
T Consensus       218 -g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  251 (358)
T 3hut_A          218 -GSALPVYGSSALYSPKFIDLGGPAVEGVRLATAF  251 (358)
T ss_dssp             -TCCCCEEECGGGCSHHHHHHHGGGGTTCEEEESC
T ss_pred             -CCCCCEEEECCCCCHHHHHHCCCCCCCCEEECCC
T ss_conf             -9999768641457777775224011584662135


No 201
>3e70_C DPA, signal recognition particle receptor; FTSY, SRP-GTPase, protein-targeting, transport protein; HET: GDP; 1.97A {Pyrococcus furiosus} PDB: 3dmd_B 3dm9_B*
Probab=31.01  E-value=26  Score=15.00  Aligned_cols=96  Identities=7%  Similarity=0.082  Sum_probs=58.0

Q ss_pred             CHHHHHHHHHHHHHCCCEEEEECCHH-------HHHHHHHHCCCCCEEEECC--CCCCCCHHHHHHHHC--CCCCCCEEE
Q ss_conf             98999999999998898999999979-------9999997179994899707--899877389999614--348897399
Q gi|254780892|r   10 SHIVRKVGRHLFNDFGFMVFEATSVC-------EAREFCEKELLPNYLVIDE--SMEGVLEFIAHVRQM--PLGTDVFVY   78 (133)
Q Consensus        10 ~~~~r~~l~~~L~~~g~~v~~a~~g~-------eAl~~~~~~~~pdlii~D~--~mP~~~~l~~~ir~~--~~~~~~pii   78 (133)
                      .+.-...++.+.+..|..+....++.       +|++.+..+.+ |+||+|-  .+|.-.++..+++..  ...++..++
T Consensus       169 R~aA~eQL~~~a~~~~v~~~~~~~~~d~~~v~~~a~~~a~~~~~-D~vlIDTaGR~~~~~~l~~el~~i~~~~~p~~~ll  247 (328)
T 3e70_C          169 RAGAIEQLEEHAKRIGVKVIKHSYGADPAAVAYDAIQHAKARGI-DVVLIDTAGRSETNRNLMDEMKKIARVTKPNLVIF  247 (328)
T ss_dssp             STTHHHHHHHHHHHTTCEEECCCTTCCHHHHHHHHHHHHHHHTC-SEEEEEECCSCCTTTCHHHHHHHHHHHHCCSEEEE
T ss_pred             CHHHHHHHHHHHHHHCCCEECCCCCCCHHHHHHHHHHHHHHCCC-CEEEECCCCCCCCCHHHHHHHHHHHHHCCCCEEEE
T ss_conf             50799999999887357614678999999999999999998699-98986787776130999999999997629974776


Q ss_pred             EEECCCCHHHHHHHHH----CCCCEEEECCCC
Q ss_conf             9963899899999997----699889976989
Q gi|254780892|r   79 YLLMEVDFEKMIAGAR----AGANSFLLKPFN  106 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~----~Ga~~yl~KP~~  106 (133)
                      ++++....+...++..    .|.++.+.--++
T Consensus       248 V~da~~g~~~~~~~~~f~~~~~~~g~IlTKlD  279 (328)
T 3e70_C          248 VGDALAGNAIVEQARQFNEAVKIDGIILTKLD  279 (328)
T ss_dssp             EEEGGGTTHHHHHHHHHHHHSCCCEEEEECGG
T ss_pred             ECCCCCCHHHHHHHHHHHHCCCCCEEEEEEEC
T ss_conf             23421228999999998622899869997033


No 202
>2hnk_A SAM-dependent O-methyltransferase; modified rossman fold; HET: SAH; 2.30A {Leptospira interrogans}
Probab=30.80  E-value=26  Score=14.98  Aligned_cols=64  Identities=16%  Similarity=0.212  Sum_probs=47.7

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCE---EEEECCHHHHHHHHHHC--------------CCCCEEEECCCCCCCCHHHHH
Q ss_conf             7999739989999999999988989---99999979999999717--------------999489970789987738999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFM---VFEATSVCEAREFCEKE--------------LLPNYLVIDESMEGVLEFIAH   65 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~---v~~a~~g~eAl~~~~~~--------------~~pdlii~D~~mP~~~~l~~~   65 (133)
                      +|.-+|-++......+..+...|+.   -....++.+.+..+...              ..+|+|++|-.-++-.+....
T Consensus        87 ~v~tie~~~~~~~~A~~~~~~ag~~~~I~~~~g~A~e~L~~L~~~~~~~~~~~~~~~~~~~fD~IFiDa~K~~Y~~y~~~  166 (239)
T 2hnk_A           87 KILCCDVSEEWTNVARKYWKENGLENKIFLKLGSALETLQVLIDSKSAPSWASDFAFGPSSIDLFFLDADKENYPNYYPL  166 (239)
T ss_dssp             EEEEEESCHHHHHHHHHHHHHTTCGGGEEEEESCHHHHHHHHHHCSSCCGGGTTTCCSTTCEEEEEECSCGGGHHHHHHH
T ss_pred             CEEEEECCHHHHHHHHHHHHHCCCCEEEEEEEECHHHHHHHHHHCCCCCCCCCCCCCCCCCCCEEEEECCHHHHHHHHHH
T ss_conf             68999453888999999999879962599996168999999884523332110012467775689993787775999999


Q ss_pred             H
Q ss_conf             9
Q gi|254780892|r   66 V   66 (133)
Q Consensus        66 i   66 (133)
                      +
T Consensus       167 ~  167 (239)
T 2hnk_A          167 I  167 (239)
T ss_dssp             H
T ss_pred             H
T ss_conf             9


No 203
>1qb7_A APRT, adenine phosphoribosyltransferase; dinucleotide binding fold; HET: ADE CIT; 1.50A {Leishmania donovani} SCOP: c.61.1.1 PDB: 1qb8_A* 1qcc_A* 1qcd_A 1mzv_A*
Probab=30.26  E-value=27  Score=14.92  Aligned_cols=27  Identities=19%  Similarity=0.233  Sum_probs=10.7

Q ss_pred             EEEEECCCHHH---HHHHHHHHHHCCCEEE
Q ss_conf             79997399899---9999999998898999
Q gi|254780892|r    3 SLLLVDSSHIV---RKVGRHLFNDFGFMVF   29 (133)
Q Consensus         3 ~ILiVDD~~~~---r~~l~~~L~~~g~~v~   29 (133)
                      |||||||=-.+   .....++++..|.+|.
T Consensus       140 rVlIVDDviaTGgT~~a~~~ll~~~Ga~vv  169 (236)
T 1qb7_A          140 RVVLIDDVLATGGTALSGLQLVEASDAVVV  169 (236)
T ss_dssp             EEEEEEEEESSCHHHHHHHHHHHHTTCEEE
T ss_pred             EEEEEEEEECCCHHHHHHHHHHHHCCCEEE
T ss_conf             799996016356699999999998799899


No 204
>3mjd_A Orotate phosphoribosyltransferase; IDP02311, csgid, structural genomics, center for structural genomics of infectious diseases; 1.90A {Francisella tularensis}
Probab=29.90  E-value=27  Score=14.92  Aligned_cols=21  Identities=29%  Similarity=0.499  Sum_probs=9.3

Q ss_pred             EEEECCCCC-CC--CHHHHHHHHC
Q ss_conf             899707899-87--7389999614
Q gi|254780892|r   49 YLVIDESME-GV--LEFIAHVRQM   69 (133)
Q Consensus        49 lii~D~~mP-~~--~~l~~~ir~~   69 (133)
                      ++++|=-+- |+  .+.+..+|..
T Consensus       139 VlIVDDViTTG~S~~~ai~~l~~~  162 (232)
T 3mjd_A          139 VLLIDDVMTAGTAFYESYNKLKII  162 (232)
T ss_dssp             EEEECSCCSSSHHHHHHHHHHHTT
T ss_pred             EEEEEEEECCCCCHHHHHHHHHHC
T ss_conf             589831035685789999999986


No 205
>1pv8_A Delta-aminolevulinic acid dehydratase; porphobilinogen synthase, tetrapyrrole biosynthesis, reactio intermediate, lyase; HET: PB1; 2.20A {Homo sapiens} SCOP: c.1.10.3 PDB: 1e51_A* 2z0i_A 2z1b_A
Probab=29.68  E-value=23  Score=15.29  Aligned_cols=12  Identities=42%  Similarity=0.888  Sum_probs=8.7

Q ss_pred             HHCCCCEEEECC
Q ss_conf             976998899769
Q gi|254780892|r   93 ARAGANSFLLKP  104 (133)
Q Consensus        93 ~~~Ga~~yl~KP  104 (133)
                      .+.||+-.++||
T Consensus       242 ~~EGAD~~mVKP  253 (330)
T 1pv8_A          242 VREGADMLMVKP  253 (330)
T ss_dssp             HHTTCSBEEEES
T ss_pred             HHCCCCEEEECC
T ss_conf             756987799626


No 206
>1uan_A Hypothetical protein TT1542; rossmann-like, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; 2.00A {Thermus thermophilus} SCOP: c.134.1.1
Probab=29.61  E-value=27  Score=14.86  Aligned_cols=54  Identities=19%  Similarity=-0.033  Sum_probs=31.5

Q ss_pred             CCEEEEE----CCCHHHHHHHHHHHHHCCCEE--EEECCH------------HHHHHHHHHCCCCCEEEECC
Q ss_conf             9779997----399899999999999889899--999997------------99999997179994899707
Q gi|254780892|r    1 MDSLLLV----DSSHIVRKVGRHLFNDFGFMV--FEATSV------------CEAREFCEKELLPNYLVIDE   54 (133)
Q Consensus         1 m~~ILiV----DD~~~~r~~l~~~L~~~g~~v--~~a~~g------------~eAl~~~~~~~~pdlii~D~   54 (133)
                      |.+||+|    ||...-+...-..+...|.+|  ..+.+|            .|+...+..-..-++.++|+
T Consensus         1 m~~VLvi~aHPDDe~lg~GGtiak~~~~G~~V~vv~~T~G~~g~~~~~~~R~~E~~~a~~~lG~~~~~~L~~   72 (227)
T 1uan_A            1 MLDLLVVAPHPDDGELGCGGTLARAKAEGLSTGILDLTRGEMGSKGTPEEREKEVAEASRILGLDFRGNLGF   72 (227)
T ss_dssp             CEEEEEEESSTTHHHHHHHHHHHHHHHTTCCEEEEEEECCTTTCCSCHHHHHHHHHHHHHHHTCSEEEEEEE
T ss_pred             CCEEEEEEECCCHHHHHHHHHHHHHHHCCCEEEEEEEECCCCCCCCCHHHHHHHHHHHHHHCCCCCCEEEEC
T ss_conf             970899976887478879999999998699099999738977889889999999987776415440125655


No 207
>2vpq_A Acetyl-COA carboxylase; bacteria, ATP-grAsp domain, biotin carboxylase, ligase; HET: ANP; 2.1A {Staphylococcus aureus}
Probab=29.13  E-value=28  Score=14.81  Aligned_cols=118  Identities=13%  Similarity=0.084  Sum_probs=61.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECC-----------------------------HHHHHHHHHHCCCCCEEE
Q ss_conf             977999739989999999999988989999999-----------------------------799999997179994899
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATS-----------------------------VCEAREFCEKELLPNYLV   51 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~-----------------------------g~eAl~~~~~~~~pdlii   51 (133)
                      ||||||+---..-.++++ .++.+|+++..+.+                             .+.-++.+.+ ..+|.|+
T Consensus         1 ikkiLIanrGeiA~riir-a~relGi~tVaV~s~~D~~a~~~~~ADe~~~i~~~~~~~syLd~~~Ii~ia~~-~~~DaIh   78 (451)
T 2vpq_A            1 MKKVLIANRGEIAVRIIR-ACRDLGIQTVAIYSEGDKDALHTQIADEAYCVGPTLSKDSYLNIPNILSIATS-TGCDGVH   78 (451)
T ss_dssp             -CEEEECCCHHHHHHHHH-HHHHTTCEEEEEEEGGGTTCHHHHHSSEEEEEECSSGGGTTTCHHHHHHHHHH-TTCSEEE
T ss_pred             CCEEEEECCCHHHHHHHH-HHHHCCCEEEEECCCHHHCCCCHHHCCEEEEECCCCCCCCCCCHHHHHHHHHH-HCCCEEE
T ss_conf             968999897099999999-99987995999848367468897788999981898642343689999999999-7829999


Q ss_pred             ECCCC--------------------CCC--CHHH---HHHHHCCCCCCCEEEEEE-C-CCCHHHHHHH-HHCCCCEEEEC
Q ss_conf             70789--------------------987--7389---999614348897399996-3-8998999999-97699889976
Q gi|254780892|r   52 IDESM--------------------EGV--LEFI---AHVRQMPLGTDVFVYYLL-M-EVDFEKMIAG-ARAGANSFLLK  103 (133)
Q Consensus        52 ~D~~m--------------------P~~--~~l~---~~ir~~~~~~~~pii~lT-~-~~~~~~~~~a-~~~Ga~~yl~K  103 (133)
                      --|-.                    |+.  .+..   ...|..-...++|++==+ + -.+.++..++ -+.| .-.+.|
T Consensus        79 PGyGflsEn~~fa~~~~~~gi~fIGPs~~~i~~~gdK~~ar~~a~~~gvPv~pg~~~~~~~~~ea~~~a~~IG-yPviIK  157 (451)
T 2vpq_A           79 PGYGFLAENADFAELCEACQLKFIGPSYQSIQKMGIKDVAKAEMIKANVPVVPGSDGLMKDVSEAKKIAKKIG-YPVIIK  157 (451)
T ss_dssp             CCSSTTTTCHHHHHHHHTTTCEESSSCHHHHHHHHSHHHHHHHHHHTTCCBCSBCSSCBSCHHHHHHHHHHHC-SSEEEE
T ss_pred             ECHHHHCCCHHHHHHHHHCCCEECCCCHHHHHHHHCHHHHHHHHHHCCCCCCCCCCCCCCCHHHHHHHHHHCC-CCEEEE
T ss_conf             5866634466778999975984607979999986486899999998699918997777799999999998739-969999


Q ss_pred             CCC------------HHHHHHHHHHHHHHH
Q ss_conf             989------------899999999999999
Q gi|254780892|r  104 PFN------------RETLRFAMRELPQMQ  121 (133)
Q Consensus       104 P~~------------~~~L~~~i~~~~~~~  121 (133)
                      |..            .++|..++..+....
T Consensus       158 as~ggGGrGmriV~~~~el~~a~~~a~~ea  187 (451)
T 2vpq_A          158 ATAGGGGKGIRVARDEKELETGFRMTEQEA  187 (451)
T ss_dssp             ETTCCTTCSEEEESSHHHHHHHHHHHHHHH
T ss_pred             ECCCCCCCCCEEECCCHHHHHHHHHHHHHH
T ss_conf             887899886268758245699999999999


No 208
>1q6o_A Humps, 3-keto-L-gulonate 6-phosphate decarboxylase, D-; beta barrel, lyase; HET: LG6; 1.20A {Escherichia coli} SCOP: c.1.2.3 PDB: 1kw1_A* 1q6l_A* 1kv8_A* 1q6q_A* 1q6r_A* 1xbv_A* 1so5_A* 1so4_A* 1xby_A* 1so3_A* 1so6_A* 1xbz_A* 1xbx_A*
Probab=28.76  E-value=28  Score=14.77  Aligned_cols=23  Identities=9%  Similarity=0.028  Sum_probs=11.9

Q ss_pred             EECCCCHHHHHHHHHCCCCEEEE
Q ss_conf             96389989999999769988997
Q gi|254780892|r   80 LLMEVDFEKMIAGARAGANSFLL  102 (133)
Q Consensus        80 lT~~~~~~~~~~a~~~Ga~~yl~  102 (133)
                      .++....+...++.++||+.++.
T Consensus       168 ~~gGi~~~~~~~~~~~Gad~iVV  190 (216)
T 1q6o_A          168 VTGGLALEDLPLFKGIPIHVFIA  190 (216)
T ss_dssp             EESSCCGGGGGGGTTSCCSEEEE
T ss_pred             ECCCCCCCCHHHHHHCCCCEEEE
T ss_conf             68998803699999859999998


No 209
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri}
Probab=28.59  E-value=28  Score=14.75  Aligned_cols=54  Identities=11%  Similarity=0.051  Sum_probs=34.9

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCH------H---HHHHHHHHCCCCCEEEECCC
Q ss_conf             9779997399899999999999889899999997------9---99999971799948997078
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSV------C---EAREFCEKELLPNYLVIDES   55 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g------~---eAl~~~~~~~~pdlii~D~~   55 (133)
                      |+||||+=-.=.+...+.+.|...|++|......      .   +..+.+..... .++..|+.
T Consensus         4 M~KILItGatG~iG~~l~~~L~~~G~~V~~~~R~~~~~~~~~~~~~~~~~~~~~v-~~v~~D~~   66 (321)
T 3c1o_A            4 MEKIIIYGGTGYIGKFMVRASLSFSHPTFIYARPLTPDSTPSSVQLREEFRSMGV-TIIEGEME   66 (321)
T ss_dssp             CCCEEEETTTSTTHHHHHHHHHHTTCCEEEEECCCCTTCCHHHHHHHHHHHHTTC-EEEECCTT
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCCEEEEECCCCCCCCHHHHHHHHHHCCCCE-EEEEEECC
T ss_conf             8889998998289999999999789908999899866556778887876414981-99996457


No 210
>3mbh_A Putative phosphomethylpyrimidine kinase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: MSE PXL; 2.00A {Bacteroides thetaiotaomicron} PDB: 3mbj_A*
Probab=28.38  E-value=29  Score=14.73  Aligned_cols=78  Identities=10%  Similarity=0.073  Sum_probs=44.1

Q ss_pred             CCEEEEECCCHHH----HHHHHHHHHHCCCEEEEECC-------H-------------HHHHHHHHH-CCCCCEEEECCC
Q ss_conf             9779997399899----99999999988989999999-------7-------------999999971-799948997078
Q gi|254780892|r    1 MDSLLLVDSSHIV----RKVGRHLFNDFGFMVFEATS-------V-------------CEAREFCEK-ELLPNYLVIDES   55 (133)
Q Consensus         1 m~~ILiVDD~~~~----r~~l~~~L~~~g~~v~~a~~-------g-------------~eAl~~~~~-~~~pdlii~D~~   55 (133)
                      |||||++.|....    -..--..++..|+++..+.+       |             .+.+..+.. ...+|.|.+.+.
T Consensus         7 ~k~vl~i~~~~~~G~~g~~a~i~vl~~~G~~~~~v~T~~~s~htg~~~~~~~~~~~~~~~~l~~~~~~~~~~daiktG~l   86 (291)
T 3mbh_A            7 VKKIAAVHDLSGMGRVSLTVVIPILSSMGFQVCPLPTAVLSNHTQYPGFSFLDLTDEMPKIIAEWKKLEVQFDAIYTGYL   86 (291)
T ss_dssp             CCEEEEECCEEEESSCTHHHHHHHHHHTTCEEEECCCEEEEECTTSSCCCEEECTTTHHHHHHHHHHTTCCCSEEEECCC
T ss_pred             CCEEEEEECCCCCCHHHHHHHHHHHHHCCCEEEEEEEEECCCCCCCCCEEEEECCHHHHHHHHHHHHCCCCCCEEEECCC
T ss_conf             88699993789987169999999999869815896179825789999826985969999999999956999798999998


Q ss_pred             CC-CCCHH-HHHHHHCCCCCCCEEEE
Q ss_conf             99-87738-99996143488973999
Q gi|254780892|r   56 ME-GVLEF-IAHVRQMPLGTDVFVYY   79 (133)
Q Consensus        56 mP-~~~~l-~~~ir~~~~~~~~pii~   79 (133)
                      -. ...+. ...++.. ..++.++++
T Consensus        87 ~s~~~v~~i~~~l~~~-~~~~~~vv~  111 (291)
T 3mbh_A           87 GSPRQIQIVSDFIKDF-RQPDSLIVA  111 (291)
T ss_dssp             SSTTHHHHHHHHHHHH-CCTTCEEEE
T ss_pred             CCHHHHHHHHHHHHHH-CCCCCEEEE
T ss_conf             9999999999999984-689856972


No 211
>1h7n_A 5-aminolaevulinic acid dehydratase; lyase, aldolase, TIM barrel, tetrapyrrole synthesis; HET: SHF; 1.6A {Saccharomyces cerevisiae} SCOP: c.1.10.3 PDB: 1h7p_A* 1h7r_A* 1ohl_A* 1qml_A 1qnv_A 1w31_A* 1h7o_A* 1eb3_A* 1gjp_A* 1ylv_A* 1aw5_A
Probab=28.29  E-value=23  Score=15.34  Aligned_cols=15  Identities=27%  Similarity=0.530  Sum_probs=10.5

Q ss_pred             HHHHCCCCEEEECCC
Q ss_conf             999769988997698
Q gi|254780892|r   91 AGARAGANSFLLKPF  105 (133)
Q Consensus        91 ~a~~~Ga~~yl~KP~  105 (133)
                      .-.+.||+=.++||-
T Consensus       251 ~D~~EGAD~lMVKPa  265 (342)
T 1h7n_A          251 RDMSEGADGIIVKPS  265 (342)
T ss_dssp             HHHHTTCSEEEEESS
T ss_pred             HHHHCCCCEEEECCC
T ss_conf             537609987996177


No 212
>3n2l_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, infectious diseases; 2.10A {Vibrio cholerae}
Probab=28.27  E-value=29  Score=14.72  Aligned_cols=20  Identities=15%  Similarity=0.428  Sum_probs=7.8

Q ss_pred             EEEECCCCC-CC--CHHHHHHHH
Q ss_conf             899707899-87--738999961
Q gi|254780892|r   49 YLVIDESME-GV--LEFIAHVRQ   68 (133)
Q Consensus        49 lii~D~~mP-~~--~~l~~~ir~   68 (133)
                      ++++|=-+- |+  .+.+..+|.
T Consensus       145 VlIVDDViTTG~Si~~ai~~l~~  167 (238)
T 3n2l_A          145 VMLVDDVITAGTAIRESMELIQA  167 (238)
T ss_dssp             EEEECSCCSSSHHHHHHHHHHHH
T ss_pred             EEEEEEEECCCCCHHHHHHHHHH
T ss_conf             79997651668458999999998


No 213
>3e58_A Putative beta-phosphoglucomutase; structural genomics, PSI-2, protein structure initiative; 1.86A {Streptococcus thermophilus lmg 18311}
Probab=28.25  E-value=29  Score=14.71  Aligned_cols=80  Identities=11%  Similarity=0.069  Sum_probs=30.5

Q ss_pred             HHHHCCCEEEEECCHH-HHHH-HHHH---CCCCCEEEECCCCC----CCCHHHHHHHHCCCCCCCEEEEEECCCCHHHHH
Q ss_conf             9998898999999979-9999-9971---79994899707899----877389999614348897399996389989999
Q gi|254780892|r   20 LFNDFGFMVFEATSVC-EARE-FCEK---ELLPNYLVIDESME----GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMI   90 (133)
Q Consensus        20 ~L~~~g~~v~~a~~g~-eAl~-~~~~---~~~pdlii~D~~mP----~~~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~   90 (133)
                      .|...|+.+..++++. +.++ .+..   ..++|.|+.--...    +..-+...++... .+.-.++++.  +......
T Consensus       100 ~l~~~g~~~~i~Tn~~~~~~~~~l~~~gl~~~fd~i~~~~~~~~~Kp~~~~~~~~~~~~g-~~~~~~l~Vg--D~~~Di~  176 (214)
T 3e58_A          100 EVKSQGLEIGLASSSVKADIFRALEENRLQGFFDIVLSGEEFKESKPNPEIYLTALKQLN-VQASRALIIE--DSEKGIA  176 (214)
T ss_dssp             HHHHTTCEEEEEESSCHHHHHHHHHHTTCGGGCSEEEEGGGCSSCTTSSHHHHHHHHHHT-CCGGGEEEEE--CSHHHHH
T ss_pred             HHHHCCCEEEEECCCCHHHHHHHHHHHCCCCCCCEEECCCCCCCCCCCHHHHHHHHHHCC-CCCCCEEEEE--CCHHHHH
T ss_conf             999879726875387367777787763123314678614335666765699999999829-9936379995--6999999


Q ss_pred             HHHHCCCCEEEE
Q ss_conf             999769988997
Q gi|254780892|r   91 AGARAGANSFLL  102 (133)
Q Consensus        91 ~a~~~Ga~~yl~  102 (133)
                      -|..+|..-+..
T Consensus       177 aA~~aG~~~i~v  188 (214)
T 3e58_A          177 AGVAADVEVWAI  188 (214)
T ss_dssp             HHHHTTCEEEEE
T ss_pred             HHHHCCCEEEEE
T ss_conf             999859989998


No 214
>2zxr_A Single-stranded DNA specific exonuclease RECJ; DNA repair, hydrolase; 2.15A {Thermus thermophilus} PDB: 2zxo_A 2zxp_A 1ir6_A
Probab=28.00  E-value=9.4  Score=17.62  Aligned_cols=29  Identities=10%  Similarity=-0.005  Sum_probs=16.2

Q ss_pred             EECCHH---HHHHHHHHCCCCCEEEECCCCCCC
Q ss_conf             999979---999999717999489970789987
Q gi|254780892|r   30 EATSVC---EAREFCEKELLPNYLVIDESMEGV   59 (133)
Q Consensus        30 ~a~~g~---eAl~~~~~~~~pdlii~D~~mP~~   59 (133)
                      ++.+|.   ++++.+.+... |+|++|.|.|+.
T Consensus       134 TvDcGi~a~e~i~~a~~~Gi-dvIVtDHH~p~~  165 (666)
T 2zxr_A          134 TVDCGITNHAELRELLENGV-EVIVTDHHTPGK  165 (666)
T ss_dssp             ESCCC--------------C-EEEEECCCC---
T ss_pred             EECCCCCCHHHHHHHHHCCC-EEEEECCCCCCC
T ss_conf             96488233999998886799-899949899987


No 215
>3iuu_A MLRC-like, putative metallopeptidase; YP_676511.1, structural genomics, joint center for structural genomics, JCSG; HET: PGE; 2.13A {Mesorhizobium SP}
Probab=27.73  E-value=29  Score=14.66  Aligned_cols=70  Identities=13%  Similarity=0.141  Sum_probs=29.4

Q ss_pred             HHHHCCCCCEEEECCCC-------CCCC-HHHHHHHHCCCCCCCEEEEEEC-CCCHHHHHHHHHCCCCEEEECC-CCHHH
Q ss_conf             99717999489970789-------9877-3899996143488973999963-8998999999976998899769-89899
Q gi|254780892|r   40 FCEKELLPNYLVIDESM-------EGVL-EFIAHVRQMPLGTDVFVYYLLM-EVDFEKMIAGARAGANSFLLKP-FNRET  109 (133)
Q Consensus        40 ~~~~~~~pdlii~D~~m-------P~~~-~l~~~ir~~~~~~~~pii~lT~-~~~~~~~~~a~~~Ga~~yl~KP-~~~~~  109 (133)
                      .++.+. .|.|++++|=       +|+. ++++++|+. .++++||++.-- +.+.....-...-....|-+-| ++..+
T Consensus        91 ~lra~~-~Dgv~L~LHGAmv~e~~~D~EG~ll~~iR~~-vGp~vPI~~tlDlHaNvs~~mv~~~d~l~~yrtyPHiD~~e  168 (495)
T 3iuu_A           91 AARMQD-FDAICLDLHGATLAEHTLDTEGYLLSRLREV-VGNDIMISLALDLHAYLTPQMVEQATIITSFRTTPHADIEE  168 (495)
T ss_dssp             HHHHSC-CSEEEEEECSCCCBSSCSSHHHHHHHHHHHH-HTTTSEEEEEECTTCCCCHHHHHHCSEEEECCCSSCCCHHH
T ss_pred             HHHCCC-CCEEEEECCCCEEECCCCCCCHHHHHHHHHH-CCCCCCEEEEECCCCCCCHHHHHHCCEEEEECCCCCCCHHH
T ss_conf             985179-8789995547666358889857999999987-19988559972534564899997387767753377738999


Q ss_pred             HH
Q ss_conf             99
Q gi|254780892|r  110 LR  111 (133)
Q Consensus       110 L~  111 (133)
                      --
T Consensus       169 tg  170 (495)
T 3iuu_A          169 TG  170 (495)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             99


No 216
>3m3h_A OPRT, oprtase, orotate phosphoribosyltransferase; pyrimidine ribonucleotide biosynthesis, structural genomics, infectious diseases; 1.75A {Bacillus anthracis} PDB: 3osc_A*
Probab=27.58  E-value=21  Score=15.48  Aligned_cols=66  Identities=11%  Similarity=0.021  Sum_probs=30.2

Q ss_pred             CEEEECCCCC-CC--CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHH
Q ss_conf             4899707899-87--738999961434889739999638998999999976998899769898999999999
Q gi|254780892|r   48 NYLVIDESME-GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE  116 (133)
Q Consensus        48 dlii~D~~mP-~~--~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~  116 (133)
                      .++|+|=-+- |+  .+.+..+|+. ...-.-++++--+....-....-+.|..-|=  =++.+++.+.+.+
T Consensus       139 ~VlIVDDViTTG~Si~~ai~~lr~~-G~~V~~v~vivdr~~~gg~e~l~~~Gv~~~s--L~t~~dl~~~~~~  207 (234)
T 3m3h_A          139 KVVVVEDLISTGGSAITCVEALREA-GCEVLGIVSIFTYELEAGKEKLEAANVASYS--LSDYSALTEVAAE  207 (234)
T ss_dssp             EEEEEEEEESSSHHHHHHHHHHHHT-TCEEEEEEEEEECCCHHHHHHHHHTTCCEEE--SSCHHHHHHHHHH
T ss_pred             EEEEEEEEECCCCCHHHHHHHHHHC-CCEEEEEEEEEECCCHHHHHHHHHCCCCEEE--ECCHHHHHHHHHH
T ss_conf             5999853003472279999999978-9979999999987744069999967997899--7769999999998


No 217
>1l3i_A Precorrin-6Y methyltransferase/putative decarboxylase; structural genomics, beta barrel, rossmann fold, tetramer; HET: SAH; 1.95A {Methanothermobacterthermautotrophicus} SCOP: c.66.1.22 PDB: 1kxz_A 1l3b_A 1f38_A 1l3c_A*
Probab=27.36  E-value=30  Score=14.62  Aligned_cols=65  Identities=14%  Similarity=0.056  Sum_probs=44.2

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCE--E-EEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHC
Q ss_conf             77999739989999999999988989--9-99999799999997179994899707899877389999614
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFM--V-FEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQM   69 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~--v-~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~   69 (133)
                      .+|.-||=|+......++.++..|+.  + ....+..+.+   .....||+|+++.......+++..+...
T Consensus        56 ~~V~avD~~~~~~~~a~~~~~~~gl~~~v~~~~gd~~~~~---~~~~~~D~v~~~~~~~~~~~~l~~~~~~  123 (192)
T 1l3i_A           56 RRVYAIDRNPEAISTTEMNLQRHGLGDNVTLMEGDAPEAL---CKIPDIDIAVVGGSGGELQEILRIIKDK  123 (192)
T ss_dssp             SEEEEEESCHHHHHHHHHHHHHTTCCTTEEEEESCHHHHH---TTSCCEEEEEESCCTTCHHHHHHHHHHT
T ss_pred             CEEEEEECCCHHHHHHHHHHHHCCCCCCEEEEECCHHHCC---CCCCCCCEEEEECCHHHHHHHHHHHHHH
T ss_conf             9999999062889999999998099988899988621053---0008868899918034699999999996


No 218
>2gjl_A Hypothetical protein PA1024; 2-nitropropane dioxygenase, 2-nitropropane, FMN, oxidoreductase; HET: FMN; 2.00A {Pseudomonas aeruginosa PAO1} PDB: 2gjn_A*
Probab=27.27  E-value=30  Score=14.61  Aligned_cols=84  Identities=15%  Similarity=-0.002  Sum_probs=56.9

Q ss_pred             HHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEECCCCCCC------CHHHHHHHHCCCCCCCEEEEEECCCCHHHH
Q ss_conf             9999998898999-999979999999717999489970789987------738999961434889739999638998999
Q gi|254780892|r   17 GRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGV------LEFIAHVRQMPLGTDVFVYYLLMEVDFEKM   89 (133)
Q Consensus        17 l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D~~mP~~------~~l~~~ir~~~~~~~~pii~lT~~~~~~~~   89 (133)
                      +...+...|..+. .+.+..+|...... . +|.++..-.=-||      ......+.+.....++|+|.=.+-.+....
T Consensus       110 ~i~~~~~~g~~v~~~v~s~~~A~~a~~~-G-~D~li~qG~eaGGh~g~~~~~~~~L~~~v~~~~~iPviaAGGI~~g~~i  187 (328)
T 2gjl_A          110 HIAEFRRHGVKVIHKCTAVRHALKAERL-G-VDAVSIDGFECAGHPGEDDIPGLVLLPAAANRLRVPIIASGGFADGRGL  187 (328)
T ss_dssp             HHHHHHHTTCEEEEEESSHHHHHHHHHT-T-CSEEEEECTTCSBCCCSSCCCHHHHHHHHHTTCCSCEEEESSCCSHHHH
T ss_pred             HHHHHHHCCCEEEEECCCHHHHHHHHHH-C-CCCCEECCCCCCCCCCCCCCCHHHHHHHHHHHCCCCEEECCCCCCHHHH
T ss_conf             9999987698899960779999999982-9-9921202776666778775416675899987337867713665666999


Q ss_pred             HHHHHCCCCEEEE
Q ss_conf             9999769988997
Q gi|254780892|r   90 IAGARAGANSFLL  102 (133)
Q Consensus        90 ~~a~~~Ga~~yl~  102 (133)
                      ..++..||+....
T Consensus       188 aaal~lGA~gV~~  200 (328)
T 2gjl_A          188 VAALALGADAINM  200 (328)
T ss_dssp             HHHHHHTCSEEEE
T ss_pred             HHHHHCCCCHHEE
T ss_conf             9998439512056


No 219
>1xdw_A NAD+-dependent (R)-2-hydroxyglutarate dehydrogenase; structural variant of the BAB rossmann fold, oxidoreductase; 1.98A {Acidaminococcus fermentans}
Probab=27.20  E-value=30  Score=14.60  Aligned_cols=105  Identities=8%  Similarity=0.003  Sum_probs=61.5

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECC---HHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEE
Q ss_conf             977999739989999999999988989999999---79999999717999489970789987738999961434889739
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATS---VCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~---g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pi   77 (133)
                      || ||+.+.....+..+.++.+..|+++....+   .++..+.+.  . .|++++=..-+-.-+++......    .+.+
T Consensus         1 MK-Il~~~~~~~~~~~~e~~~~~~~~ev~~~~~~~~~~e~~~~~~--~-~D~~i~~~~~~~~~~~l~~~~~l----~lK~   72 (331)
T 1xdw_A            1 MK-VLCYGVRDVELPIFEACNKEFGYDIKCVPDYLNTKETAEMAA--G-FDAVILRGNCFANKQNLDIYKKL----GVKY   72 (331)
T ss_dssp             CE-EEECSCCTTTHHHHHHHGGGTCCEEEECSCCSCSHHHHHTTT--T-CSEEEECTTCCBCHHHHHHHHHH----TCCE
T ss_pred             CE-EEEECCCCCCHHHHHHHHHHCCCEEEEECCCCCHHHHHHHHC--C-CCEEEECCCCCCCHHHHHHCCCC----CCCE
T ss_conf             98-999815855679999976564958999179999899999867--9-97899907887799999745205----9709


Q ss_pred             EEEECCCCH-HHHHHHHHCCCCEEEECCCCHHHHHHH
Q ss_conf             999638998-999999976998899769898999999
Q gi|254780892|r   78 YYLLMEVDF-EKMIAGARAGANSFLLKPFNRETLRFA  113 (133)
Q Consensus        78 i~lT~~~~~-~~~~~a~~~Ga~~yl~KP~~~~~L~~~  113 (133)
                      |...+-+.. =+...+.+.|..=.-.+........+-
T Consensus        73 I~~~~aG~D~iD~~~~~~~gI~v~n~~g~~~~~VAE~  109 (331)
T 1xdw_A           73 ILTRTAGTDHIDKEYAKELGFPMAFVPRYSPNAIAEL  109 (331)
T ss_dssp             EEESSSCCTTBCHHHHHHTTCCEECCCCCCHHHHHHH
T ss_pred             EEECCCCCCCCCHHHHHHCCEEEEECCCCCCHHHHHH
T ss_conf             9988836650079989739889997999881679999


No 220
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A
Probab=27.08  E-value=27  Score=14.88  Aligned_cols=82  Identities=12%  Similarity=0.067  Sum_probs=42.3

Q ss_pred             HHHHHCCCEEEEECCHHHH-----HHHHH-HCCCCCEEEE--CCCC--CCCCHHHHHHHHCCCCCCCEEEEEECCCCHHH
Q ss_conf             9999889899999997999-----99997-1799948997--0789--98773899996143488973999963899899
Q gi|254780892|r   19 HLFNDFGFMVFEATSVCEA-----REFCE-KELLPNYLVI--DESM--EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEK   88 (133)
Q Consensus        19 ~~L~~~g~~v~~a~~g~eA-----l~~~~-~~~~pdlii~--D~~m--P~~~~l~~~ir~~~~~~~~pii~lT~~~~~~~   88 (133)
                      +.|...|+.+..++++...     ++.+. .+..+|.++.  |...  |+-..+...+++....+.=.++++.-  ...+
T Consensus       113 ~~Lk~~g~~l~i~Tn~~~~~~~~~l~~~~l~~~f~d~~i~~~~~~~~KP~p~~~~~~~~~l~~~p~~~~l~VGD--s~~D  190 (267)
T 1swv_A          113 ASLRERGIKIGSTTGYTREMMDIVAKEAALQGYKPDFLVTPDDVPAGRPYPWMCYKNAMELGVYPMNHMIKVGD--TVSD  190 (267)
T ss_dssp             HHHHHTTCEEEEBCSSCHHHHHHHHHHHHHTTCCCSCCBCGGGSSCCTTSSHHHHHHHHHHTCCSGGGEEEEES--SHHH
T ss_pred             HHHHHCCCEEEEECCCCHHHHHHHHHHCCCCCCCCEEEEEECCCCCCCCCHHHHHHHHHHHCCCCCCEEEEEEC--CHHH
T ss_conf             99997794488626984888999999808877764079862236778999899999999948998773899968--8878


Q ss_pred             HHHHHHCCCCEEEE
Q ss_conf             99999769988997
Q gi|254780892|r   89 MIAGARAGANSFLL  102 (133)
Q Consensus        89 ~~~a~~~Ga~~yl~  102 (133)
                      ..-|.++|+.-..+
T Consensus       191 i~~A~~aG~~tI~v  204 (267)
T 1swv_A          191 MKEGRNAGMWTVGV  204 (267)
T ss_dssp             HHHHHHTTSEEEEE
T ss_pred             HHHHHHCCCEEEEE
T ss_conf             99999879979999


No 221
>2o07_A Spermidine synthase; structural genomics, structural genomics consortium, SGC, transferase; HET: SPD MTA; 1.89A {Homo sapiens} SCOP: c.66.1.17 PDB: 2o06_A* 2o05_A* 2o0l_A*
Probab=26.40  E-value=31  Score=14.51  Aligned_cols=74  Identities=9%  Similarity=0.060  Sum_probs=50.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHC-------CCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-------CHHHHHHH
Q ss_conf             77999739989999999999988-------98999999979999999717999489970789987-------73899996
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDF-------GFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-------LEFIAHVR   67 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~-------g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-------~~l~~~ir   67 (133)
                      .+|-+||-|+.+-+..++.+...       ..+ ....+|.+-++..  ...+|+|++|..-|.+       .++.+.++
T Consensus       120 ~~v~~VEiD~~Vi~~a~~~~~~~~~~~~dpRv~-i~~~Da~~~l~~~--~~~yDvIi~D~~dp~~~~~~L~t~eFy~~~~  196 (304)
T 2o07_A          120 ESVVQCEIDEDVIQVSKKFLPGMAIGYSSSKLT-LHVGDGFEFMKQN--QDAFDVIITDSSDPMGPAESLFKESYYQLMK  196 (304)
T ss_dssp             CEEEEEESCHHHHHHHHHHCHHHHGGGGCTTEE-EEESCHHHHHHTC--SSCEEEEEEECC-----------CHHHHHHH
T ss_pred             CEEEEECCCHHHHHHHHHHHHHHCCCCCCCCEE-EEEHHHHHHHHHC--CCCCCEEEECCCCCCCHHHHHCCHHHHHHHH
T ss_conf             326876046999999998555533443577248-9960799999747--7778889990899886357653799999999


Q ss_pred             HCCCCCCCEEE
Q ss_conf             14348897399
Q gi|254780892|r   68 QMPLGTDVFVY   78 (133)
Q Consensus        68 ~~~~~~~~pii   78 (133)
                      +.-....+-+.
T Consensus       197 ~~L~~~Gv~v~  207 (304)
T 2o07_A          197 TALKEDGVLCC  207 (304)
T ss_dssp             HHEEEEEEEEE
T ss_pred             HHCCCCCEEEE
T ss_conf             97599989999


No 222
>2c1x_A UDP-glucose flavonoid 3-O glycosyltransferase; WINE, catalysis, glycosylation; HET: UDP B3P; 1.9A {Vitis vinifera} SCOP: c.87.1.10 PDB: 2c1z_A* 2c9z_A*
Probab=25.96  E-value=32  Score=14.47  Aligned_cols=51  Identities=10%  Similarity=-0.076  Sum_probs=37.1

Q ss_pred             CCCCEEEEEECCCCHHHHHHHH-HC-CCCEEEECC-CCHHHHHHHHHHHHHHHH
Q ss_conf             8897399996389989999999-76-998899769-898999999999999999
Q gi|254780892|r   72 GTDVFVYYLLMEVDFEKMIAGA-RA-GANSFLLKP-FNRETLRFAMRELPQMQK  122 (133)
Q Consensus        72 ~~~~pii~lT~~~~~~~~~~a~-~~-Ga~~yl~KP-~~~~~L~~~i~~~~~~~~  122 (133)
                      ...+|.|++--..|.-...+-+ +. |+--.+.+. ++.++|..++++++...+
T Consensus       361 ~~GVP~l~~P~~~DQ~~na~rv~~~lG~G~~l~~~~~t~~~l~~ai~~vL~~~~  414 (456)
T 2c1x_A          361 AGGVPLICRPFFGDQRLNGRMVEDVLEIGVRIEGGVFTKSGLMSCFDQILSQEK  414 (456)
T ss_dssp             HHTCCEEECCCSTTHHHHHHHHHHTSCCEEECGGGSCCHHHHHHHHHHHHHSHH
T ss_pred             HCCCCEEECCCHHHHHHHHHHHHHHCCEEEEECCCCCCHHHHHHHHHHHHCCCH
T ss_conf             859998963642221899999999708389903898389999999999970958


No 223
>3nav_A Tryptophan synthase alpha chain; alpha subunit, structural genomics, CSG center for structural genomics of infectious diseases; 2.10A {Vibrio cholerae o1 biovar el tor}
Probab=25.92  E-value=32  Score=14.46  Aligned_cols=97  Identities=13%  Similarity=0.029  Sum_probs=59.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEE---ECCHHHHHHHHHHCCCCCEEEECCCCC--CC--------CHHHHHHHHC
Q ss_conf             7999739989999999999988989999---999799999997179994899707899--87--------7389999614
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFE---ATSVCEAREFCEKELLPNYLVIDESME--GV--------LEFIAHVRQM   69 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~---a~~g~eAl~~~~~~~~pdlii~D~~mP--~~--------~~l~~~ir~~   69 (133)
                      -++|+|--..-...+...+...|.....   -.+..+-+..+.+... ..|-+=-.+.  |.        .+.++++|+ 
T Consensus       128 GviipDLp~ee~~~~~~~~~~~gl~~I~lvsptt~~~Ri~~i~~~a~-gfiY~vs~~GvTG~~~~~~~~~~~~i~~ik~-  205 (271)
T 3nav_A          128 SVLIADVPTNESQPFVAAAEKFGIQPIFIAPPTASDETLRAVAQLGK-GYTYLLSRAGVTGAETKANMPVHALLERLQQ-  205 (271)
T ss_dssp             EEEETTSCGGGCHHHHHHHHHTTCEEEEEECTTCCHHHHHHHHHHCC-SCEEECCCC--------CCHHHHHHHHHHHH-
T ss_pred             EEEECCCCHHHHHHHHHHHHHCCCCEEEEECCCCHHHHHHHHHHCCC-CCEEEEECCCCCCCCCCCCCHHHHHHHHHHH-
T ss_conf             89945898156599999987679717999446755889999986188-7389850555678776665028999998753-


Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             3488973999963899899999997699889976
Q gi|254780892|r   70 PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLK  103 (133)
Q Consensus        70 ~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~K  103 (133)
                        ..++||++==|-.+.++..++++.||++.++-
T Consensus       206 --~t~~Pv~vGFGI~~~e~v~~~~~~~ADGvVVG  237 (271)
T 3nav_A          206 --FDAPPALLGFGISEPAQVKQAIEAGAAGAISG  237 (271)
T ss_dssp             --TTCCCEEECSSCCSHHHHHHHHHTTCSEEEES
T ss_pred             --CCCCCEEEEEEECCHHHHHHHHHCCCCEEEEC
T ss_conf             --36897289830188999999987389999988


No 224
>3etn_A Putative phosphosugar isomerase involved in capsule formation; YP_209877.1, structural genomics; HET: MSE CMK; 1.70A {Bacteroides fragilis nctc 9343}
Probab=25.90  E-value=32  Score=14.46  Aligned_cols=31  Identities=10%  Similarity=-0.030  Sum_probs=20.3

Q ss_pred             CHHHHHHHHCC-CCCCCEEEEEECCCCHHHHH
Q ss_conf             73899996143-48897399996389989999
Q gi|254780892|r   60 LEFIAHVRQMP-LGTDVFVYYLLMEVDFEKMI   90 (133)
Q Consensus        60 ~~l~~~ir~~~-~~~~~pii~lT~~~~~~~~~   90 (133)
                      -|++..++.-. ..+.+++|.+|+........
T Consensus       120 ~evi~~~~~ak~~~~~~~vI~IT~~~~S~lak  151 (220)
T 3etn_A          120 REIVELTQLAHNLNPGLKFIVITGNPDSPLAS  151 (220)
T ss_dssp             HHHHHHHHHHHHHCTTCEEEEEESCTTSHHHH
T ss_pred             HHHHHHHHHHHHCCCCCCEEEEEECCCCCCCC
T ss_conf             65888899987404687158886058874213


No 225
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A*
Probab=25.89  E-value=32  Score=14.46  Aligned_cols=56  Identities=7%  Similarity=-0.068  Sum_probs=38.1

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHHCCCEEEEECCH----HHHHHHHHHCCCCCEEEECCCCC
Q ss_conf             97-79997399899999999999889899999997----99999997179994899707899
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSV----CEAREFCEKELLPNYLVIDESME   57 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g----~eAl~~~~~~~~pdlii~D~~mP   57 (133)
                      || ||||.--.=.+...+.+.|...|++|......    ...++.+.... .+++..|+.-+
T Consensus        10 mk~KIlVtGatG~iG~~l~~~Ll~~g~~V~~l~R~~~~~~~~~~~l~~~~-~~~~~~d~~~~   70 (318)
T 2r6j_A           10 MKSKILIFGGTGYIGNHMVKGSLKLGHPTYVFTRPNSSKTTLLDEFQSLG-AIIVKGELDEH   70 (318)
T ss_dssp             CCCCEEEETTTSTTHHHHHHHHHHTTCCEEEEECTTCSCHHHHHHHHHTT-CEEEECCTTCH
T ss_pred             CCCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCCCCCHHHHHHHHCCC-CEEEEEECCCC
T ss_conf             99839998999689999999999786979999789742366777641188-18999114430


No 226
>3iaa_A CALG2; glycosyltransferase, calicheamicin, TDP, enediyne, TR; HET: TYD; 2.50A {Micromonospora echinospora}
Probab=25.80  E-value=32  Score=14.45  Aligned_cols=47  Identities=15%  Similarity=0.051  Sum_probs=31.2

Q ss_pred             CCCCEEEEEECCCCHHHHHHH-HHCCCCEEEECC--CCHHHHHHHHHHHHH
Q ss_conf             889739999638998999999-976998899769--898999999999999
Q gi|254780892|r   72 GTDVFVYYLLMEVDFEKMIAG-ARAGANSFLLKP--FNRETLRFAMRELPQ  119 (133)
Q Consensus        72 ~~~~pii~lT~~~~~~~~~~a-~~~Ga~~yl~KP--~~~~~L~~~i~~~~~  119 (133)
                      ...+|+|++....+.....+. .+.| .++..++  ++.++|..+|.+++.
T Consensus       331 a~G~P~v~~p~~~dq~~~a~~i~~~g-~G~~l~~~~~t~~~L~~al~~lL~  380 (416)
T 3iaa_A          331 YWGRPLVVVPQSFDVQPMARRVDQLG-LGAVLPGEKADGDTLLAAVGAVAA  380 (416)
T ss_dssp             HTTCCEEECCCSGGGHHHHHHHHHTT-SEEECCGGGCCHHHHHHHHHHHHS
T ss_pred             HHCCCEEEECCCCCHHHHHHHHHHCC-CEEECCCCCCCHHHHHHHHHHHHC
T ss_conf             94999999357253899999999879-889826057999999999999977


No 227
>1wo8_A Methylglyoxal synthase; structural genomics, riken structural genomics/proteomics initiative, RSGI, lyase; 1.70A {Thermus thermophilus HB8} SCOP: c.24.1.2
Probab=25.66  E-value=32  Score=14.43  Aligned_cols=37  Identities=14%  Similarity=0.023  Sum_probs=17.3

Q ss_pred             CCEEEEECCCH---HHHHHHHHHHHH-CCCEEEEECCHH-HHH
Q ss_conf             97799973998---999999999998-898999999979-999
Q gi|254780892|r    1 MDSLLLVDSSH---IVRKVGRHLFND-FGFMVFEATSVC-EAR   38 (133)
Q Consensus         1 m~~ILiVDD~~---~~r~~l~~~L~~-~g~~v~~a~~g~-eAl   38 (133)
                      ||+|-+|=+|.   ......+++..- .||+. .|..|. +.+
T Consensus         1 ~k~ialiAhD~dK~~l~~~a~~~~~ll~gf~i-~AT~GTa~~L   42 (126)
T 1wo8_A            1 MKALALIAHDAKKDEMVAFCLRHKDVLARYPL-LATGTTGARI   42 (126)
T ss_dssp             CCEEEEEECGGGHHHHHHHHHHTHHHHTTSCE-EECHHHHHHH
T ss_pred             CCEEEEEEHHCCHHHHHHHHHHHHHHHCCCEE-EEEHHHHHHH
T ss_conf             95489983006769999999999999749759-9603299999


No 228
>3kzp_A LMO0111 protein, putative diguanylate cyclase/phosphodiesterase; EAL-domain, structural genomics, PSI-2, protein structure initiative; 2.00A {Listeria monocytogenes}
Probab=25.38  E-value=16  Score=16.16  Aligned_cols=86  Identities=17%  Similarity=0.181  Sum_probs=55.7

Q ss_pred             HHHHHHCCCEEEE--ECCHHHHHHHHHHCCCCCEEEECCCCCC---C-----CHHHHHHHHCCCCCCCEEEEEECCCCHH
Q ss_conf             9999988989999--9997999999971799948997078998---7-----7389999614348897399996389989
Q gi|254780892|r   18 RHLFNDFGFMVFE--ATSVCEAREFCEKELLPNYLVIDESMEG---V-----LEFIAHVRQMPLGTDVFVYYLLMEVDFE   87 (133)
Q Consensus        18 ~~~L~~~g~~v~~--a~~g~eAl~~~~~~~~pdlii~D~~mP~---~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~   87 (133)
                      -+.|+..|+.+..  +.+|...+..+.. ..||.|=+|..+-.   .     ..+++.+.......++.+| .++-.+.+
T Consensus       134 l~~l~~~G~~ialDdfG~g~~~~~~l~~-l~~d~iKid~~~~~~~~~~~~~~~~~v~~i~~~a~~~~~~vI-aegVEt~~  211 (235)
T 3kzp_A          134 IKVIHGLGYHIAIDDVSCGLNSLERVMS-YLPYIIEIKFSLIHFKNIPLEDLLLFIKAWANFAQKNKLDFV-VEGIETKE  211 (235)
T ss_dssp             HHHHHHTTCEEEECSTTSTTCCHHHHHH-HGGGCSEEEEEGGGGTTSCHHHHHHHHHHHHHHHHHTTCEEE-EEEECSTH
T ss_pred             HHHHHHCCCCEEECCCCCCCCCHHHHHH-CCCCEECCCHHHHHHHCCCCHHHHHHHHHHHHHHHHCCCEEE-EEECCCHH
T ss_conf             9999976996885257987410778852-798676141567765302311268999999999998699899-97189599


Q ss_pred             HHHHHHHCCCC---EE-EECCC
Q ss_conf             99999976998---89-97698
Q gi|254780892|r   88 KMIAGARAGAN---SF-LLKPF  105 (133)
Q Consensus        88 ~~~~a~~~Ga~---~y-l~KP~  105 (133)
                      ....+.+.|++   +| +.||.
T Consensus       212 ~~~~l~~lGvd~~QG~~~~~P~  233 (235)
T 3kzp_A          212 TMTLLESHGVSIFQGYLVNKPF  233 (235)
T ss_dssp             HHHHHHHTTCCSCEEEECCCCE
T ss_pred             HHHHHHHCCCCEEECCEEEECC
T ss_conf             9999998699996448100377


No 229
>1hg3_A Triosephosphate isomerase; thermostability, tetrameric; 2.7A {Pyrococcus woesei} SCOP: c.1.1.1
Probab=25.13  E-value=33  Score=14.37  Aligned_cols=86  Identities=16%  Similarity=0.201  Sum_probs=52.2

Q ss_pred             HHHHHHHHHHHCCCEEE-EECCHHHHHHHHHHCCCCCEEEEC--CCCCCC-------C----HHHHHHHHCCCCCCCEEE
Q ss_conf             99999999998898999-999979999999717999489970--789987-------7----389999614348897399
Q gi|254780892|r   13 VRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVID--ESMEGV-------L----EFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus        13 ~r~~l~~~L~~~g~~v~-~a~~g~eAl~~~~~~~~pdlii~D--~~mP~~-------~----~l~~~ir~~~~~~~~pii   78 (133)
                      ..+.+.+ +...|+.+. |+.+..++-...  ...|++|-.-  |-.-.+       .    ++.+.++.  ...++||+
T Consensus       106 ~~~~i~~-a~~~gl~~i~cv~e~~~~~~~~--~l~~~iiayeP~waIGtg~~~~~~~~~~i~~~~~~i~~--~~~~i~vl  180 (225)
T 1hg3_A          106 LEAAIRR-AEEVGLMTMVCSNNPAVSAAVA--ALNPDYVAVEPPELIGTGIPVSKAKPEVITNTVELVKK--VNPEVKVL  180 (225)
T ss_dssp             HHHHHHH-HHHHTCEEEEEESSHHHHHHHH--TTCCSEEEECCTTTTTTSCCTTTSCTHHHHHHHHHHHH--HCTTSEEE
T ss_pred             HHHHHHH-HHHCCCCEEEEECCHHHHHHHH--HHCCCEEEEEEHHHCCCCCCCCCCCHHHHHHHHHHHHH--HCCCEEEE
T ss_conf             6999999-9985991678624068877887--50763599950231368878773458999999999986--33640489


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEEC
Q ss_conf             9963899899999997699889976
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLK  103 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~K  103 (133)
                      +=.|-...+....+...|++++|.=
T Consensus       181 yGgsV~~~~~~~~~~~~g~DGvLVG  205 (225)
T 1hg3_A          181 CGAGISTGEDVKKAIELGTVGVLLA  205 (225)
T ss_dssp             EESSCCSHHHHHHHHHTTCSEEEES
T ss_pred             EECCCCCHHHHHHHHHCCCCEEEEC
T ss_conf             8368697789999872799789984


No 230
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Vibrio parahaemolyticus AQ3810}
Probab=25.07  E-value=33  Score=14.36  Aligned_cols=78  Identities=12%  Similarity=-0.022  Sum_probs=49.4

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCC--CCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEE
Q ss_conf             977999739989999999999988989999999799999997179--994899707899877389999614348897399
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKEL--LPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~--~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii   78 (133)
                      ||.|||.=-+.=+-..+.+.|-..|++|....-.++-++.+.++.  ....+.+|+.=++  ++...+.+...  .+.++
T Consensus         1 MkiVlITGassGIG~a~A~~la~~G~~V~l~~R~~~~l~~~~~~~~~~~~~~~~Dv~~~~--~v~~~~~~~~~--~~d~l   76 (230)
T 3guy_A            1 MSLIVITGASSGLGAELAKLYDAEGKATYLTGRSESKLSTVTNCLSNNVGYRARDLASHQ--EVEQLFEQLDS--IPSTV   76 (230)
T ss_dssp             --CEEEESTTSHHHHHHHHHHHHTTCCEEEEESCHHHHHHHHHTCSSCCCEEECCTTCHH--HHHHHHHSCSS--CCSEE
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHCCCCCEEEEECCCHH--HHHHHHHHHCC--CCCEE
T ss_conf             999999187719999999999987998999989999999999985434688970069999--99999998588--38799


Q ss_pred             EEEC
Q ss_conf             9963
Q gi|254780892|r   79 YLLM   82 (133)
Q Consensus        79 ~lT~   82 (133)
                      +..+
T Consensus        77 inna   80 (230)
T 3guy_A           77 VHSA   80 (230)
T ss_dssp             EECC
T ss_pred             EECC
T ss_conf             9868


No 231
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding motif, oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2
Probab=25.04  E-value=33  Score=14.36  Aligned_cols=82  Identities=13%  Similarity=0.066  Sum_probs=48.2

Q ss_pred             CCEEEEECCCHHHHHHHHHHH-H--HCCCEEEEECCHH---HHHH-HHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCC
Q ss_conf             977999739989999999999-9--8898999999979---9999-99717999489970789987-7389999614348
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLF-N--DFGFMVFEATSVC---EARE-FCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLG   72 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L-~--~~g~~v~~a~~g~---eAl~-~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~   72 (133)
                      ||+|||.=-+.=+-..+.+.| +  ..|++|..+....   +.++ ....+.....+-+|+.=++. .++...++.....
T Consensus        21 MktVlITGas~GIG~aia~~l~~la~~G~~V~~~~R~~~~~~~l~~~~~~~~~~~~~~~Dvs~~~~v~~~~~~i~~~~~~  100 (267)
T 1sny_A           21 MNSILITGCNRGLGLGLVKALLNLPQPPQHLFTTCRNREQAKELEDLAKNHSNIHILEIDLRNFDAYDKLVADIEGVTKD  100 (267)
T ss_dssp             CSEEEESCCSSHHHHHHHHHHHTSSSCCSEEEEEESCTTSCHHHHHHHHHCTTEEEEECCTTCGGGHHHHHHHHHHHHGG
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHHHHCCCCEEEEEEECCCHHHHHHHHHHHHHHHCC
T ss_conf             99899918987899999999998886799999998898999999999852998899996379999999998655554226


Q ss_pred             CCCEEEEEEC
Q ss_conf             8973999963
Q gi|254780892|r   73 TDVFVYYLLM   82 (133)
Q Consensus        73 ~~~pii~lT~   82 (133)
                      ..+-+++-.+
T Consensus       101 ~~idiLvnNA  110 (267)
T 1sny_A          101 QGLNVLFNNA  110 (267)
T ss_dssp             GCCSEEEECC
T ss_pred             CCEEEEEEEC
T ss_conf             8637999503


No 232
>1x1o_A Nicotinate-nucleotide pyrophosphorylase; transferase, structural genomics, NPPSFA; 1.90A {Thermus thermophilus HB8}
Probab=25.03  E-value=33  Score=14.36  Aligned_cols=64  Identities=22%  Similarity=0.173  Sum_probs=40.0

Q ss_pred             EEECCHHHHHHHHHHCCCCCEEEECCCCCCC-CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEE
Q ss_conf             9999979999999717999489970789987-73899996143488973999963899899999997699889
Q gi|254780892|r   29 FEATSVCEAREFCEKELLPNYLVIDESMEGV-LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF  100 (133)
Q Consensus        29 ~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~y  100 (133)
                      .++.+-+++.+.+..+  +|.|.+|-.=|.. -+.++.++     +.++ +..||.-+.+...+....|++-+
T Consensus       201 VEv~~~~e~~~a~~~g--ad~I~LDn~~~e~i~~~v~~~~-----~~v~-ieaSGGI~~~ni~~ya~~GVD~I  265 (286)
T 1x1o_A          201 VEVRSLEELEEALEAG--ADLILLDNFPLEALREAVRRVG-----GRVP-LEASGNMTLERAKAAAEAGVDYV  265 (286)
T ss_dssp             EEESSHHHHHHHHHHT--CSEEEEESCCHHHHHHHHHHHT-----TSSC-EEEESSCCHHHHHHHHHHTCSEE
T ss_pred             EEECCHHHHHHHHHCC--CCEEEECCCCHHHHHHHHHHHC-----CCEE-EEEECCCCHHHHHHHHHCCCCEE
T ss_conf             9958799999998659--9877328989999999999877-----9669-99979999999999997699999


No 233
>3cni_A Putative ABC type-2 transporter; structural genomics, PSI-2, protein structure initiative, midwest center for structural genomics, MCSG; 2.30A {Thermotoga maritima MSB8}
Probab=24.84  E-value=33  Score=14.34  Aligned_cols=61  Identities=11%  Similarity=0.221  Sum_probs=38.7

Q ss_pred             CEEEEECCCHH-HHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHH
Q ss_conf             77999739989-99999999998898999999979999999717999489970789987738999961
Q gi|254780892|r    2 DSLLLVDSSHI-VRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQ   68 (133)
Q Consensus         2 ~~ILiVDD~~~-~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~   68 (133)
                      .+|-|||.|.. .-+.+.+.|+....-+....+-++|.+.+.++.. +.++.   .|.+++  +.+..
T Consensus        11 ~kiaivd~D~s~~s~~~~~~L~~~~~~~~~~~d~~eA~~~l~~g~~-~~viv---IP~~Fs--~~l~~   72 (156)
T 3cni_A           11 QKVAIVREDTGTIAELAEKALGNMVDIVYAGSDLKEAEEAVKKEKA-PAIIV---IPKGFS--QSLES   72 (156)
T ss_dssp             CEEEEEECCCSHHHHHHHHHHHTSSEEEEEESCHHHHHHHHHHHTC-SEEEE---ECTTHH--HHHHH
T ss_pred             CEEEEEECCCCHHHHHHHHHHHCCCCEEEEECCHHHHHHHHHCCCE-EEEEE---ECCCHH--HHHHC
T ss_conf             8599998999979999999861699658997999999999983986-79999---883478--99877


No 234
>1twd_A Copper homeostasis protein CUTC; TIM-like protein, structural genomics, PSI, protein structure initiative; 1.70A {Shigella flexneri} SCOP: c.1.30.1 PDB: 1x7i_A 1x8c_A
Probab=24.79  E-value=33  Score=14.33  Aligned_cols=90  Identities=9%  Similarity=-0.086  Sum_probs=58.6

Q ss_pred             CCCHHHHHHHHHHHHHC-CCEEE------EECCHHHHHHHHHHCCCCCEEEECCCCCCC---CHHHHHHHHCCCCCCCEE
Q ss_conf             39989999999999988-98999------999979999999717999489970789987---738999961434889739
Q gi|254780892|r    8 DSSHIVRKVGRHLFNDF-GFMVF------EATSVCEAREFCEKELLPNYLVIDESMEGV---LEFIAHVRQMPLGTDVFV   77 (133)
Q Consensus         8 DD~~~~r~~l~~~L~~~-g~~v~------~a~~g~eAl~~~~~~~~pdlii~D~~mP~~---~~l~~~ir~~~~~~~~pi   77 (133)
                      +|.......++++.... |+.+.      .+.+..+|++.+..-. ++=|++.=.-|+.   .+.++++.+.   ..-++
T Consensus        97 ~dg~iD~~~~~~Li~~a~~l~vTFHRAfD~~~d~~~al~~Li~lG-~~rILTSG~~~~a~~G~~~L~~L~~~---a~~~i  172 (256)
T 1twd_A           97 VDGNVDMPRMEKIMAAAGPLAVTFHRAFDMCANPLYTLNNLAELG-IARVLTSGQKSDALQGLSKIMELIAH---RDAPI  172 (256)
T ss_dssp             TTSSBCHHHHHHHHHHHTTSEEEECGGGGGCSCHHHHHHHHHHHT-CCEEEECTTSSSTTTTHHHHHHHHTS---SSCCE
T ss_pred             CCCCCCHHHHHHHHHHHCCCCEEEECCHHHHCCHHHHHHHHHHCC-CCEEECCCCCCCHHHHHHHHHHHHHH---CCCCE
T ss_conf             999849999999999857686477442565289999999999759-89786578967777769999999985---69938


Q ss_pred             EEEECCCCHHHHHHHHHCCCCEEE
Q ss_conf             999638998999999976998899
Q gi|254780892|r   78 YYLLMEVDFEKMIAGARAGANSFL  101 (133)
Q Consensus        78 i~lT~~~~~~~~~~a~~~Ga~~yl  101 (133)
                      |+..+--..+...+-.+.|+..|=
T Consensus       173 Im~GgGI~~~Ni~~l~~tG~~e~H  196 (256)
T 1twd_A          173 IMAGAGVRAENLHHFLDAGVLEVH  196 (256)
T ss_dssp             EEEESSCCTTTHHHHHHHTCSEEE
T ss_pred             EEEECCCCHHHHHHHHHCCCCEEE
T ss_conf             997277799999999977988798


No 235
>3hix_A ALR3790 protein; rhodanese, rhodanese_3, Q8YQN0, Q8YQN0_anAsp, NSR437I, NESG, structural genomics, PSI-2, protein structure initiative; 1.92A {Anabaena SP} PDB: 3k9r_A
Probab=24.72  E-value=33  Score=14.32  Aligned_cols=27  Identities=11%  Similarity=-0.049  Sum_probs=11.8

Q ss_pred             CCCCEEEEEECCCCHH-H-HHHHHHCCCC
Q ss_conf             8897399996389989-9-9999976998
Q gi|254780892|r   72 GTDVFVYYLLMEVDFE-K-MIAGARAGAN   98 (133)
Q Consensus        72 ~~~~pii~lT~~~~~~-~-~~~a~~~Ga~   98 (133)
                      .++-||++.-..+... . .....+.|..
T Consensus        50 ~~~~~Iv~~C~~g~rs~~aa~~L~~~G~~   78 (106)
T 3hix_A           50 EKSRDIYVYGAGDEQTSQAVNLLRSAGFE   78 (106)
T ss_dssp             CTTSCEEEECSSHHHHHHHHHHHHHTTCS
T ss_pred             CCCCEEEEECCCCHHHHHHHHHHHHCCCC
T ss_conf             99984999999982999999999982985


No 236
>3l49_A ABC sugar (ribose) transporter, periplasmic substrate-binding subunit; sugar binding/transporter, structural genomics, PSI; HET: UNL; 2.30A {Rhodobacter sphaeroides}
Probab=24.32  E-value=34  Score=14.28  Aligned_cols=39  Identities=5%  Similarity=-0.009  Sum_probs=19.0

Q ss_pred             HHHHHHHHHHCCCEEEEECCH------HHHHHHHHHCCCCCEEEEC
Q ss_conf             999999999889899999997------9999999717999489970
Q gi|254780892|r   14 RKVGRHLFNDFGFMVFEATSV------CEAREFCEKELLPNYLVID   53 (133)
Q Consensus        14 r~~l~~~L~~~g~~v~~a~~g------~eAl~~~~~~~~pdlii~D   53 (133)
                      .+.++..++..||++....++      .++++.+.... +|.||+-
T Consensus        24 ~~g~~~~a~~~G~~~~~~~~~~d~~~q~~~i~~~i~~~-vDgiIi~   68 (291)
T 3l49_A           24 YQAQIAEIERLGGTAIALDAGRNDQTQVSQIQTLIAQK-PDAIIEQ   68 (291)
T ss_dssp             HHHHHHHHHHTTCEEEEEECTTCHHHHHHHHHHHHHHC-CSEEEEE
T ss_pred             HHHHHHHHHHCCCEEEEEECCCCHHHHHHHHHHHHHCC-CCEEEEC
T ss_conf             99999999974999999938999999999999999749-9999977


No 237
>1iy9_A Spermidine synthase; rossmann fold, structural genomics, PSI, protein structure initiative, northeast structural genomics consortium, NESG; 2.30A {Bacillus subtilis} SCOP: c.66.1.17
Probab=24.28  E-value=34  Score=14.27  Aligned_cols=65  Identities=14%  Similarity=0.047  Sum_probs=47.0

Q ss_pred             CEEEEECCCHHHHHHHHHHHHH-------CCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCC-------CHHHHHHH
Q ss_conf             7799973998999999999998-------898999999979999999717999489970789987-------73899996
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFND-------FGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-------LEFIAHVR   67 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~-------~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~-------~~l~~~ir   67 (133)
                      ++|-+||=|+.+-+..++.+..       -..++ ...+|.+-+...  ...+|+|++|.--|.+       .|+.+.++
T Consensus       100 ~~v~~VEiD~~Vi~~a~~~~~~~~~~~~dprv~i-~~~Da~~~l~~~--~~~yDvIi~D~~~p~~~~~~L~t~eFy~~~~  176 (275)
T 1iy9_A          100 KKATLVDIDGKVIEYSKKFLPSIAGKLDDPRVDV-QVDDGFMHIAKS--ENQYDVIMVDSTEPVGPAVNLFTKGFYAGIA  176 (275)
T ss_dssp             SEEEEEESCHHHHHHHHHHCHHHHTTTTSTTEEE-EESCSHHHHHTC--CSCEEEEEESCSSCCSCCCCCSTTHHHHHHH
T ss_pred             CEEEEEEECHHHHHHHHHHCHHHCCCCCCCCCEE-EECHHHHHHHCC--CCCCCEEEEECCCCCCCCHHHCCHHHHHHHH
T ss_conf             4699997088999999985723135323877438-988589987505--6776789993899887212116899999999


Q ss_pred             HC
Q ss_conf             14
Q gi|254780892|r   68 QM   69 (133)
Q Consensus        68 ~~   69 (133)
                      +.
T Consensus       177 ~~  178 (275)
T 1iy9_A          177 KA  178 (275)
T ss_dssp             HH
T ss_pred             HH
T ss_conf             87


No 238
>2qy9_A Cell division protein FTSY; SRP receptor, protein targeting, simibi class GTPase, cell cycle, GTP-binding, inner membrane, membrane; 1.90A {Escherichia coli} SCOP: a.24.13.1 c.37.1.10 PDB: 1fts_A
Probab=24.04  E-value=34  Score=14.25  Aligned_cols=104  Identities=8%  Similarity=0.071  Sum_probs=62.3

Q ss_pred             EEEEECCC---HHHHHHHHHHHHHCCCEEEEECCHH-------HHHHHHHHCCCCCEEEECC--CCCCCCHHHHHHHH--
Q ss_conf             79997399---8999999999998898999999979-------9999997179994899707--89987738999961--
Q gi|254780892|r    3 SLLLVDSS---HIVRKVGRHLFNDFGFMVFEATSVC-------EAREFCEKELLPNYLVIDE--SMEGVLEFIAHVRQ--   68 (133)
Q Consensus         3 ~ILiVDD~---~~~r~~l~~~L~~~g~~v~~a~~g~-------eAl~~~~~~~~pdlii~D~--~mP~~~~l~~~ir~--   68 (133)
                      +|++|--|   +.-.+.++..-+..|..++...++.       +|++.+....+ |+||+|-  .++.-.++..+++.  
T Consensus       129 ~V~lva~Dt~R~aA~eQL~~~a~~~~v~~~~~~~~~d~~~i~~~~~~~a~~~~~-D~vliDTaGR~~~~~~lm~EL~~i~  207 (309)
T 2qy9_A          129 SVMLAAGDTFRAAAVEQLQVWGQRNNIPVIAQHTGADSASVIFDAIQAAKARNI-DVLIADTAGRLQNKSHLMEELKKIV  207 (309)
T ss_dssp             CEEEECCCTTCHHHHHHHHHHHHHTTCCEECCSTTCCHHHHHHHHHHHHHHTTC-SEEEECCCCCGGGHHHHHHHHHHHH
T ss_pred             CCEEEECCCCCHHHHHHHHHHHHHCCCCEEECCCCCCHHHHHHHHHHHHHHCCC-CEEEECCCCCCCCCHHHHHHHHHHH
T ss_conf             614864453065499999998752498377337888799999999999997699-8999689887767899999999999


Q ss_pred             ------CCCCCCCEEEEEECCCCHHHHHHHHH----CCCCEEEECCCCH
Q ss_conf             ------43488973999963899899999997----6998899769898
Q gi|254780892|r   69 ------MPLGTDVFVYYLLMEVDFEKMIAGAR----AGANSFLLKPFNR  107 (133)
Q Consensus        69 ------~~~~~~~pii~lT~~~~~~~~~~a~~----~Ga~~yl~KP~~~  107 (133)
                            .+..+.-.++++.+....+...++..    .|.++.+.--++.
T Consensus       208 ~~~~~~~~~~p~e~~LVlda~~g~~~~~~~~~f~~~~~~~g~IlTKlD~  256 (309)
T 2qy9_A          208 RVMKKLDVEAPHEVMLTIDASTGQNAVSQAKLFHEAVGLTGITLTKLDG  256 (309)
T ss_dssp             HHHTTTCTTCCSEEEEEEEGGGTHHHHHHHHHHHHHSCCCEEEEECCTT
T ss_pred             HHHHHHCCCCCCEEEEECCCCCCHHHHHHHHHHCCCCCCCEEEEECCCC
T ss_conf             9987533678724565100323377999998623126887799954347


No 239
>1lh0_A OMP synthase; loop closure, monomer closure, orotate phosphoribosyltransferase; HET: ORO PRP; 2.00A {Salmonella typhimurium} SCOP: c.61.1.1 PDB: 1opr_A* 1sto_A* 1oro_A
Probab=24.02  E-value=31  Score=14.55  Aligned_cols=22  Identities=14%  Similarity=0.369  Sum_probs=11.4

Q ss_pred             CEEEECCCCC-CC--CHHHHHHHHC
Q ss_conf             4899707899-87--7389999614
Q gi|254780892|r   48 NYLVIDESME-GV--LEFIAHVRQM   69 (133)
Q Consensus        48 dlii~D~~mP-~~--~~l~~~ir~~   69 (133)
                      .++++|=-.- |+  .+.+..+++.
T Consensus       119 rVliVeDViTTG~S~~e~i~~l~~~  143 (213)
T 1lh0_A          119 RVMLVDDVITAGTAIRESMEIIQAH  143 (213)
T ss_dssp             EEEEECSCCSSSCHHHHHHHHHHHT
T ss_pred             CEEEEEECCCCCHHHHHHHHHHHHC
T ss_conf             4899972314256589999999987


No 240
>3p3v_A PTS system, N-acetylgalactosamine-specific IIB CO; PTS IIB component, phosphotransferase, sugar transport, STRU genomics; HET: PGE; 1.65A {Streptococcus pyogenes serotype M1}
Probab=23.97  E-value=35  Score=14.24  Aligned_cols=43  Identities=9%  Similarity=0.186  Sum_probs=31.8

Q ss_pred             CEEEEECCCHHHHHHHHHHHHH---CCCEEEEECCHHHHHHHHHHCC
Q ss_conf             7799973998999999999998---8989999999799999997179
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFND---FGFMVFEATSVCEAREFCEKEL   45 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~---~g~~v~~a~~g~eAl~~~~~~~   45 (133)
                      ++|+||||....=...+.++..   .|..+ ...+-++|.+.+.+..
T Consensus        31 ~~IiVvdD~~A~D~~~k~~l~mA~P~gvk~-~i~sv~~a~~~l~~~~   76 (163)
T 3p3v_A           31 NTVIVANDAVSEDKIQQSLMKTVIPSSIAI-RFFSIQKVIDIIHKAS   76 (163)
T ss_dssp             SEEEEECHHHHHCHHHHHHHGGGSCTTSEE-EEECHHHHHHHGGGCC
T ss_pred             CEEEEECCCCCCCHHHHHHHHHHCCCCCEE-EEEEHHHHHHHHHCCC
T ss_conf             999997652247999999999638888859-9975999999985688


No 241
>1g5t_A COB(I)alamin adenosyltransferase; P-loop protein, cobalamin biosynthesis, RECA fold; HET: ATP; 1.80A {Salmonella typhimurium} SCOP: c.37.1.11 PDB: 1g5r_A* 1g64_A*
Probab=23.80  E-value=35  Score=14.22  Aligned_cols=47  Identities=17%  Similarity=0.083  Sum_probs=29.7

Q ss_pred             CCCCCEEEECCCCC----CC---CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHH
Q ss_conf             79994899707899----87---7389999614348897399996389989999999
Q gi|254780892|r   44 ELLPNYLVIDESME----GV---LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGA   93 (133)
Q Consensus        44 ~~~pdlii~D~~mP----~~---~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~   93 (133)
                      ...+|+||+|=-+.    |.   .+++..+...|..  +- |++||.+-++......
T Consensus       118 ~~~~dlvILDEi~~Ai~~gli~~eev~~~l~~rp~~--~e-vVlTGR~~p~~L~e~A  171 (196)
T 1g5t_A          118 DPLLDMVVLDELTYMVAYDYLPLEEVISALNARPGH--QT-VIITGRGCHRDILDLA  171 (196)
T ss_dssp             CTTCSEEEEETHHHHHHTTSSCHHHHHHHHHTSCTT--CE-EEEECSSCCHHHHHHC
T ss_pred             CCCCCEEEHHHHHHHHHCCCCCHHHHHHHHHHCCCC--CE-EEEECCCCCHHHHHHC
T ss_conf             576577869989999986996899999999828999--78-9997999998999863


No 242
>2aee_A OPRT, oprtase, orotate phosphoribosyltransferase; structural genomics, PSI, protein structure initiative; 1.95A {Streptococcus pyogenes} SCOP: c.61.1.1
Probab=23.68  E-value=27  Score=14.87  Aligned_cols=66  Identities=15%  Similarity=0.043  Sum_probs=29.8

Q ss_pred             CEEEECCCC-CCC--CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHH
Q ss_conf             489970789-987--738999961434889739999638998999999976998899769898999999999
Q gi|254780892|r   48 NYLVIDESM-EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE  116 (133)
Q Consensus        48 dlii~D~~m-P~~--~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~  116 (133)
                      .++++|=.+ -|+  .+.+..+|.. ...-.-++++-.+....-....-+.|..  +.--++.++|...+.+
T Consensus       119 ~VliVEDViTTG~S~~~ai~~l~~~-g~~V~~~~vivdr~~~~~~~~l~~~gi~--~~sl~t~~~ll~~~~~  187 (211)
T 2aee_A          119 KMVIIEDLISTGGSVLDAAAAASRE-GADVLGVVAIFTYELPKASQNFKEAGIK--LITLSNYTELIAVAKL  187 (211)
T ss_dssp             EEEEEEEEESSCHHHHHHHHHHHHT-TCEEEEEEEEEECCCHHHHHHHHHHTCC--EEESCCHHHHHHHHHH
T ss_pred             EEEEEEEEECCCCCHHHHHHHHHHC-CCEEEEEEEEEECCCHHHHHHHHHCCCC--EEEECCHHHHHHHHHH
T ss_conf             8999853045672157654468874-9806699999988861689999966996--9995659999999998


No 243
>1wl8_A GMP synthase [glutamine-hydrolyzing] subunit A; transferase, gatases, riken structural genomics/proteomics initiative, RSGI; 1.45A {Pyrococcus horikoshii} SCOP: c.23.16.1 PDB: 2d7j_A
Probab=23.67  E-value=35  Score=14.20  Aligned_cols=91  Identities=8%  Similarity=-0.007  Sum_probs=51.8

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCC--CCCCHHHHHHHHCCCCCCCEEEEE
Q ss_conf             799973998999999999998898999999979999999717999489970789--987738999961434889739999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~m--P~~~~l~~~ir~~~~~~~~pii~l   80 (133)
                      .|+|||--..+-..+.+.|+..|+++....+... ++.+.. ..||.+++.-..  |...+....++.. ...++|++-+
T Consensus         2 mI~iiD~g~~ft~ni~~~l~~lG~~~~i~p~~~~-~~~~~~-~~~~gv~~sgg~~~~~~~~~~~~i~~~-~~~~~PilGI   78 (189)
T 1wl8_A            2 MIVIMDNGGQYVHRIWRTLRYLGVETKIIPNTTP-LEEIKA-MNPKGIIFSGGPSLENTGNCEKVLEHY-DEFNVPILGI   78 (189)
T ss_dssp             EEEEEECSCTTHHHHHHHHHHTTCEEEEEETTCC-HHHHHH-TCCSEEEECCCSCTTCCTTHHHHHHTG-GGTCSCEEEE
T ss_pred             EEEEEECCCCHHHHHHHHHHHCCCEEEEECCCCC-HHHHHH-HCCCEEEECCCCCCCCCCCHHHHHHHH-HHCCCCEEEE
T ss_conf             8999979984899999999978992899969998-899983-189978758998786546649999999-8559968998


Q ss_pred             ECCCCHHHHHHHHHCCCCEE
Q ss_conf             63899899999997699889
Q gi|254780892|r   81 LMEVDFEKMIAGARAGANSF  100 (133)
Q Consensus        81 T~~~~~~~~~~a~~~Ga~~y  100 (133)
                      --    ....-+...|..-.
T Consensus        79 Cl----G~Q~l~~~~G~~~~   94 (189)
T 1wl8_A           79 CL----GHQLIAKFFGGKVG   94 (189)
T ss_dssp             TH----HHHHHHHHHTCEEE
T ss_pred             EH----HHHHHHHHCCCCCE
T ss_conf             42----13667764699401


No 244
>3pfn_A NAD kinase; structural genomics consortium, SNP, SGC, transferase; 2.70A {Homo sapiens}
Probab=23.64  E-value=35  Score=14.20  Aligned_cols=76  Identities=13%  Similarity=0.086  Sum_probs=39.0

Q ss_pred             CEEEEE--CCCHHHH---HHHHHHHHHCCCEEEEECCHHHHHHHHHHC--------------------CCCCEEEECCCC
Q ss_conf             779997--3998999---999999998898999999979999999717--------------------999489970789
Q gi|254780892|r    2 DSLLLV--DSSHIVR---KVGRHLFNDFGFMVFEATSVCEAREFCEKE--------------------LLPNYLVIDESM   56 (133)
Q Consensus         2 ~~ILiV--DD~~~~r---~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~--------------------~~pdlii~D~~m   56 (133)
                      ++||||  -.++...   .-+...|...|+.|..-.+-.+........                    ...|+|++    
T Consensus        39 k~vlii~K~~d~~~~~~~~el~~~L~~~g~~V~ve~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~DlvI~----  114 (365)
T 3pfn_A           39 KSVLVIKKMRDASLLQPFKELCTHLMEENMIVYVEKKVLEDPAIASDESFGAVKKKFCTFREDYDDISNQIDFIIC----  114 (365)
T ss_dssp             CEEEEEECTTCGGGHHHHHHHHHHHHHTSCEEEEEHHHHHSHHHHHCSTTHHHHHHCEEECTTTCCCTTTCSEEEE----
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEECCHHHHCCCCCCCCCCCCCCCCCCCCCCCHHHCCCCCCEEEE----
T ss_conf             8899995799979999999999999878998998613530715433455553344433155795675756688999----


Q ss_pred             CCCCHH-HHHHHHCCCCCCCEEEEEEC
Q ss_conf             987738-99996143488973999963
Q gi|254780892|r   57 EGVLEF-IAHVRQMPLGTDVFVYYLLM   82 (133)
Q Consensus        57 P~~~~l-~~~ir~~~~~~~~pii~lT~   82 (133)
                      =||+|. ++..+.. ....+||+-+..
T Consensus       115 lGGDGTlL~a~~~~-~~~~~PilGIN~  140 (365)
T 3pfn_A          115 LGGDGTLLYASSLF-QGSVPPVMAFHL  140 (365)
T ss_dssp             ESSTTHHHHHHHHC-SSSCCCEEEEES
T ss_pred             ECCCHHHHHHHHHH-CCCCCCEEEEEC
T ss_conf             76819999999985-178982899837


No 245
>2yvl_A TRMI protein, hypothetical protein; tRNA, methyltransferase, S-adenosylmethionine, structural genomics, NPPSFA; HET: SAM; 2.20A {Aquifex aeolicus VF5}
Probab=23.51  E-value=35  Score=14.18  Aligned_cols=89  Identities=13%  Similarity=0.125  Sum_probs=47.2

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCC--EEEEE-CCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEEE
Q ss_conf             799973998999999999998898--99999-997999999971799948997078998773899996143488973999
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGF--MVFEA-TSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~--~v~~a-~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii~   79 (133)
                      ++.-+|-++...+..++-++.+|.  +|... .+..++ . + .+..+|.|++|  +|+.-+.+..+...-+ +.=.+++
T Consensus       115 ~v~t~e~~e~~~~~A~~n~~~~g~~~nv~~~~~D~~~~-~-~-~~~~fD~V~ld--~p~p~~~l~~~~~~LK-pGG~lv~  188 (248)
T 2yvl_A          115 EVWTFEAVEEFYKTAQKNLKKFNLGKNVKFFNVDFKDA-E-V-PEGIFHAAFVD--VREPWHYLEKVHKSLM-EGAPVGF  188 (248)
T ss_dssp             EEEEECSCHHHHHHHHHHHHHTTCCTTEEEECSCTTTS-C-C-CTTCBSEEEEC--SSCGGGGHHHHHHHBC-TTCEEEE
T ss_pred             EEEEECCCHHHHHHHHHHHHHHCCCCCEEEEECCHHHC-C-C-CCCCCCEEEEE--CCCHHHHHHHHHHHCC-CCCEEEE
T ss_conf             79998288999999999899700577059999122214-3-2-45878999991--7876888999998428-8978999


Q ss_pred             EECC-CCHHHHHHHHHCCC
Q ss_conf             9638-99899999997699
Q gi|254780892|r   80 LLME-VDFEKMIAGARAGA   97 (133)
Q Consensus        80 lT~~-~~~~~~~~a~~~Ga   97 (133)
                      .+.. .......++++.|.
T Consensus       189 ~~P~i~Qv~~~~~~l~~~f  207 (248)
T 2yvl_A          189 LLPTANQVIKLLESIENYF  207 (248)
T ss_dssp             EESSHHHHHHHHHHSTTTE
T ss_pred             EECCHHHHHHHHHHHHHCC
T ss_conf             9297999999999997086


No 246
>2b7n_A Probable nicotinate-nucleotide pyrophosphorylase; quinolinate phosphoribosyltransferase, quinolinic acid; HET: NTM; 2.30A {Helicobacter pylori} PDB: 2b7p_A* 2b7q_A*
Probab=23.15  E-value=36  Score=14.14  Aligned_cols=33  Identities=15%  Similarity=0.112  Sum_probs=18.5

Q ss_pred             CCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHH
Q ss_conf             998999999976998899769898999999999
Q gi|254780892|r   84 VDFEKMIAGARAGANSFLLKPFNRETLRFAMRE  116 (133)
Q Consensus        84 ~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~  116 (133)
                      ++.++..++.++|++-.+.=.++++++...+..
T Consensus       190 ~~~~ea~~a~~~g~d~i~LDn~~~~~~~~~v~~  222 (273)
T 2b7n_A          190 ESFEEAKNAMNAGADIVMCDNLSVLETKEIAAY  222 (273)
T ss_dssp             SSHHHHHHHHHHTCSEEEEETCCHHHHHHHHHH
T ss_pred             CCHHHHHHHHHCCCCEEECCCCCHHHHHHHHHH
T ss_conf             689999999874885883189899999999999


No 247
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron}
Probab=23.02  E-value=36  Score=14.13  Aligned_cols=34  Identities=18%  Similarity=0.156  Sum_probs=28.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECCH
Q ss_conf             9779997399899999999999889899999997
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSV   34 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g   34 (133)
                      |+||||.=-.-.+...+.+.|...|++|......
T Consensus         4 m~KIlItGatG~iG~~l~~~Ll~~g~~V~~l~R~   37 (227)
T 3dhn_A            4 VKKIVLIGASGFVGSALLNEALNRGFEVTAVVRH   37 (227)
T ss_dssp             CCEEEEETCCHHHHHHHHHHHHTTTCEEEEECSC
T ss_pred             CCEEEEECCCCHHHHHHHHHHHHCCCEEEEEECC
T ss_conf             9999998899889999999999784989999868


No 248
>1k7k_A Hypothetical protein YGGV; MAD, His-TAG, large groove, disordered Se-Met, structural genomics, putative ribosomal protein, PSI; HET: MSE; 1.50A {Escherichia coli} SCOP: c.51.4.1 PDB: 2q16_A* 2pyu_A*
Probab=22.95  E-value=36  Score=14.12  Aligned_cols=30  Identities=20%  Similarity=0.303  Sum_probs=27.3

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEE
Q ss_conf             977999739989999999999988989999
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFE   30 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~   30 (133)
                      |+||+++-.|.-=..-++.+|..+|+++..
T Consensus        23 M~kI~~aT~N~~K~~E~~~iL~~~~i~i~~   52 (221)
T 1k7k_A           23 MQKVVLATGNVGKVRELASLLSDFGLDIVA   52 (221)
T ss_dssp             CEEEEESCCCHHHHHHHHHHHGGGTEEEEE
T ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEE
T ss_conf             878999939988999999973133978986


No 249
>2an1_A Putative kinase; structural genomics, PSI, protein structure initiative, midwest center for structural genomics, MCSG, transferase; 2.00A {Salmonella typhimurium LT2}
Probab=22.84  E-value=36  Score=14.11  Aligned_cols=96  Identities=13%  Similarity=0.155  Sum_probs=53.7

Q ss_pred             CEEEEEC-----CCHHHHHHHHHHHHHCCCEEEEECCHHHHHH----------HHHHCCCCCEEEECCCCCCCCHH-HHH
Q ss_conf             7799973-----9989999999999988989999999799999----------99717999489970789987738-999
Q gi|254780892|r    2 DSLLLVD-----SSHIVRKVGRHLFNDFGFMVFEATSVCEARE----------FCEKELLPNYLVIDESMEGVLEF-IAH   65 (133)
Q Consensus         2 ~~ILiVD-----D~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~----------~~~~~~~pdlii~D~~mP~~~~l-~~~   65 (133)
                      |+|.||-     ......+.+.+.|...|++|....+..+.+.          ...+  .+|+|++    =||+|. ++.
T Consensus         6 k~Igiv~~~~~~~~~~~~~~i~~~l~~~g~~v~~~~~~~~~~~~~~~~~~~~~~~~~--~~Dlvi~----iGGDGT~L~a   79 (292)
T 2an1_A            6 KCIGIVGHPRHPTALTTHEMLYRWLCDQGYEVIVEQQIAHELQLKNVPTGTLAEIGQ--QADLAVV----VGGDGNMLGA   79 (292)
T ss_dssp             CEEEEECC-------CHHHHHHHHHHHTTCEEEEEHHHHHHTTCSSCCEECHHHHHH--HCSEEEE----CSCHHHHHHH
T ss_pred             CEEEEEECCCCHHHHHHHHHHHHHHHHCCCEEEECHHHHHHCCCCCCCCCCHHHCCC--CCCEEEE----ECCCHHHHHH
T ss_conf             589999539998999999999999997889999968888664877777554445055--7778999----9268579999


Q ss_pred             HHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHH
Q ss_conf             96143488973999963899899999997699889976989899999999999
Q gi|254780892|r   66 VRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP  118 (133)
Q Consensus        66 ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~  118 (133)
                      .+... ..++||+-+.             .|--+|+. ++++.++...+.++.
T Consensus        80 ~~~~~-~~~~PilGIn-------------~G~lGFL~-~~~~~~~~~~l~~~~  117 (292)
T 2an1_A           80 ARTLA-RYDINVIGIN-------------RGNLGFLT-DLDPDNALQQLSDVL  117 (292)
T ss_dssp             HHHHT-TSSCEEEEBC-------------SSSCCSSC-CBCTTSHHHHHHHHH
T ss_pred             HHHHC-CCCCCEEEEE-------------CCCCEEEE-ECCCHHHHHHHHHHH
T ss_conf             99837-6898389876-------------58842477-336113899999987


No 250
>3ajx_A 3-hexulose-6-phosphate synthase; HPS, OMPDC suprafamily, LYA; 1.60A {Mycobacterium gastri}
Probab=22.71  E-value=37  Score=14.09  Aligned_cols=26  Identities=8%  Similarity=-0.102  Sum_probs=10.7

Q ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCC
Q ss_conf             79999999717999489970789987
Q gi|254780892|r   34 VCEAREFCEKELLPNYLVIDESMEGV   59 (133)
Q Consensus        34 g~eAl~~~~~~~~pdlii~D~~mP~~   59 (133)
                      |.+.++.+.+...--.++.|+.+.+.
T Consensus        40 G~~~i~~l~~~~~~~~i~~D~k~~di   65 (207)
T 3ajx_A           40 GLSVITAVKKAHPDKIVFADMKTMDA   65 (207)
T ss_dssp             CTHHHHHHHHHSTTSEEEEEEEECSC
T ss_pred             CHHHHHHHHHHCCCCEEECCCCCCCC
T ss_conf             99999999873799464011212159


No 251
>1rd5_A Tryptophan synthase alpha chain, chloroplast; hydroxamic acid, diboa, dimboa, indole, indole-glycerol- phosphate, lyase; 2.02A {Zea mays} SCOP: c.1.2.4 PDB: 1tjr_A
Probab=22.62  E-value=37  Score=14.08  Aligned_cols=98  Identities=12%  Similarity=0.018  Sum_probs=62.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEE--EC-CHHHHHHHHHHCCCCCEEEECCCCC--C-----CC---HHHHHHHHC
Q ss_conf             7999739989999999999988989999--99-9799999997179994899707899--8-----77---389999614
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFE--AT-SVCEAREFCEKELLPNYLVIDESME--G-----VL---EFIAHVRQM   69 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~--a~-~g~eAl~~~~~~~~pdlii~D~~mP--~-----~~---~l~~~ir~~   69 (133)
                      -++++|--..-...+...+...|.....  +. +..+=++.+.+... .-|-+=-.++  |     -.   +.++++|+ 
T Consensus       121 GviipDlp~ee~~~~~~~~~~~~l~~I~lvaPtt~~~ri~~i~~~a~-gfIY~vs~~GvTG~~~~~~~~~~~~i~~ir~-  198 (262)
T 1rd5_A          121 GLIVPDLPYVAAHSLWSEAKNNNLELVLLTTPAIPEDRMKEITKASE-GFVYLVSVNGVTGPRANVNPRVESLIQEVKK-  198 (262)
T ss_dssp             EEECTTCBTTTHHHHHHHHHHTTCEECEEECTTSCHHHHHHHHHHCC-SCEEEECSSCCBCTTSCBCTHHHHHHHHHHH-
T ss_pred             EEECCCCHHHHHHHHHHHHHHHCCCEEEECCCCCCHHHHHHHHCCCC-CEEEEECCCCCCCCCCCCCCHHHHHHHHHHH-
T ss_conf             44225760566778888875104340010167771878887632698-6278630346422122121027889998751-


Q ss_pred             CCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECC
Q ss_conf             34889739999638998999999976998899769
Q gi|254780892|r   70 PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKP  104 (133)
Q Consensus        70 ~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP  104 (133)
                        ..++||++==|-.+.++..+..+.||++.++--
T Consensus       199 --~t~~Pi~vGFGI~~~e~v~~~~~~gADGvVVGS  231 (262)
T 1rd5_A          199 --VTNKPVAVGFGISKPEHVKQIAQWGADGVIIGS  231 (262)
T ss_dssp             --HCSSCEEEESCCCSHHHHHHHHHTTCSEEEECH
T ss_pred             --CCCCCEEEEECCCCHHHHHHHHHCCCCEEEECH
T ss_conf             --368877999278999999999854999999888


No 252
>2dwc_A PH0318, 433AA long hypothetical phosphoribosylglycinamide formyl transferase; purine ribonucleotide biosynthesis, PURT; HET: ADP; 1.70A {Pyrococcus horikoshii OT3} PDB: 2czg_A*
Probab=22.31  E-value=37  Score=14.04  Aligned_cols=101  Identities=8%  Similarity=0.016  Sum_probs=54.1

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCCCEEEEECCH-------------------HHHHHHHHHCCCCCEEEECCCCCC----
Q ss_conf             779997399899999999999889899999997-------------------999999971799948997078998----
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSV-------------------CEAREFCEKELLPNYLVIDESMEG----   58 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g-------------------~eAl~~~~~~~~pdlii~D~~mP~----   58 (133)
                      +||||+=.-+.-|.. .......||+|..+...                   .+++..+.+...||+|+..+.-+.    
T Consensus        20 ~kIlIlG~Gqlgr~l-a~aA~~lG~~v~v~d~~~~~pa~~~ad~~~~~~~~D~e~l~~~a~~~~~d~v~~~~e~~~~~~l   98 (433)
T 2dwc_A           20 QKILLLGSGELGKEI-AIEAQRLGVEVVAVDRYANAPAMQVAHRSYVGNMMDKDFLWSVVEREKPDAIIPEIEAINLDAL   98 (433)
T ss_dssp             CEEEEESCSHHHHHH-HHHHHHTTCEEEEEESSTTCHHHHHSSEEEESCTTCHHHHHHHHHHHCCSEEEECSSCSCHHHH
T ss_pred             CEEEEECCCHHHHHH-HHHHHHCCCEEEEEECCCCCCHHHHCCEEEECCCCCHHHHHHHHHHHCCCEEEECCCCCCHHHH
T ss_conf             899999988999999-9999986998999979798867773555897799999999999998299999979786668999


Q ss_pred             -----------C-CHH----------HHHHHHCCCCCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCC
Q ss_conf             -----------7-738----------99996143488973999963899899999997699889976989
Q gi|254780892|r   59 -----------V-LEF----------IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN  106 (133)
Q Consensus        59 -----------~-~~l----------~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~  106 (133)
                                 . .+.          .+++-.....+.+|...+++   .++...+.+.=..-++.||..
T Consensus        99 ~~~~~~~~~~~~~~~~~~~~~~~~~~~~~ll~~~gIpt~~~~~v~s---~~e~~~~~~~ig~PvVvKp~~  165 (433)
T 2dwc_A           99 FEFEKDGYFVVPNARATWIAMHRERLRETLVKEAKVPTSRYMYATT---LDELYEACEKIGYPCHTKAIM  165 (433)
T ss_dssp             HHHHHTTCCBSSCHHHHHHHHCHHHHHHHHHHTSCCCCCCEEEESS---HHHHHHHHHHHCSSEEEEECC
T ss_pred             HHHHCCCCEECCCHHHHHHHHCCHHHHHHHHHHCCCCCCCCCCCCC---HHHHHHHHHHHCCCEEEEEEE
T ss_conf             9874268765189699998730099999999866999578521289---999999999838840321135


No 253
>3kp1_A D-ornithine aminomutase E component; 5 aminomutase (OAM), metal binding protein; HET: PLP B12 5AD; 2.01A {Clostridium sticklandii} PDB: 3kow_A* 3koy_A* 3koz_A* 3kp0_A* 3kox_A*
Probab=22.30  E-value=37  Score=14.04  Aligned_cols=98  Identities=6%  Similarity=-0.046  Sum_probs=57.7

Q ss_pred             HHHCCCEEEEECC---HHHHHHHHHHCCCCCEEEECCCCC-------CCCHHHHHHHHCCCCCCCEEEEEECCCCHHHHH
Q ss_conf             9988989999999---799999997179994899707899-------877389999614348897399996389989999
Q gi|254780892|r   21 FNDFGFMVFEATS---VCEAREFCEKELLPNYLVIDESME-------GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMI   90 (133)
Q Consensus        21 L~~~g~~v~~a~~---g~eAl~~~~~~~~pdlii~D~~mP-------~~~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~   90 (133)
                      +..+|++|.--..   .+|.++.+..+.. |+|++...--       ++.++...+++. ..++-+++++-| . ..+..
T Consensus       630 ~e~ygvEV~~LG~QVppEEiV~kAIE~dA-DaIlVSqlvTQ~d~H~tn~p~Lie~L~~~-G~RDkIivV~GG-P-rid~e  705 (763)
T 3kp1_A          630 IEKYGVEVHYLGTSVPVEKLVDAAIELKA-DAILASTIISHDDIHYKNMKRIHELAVEK-GIRDKIMIGCGG-T-QVTPE  705 (763)
T ss_dssp             GGGGTCEEEECCSSBCHHHHHHHHHHTTC-SEEEEECCCCGGGHHHHHHHHHHHHHHHT-TCTTTSEEEEEC-T-TCCHH
T ss_pred             CCCCCEEEEECCCCCCHHHHHHHHHHCCC-CEEEEEHHHHHHHHHHHHHHHHHHHHHHC-CCCCCEEEEECC-C-CCCHH
T ss_conf             22466589833576898999999997699-99996656540333988899999999963-888875999679-8-77879


Q ss_pred             HHHHCCCCEEEECCCCHHHHHHH-HHHHHHHHH
Q ss_conf             99976998899769898999999-999999999
Q gi|254780892|r   91 AGARAGANSFLLKPFNRETLRFA-MRELPQMQK  122 (133)
Q Consensus        91 ~a~~~Ga~~yl~KP~~~~~L~~~-i~~~~~~~~  122 (133)
                      -+.++|++.-.-.--.......- +++..++++
T Consensus       706 ~a~elGvdAgFGpGT~~~dVAsfiv~~~~e~~~  738 (763)
T 3kp1_A          706 VAVKQGVDAGFGRGSKGIHVATFLVKKRREMRE  738 (763)
T ss_dssp             HHHTTTCSEEECTTCCHHHHHHHHHHHHHHHC-
T ss_pred             HHHHCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
T ss_conf             999749250008999878999999999997522


No 254
>1vzw_A Phosphoribosyl isomerase A; histidine biosynthesis, tryptophan biosynthesis; 1.8A {Streptomyces coelicolor} SCOP: c.1.2.1 PDB: 2vep_A 2x30_A
Probab=22.19  E-value=38  Score=14.03  Aligned_cols=77  Identities=27%  Similarity=0.239  Sum_probs=48.8

Q ss_pred             HHHHHHHHHHCCCCCEEEECCCCCCC-----CHHHHHHHHCCCCCCCEEEEEECCCCHHHHHHHHH---CCCCEEEE---
Q ss_conf             79999999717999489970789987-----73899996143488973999963899899999997---69988997---
Q gi|254780892|r   34 VCEAREFCEKELLPNYLVIDESMEGV-----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGAR---AGANSFLL---  102 (133)
Q Consensus        34 g~eAl~~~~~~~~pdlii~D~~mP~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~~a~~---~Ga~~yl~---  102 (133)
                      ..+.++.+.+...-.++++|+.--|+     .++++.++   ...++|+++--|-.+.++..+..+   .|+++.+.   
T Consensus       148 ~~~~~~~~~~~g~~eii~~di~~dGt~~G~d~~l~~~i~---~~~~~pvi~~GGv~s~~Dl~~l~~l~~~g~~gvivgsA  224 (244)
T 1vzw_A          148 LYETLDRLNKEGCARYVVTDIAKDGTLQGPNLELLKNVC---AATDRPVVASGGVSSLDDLRAIAGLVPAGVEGAIVGKA  224 (244)
T ss_dssp             HHHHHHHHHHTTCCCEEEEEC-------CCCHHHHHHHH---HTCSSCEEEESCCCSHHHHHHHHTTGGGTEEEEEECHH
T ss_pred             CHHHHHHHHHHCCCEEEEEEECCCCCCCCCCHHHHHHHH---HHCCCCEEEECCCCCHHHHHHHHHHHHCCCCEEEEHHH
T ss_conf             356777887516645887776255876668999999999---86899899988999999999997640489105445689


Q ss_pred             ---CCCCHHHHHHH
Q ss_conf             ---69898999999
Q gi|254780892|r  103 ---KPFNRETLRFA  113 (133)
Q Consensus       103 ---KP~~~~~L~~~  113 (133)
                         +-++.+++...
T Consensus       225 l~~g~i~~~e~~~~  238 (244)
T 1vzw_A          225 LYAKAFTLEEALEA  238 (244)
T ss_dssp             HHTTSSCHHHHHHH
T ss_pred             HHCCCCCHHHHHHH
T ss_conf             88799899999998


No 255
>2r60_A Glycosyl transferase, group 1; rossmann-fold; 1.80A {Halothermothrix orenii} PDB: 2r66_A* 2r68_A*
Probab=22.18  E-value=38  Score=14.03  Aligned_cols=44  Identities=9%  Similarity=0.019  Sum_probs=32.4

Q ss_pred             CCCCEEEEEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             889739999638998999999976998899769898999999999999
Q gi|254780892|r   72 GTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        72 ~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      ...+|||. |..+.   ..+....|.++|+.+|-+.+.+..++.+++.
T Consensus       380 a~G~PVI~-s~~gg---~~e~v~~g~~G~lv~~~d~~~la~ai~~ll~  423 (499)
T 2r60_A          380 ASGLPAVV-TRNGG---PAEILDGGKYGVLVDPEDPEDIARGLLKAFE  423 (499)
T ss_dssp             HTTCCEEE-ESSBH---HHHHTGGGTSSEEECTTCHHHHHHHHHHHHS
T ss_pred             HCCCCEEE-CCCCC---HHHHHCCCCEEEEECCCCHHHHHHHHHHHHC
T ss_conf             87998999-17998---7999648974999789999999999999987


No 256
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, PSI-2, protein structure initiative; HET: MSE; 2.08A {Ruegeria pomeroyi}
Probab=21.83  E-value=38  Score=13.98  Aligned_cols=90  Identities=14%  Similarity=0.007  Sum_probs=52.7

Q ss_pred             CEEEEECCCHHHHHHHHHHHHHCC-CEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEEEE
Q ss_conf             779997399899999999999889-8999999979999999717999489970789987738999961434889739999
Q gi|254780892|r    2 DSLLLVDSSHIVRKVGRHLFNDFG-FMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYYL   80 (133)
Q Consensus         2 ~~ILiVDD~~~~r~~l~~~L~~~g-~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii~l   80 (133)
                      +||+|+=- =.+...+.+.|...| +++..+....+..+.+... .+..+..|+.=|  ..+.+.+    ...+  +++.
T Consensus         6 ~kI~ViGa-G~vG~~va~~L~~~~~~~v~~~dr~~~~~~~~~~~-~~~~~~~d~~d~--~~l~~~l----~~~D--vVi~   75 (118)
T 3ic5_A            6 WNICVVGA-GKIGQMIAALLKTSSNYSVTVADHDLAALAVLNRM-GVATKQVDAKDE--AGLAKAL----GGFD--AVIS   75 (118)
T ss_dssp             EEEEEECC-SHHHHHHHHHHHHCSSEEEEEEESCHHHHHHHHTT-TCEEEECCTTCH--HHHHHHT----TTCS--EEEE
T ss_pred             CCEEEECC-CHHHHHHHHHHHHCCCCCEEEECCCHHHHHHCCCC-CCCCCCCCCCCH--HHHHHHH----CCCC--EEEE
T ss_conf             78899867-99999999999878998478612656664100012-222111244899--9999998----5998--9998


Q ss_pred             EC-CC-CHHHHHHHHHCCCCEEEE
Q ss_conf             63-89-989999999769988997
Q gi|254780892|r   81 LM-EV-DFEKMIAGARAGANSFLL  102 (133)
Q Consensus        81 T~-~~-~~~~~~~a~~~Ga~~yl~  102 (133)
                      +. +. .......|.+.|. .|+.
T Consensus        76 ~~p~~~~~~ia~aa~~~g~-~~~D   98 (118)
T 3ic5_A           76 AAPFFLTPIIAKAAKAAGA-HYFD   98 (118)
T ss_dssp             CSCGGGHHHHHHHHHHTTC-EEEC
T ss_pred             CCCCCCCHHHHHHHHHHCC-CEEE
T ss_conf             3783045999999999099-9798


No 257
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii}
Probab=21.77  E-value=38  Score=13.97  Aligned_cols=13  Identities=8%  Similarity=0.202  Sum_probs=5.3

Q ss_pred             HHCCCEEEEECCH
Q ss_conf             9889899999997
Q gi|254780892|r   22 NDFGFMVFEATSV   34 (133)
Q Consensus        22 ~~~g~~v~~a~~g   34 (133)
                      +..|+.+..++|+
T Consensus       108 k~~g~~~~i~Tn~  120 (220)
T 2zg6_A          108 KSNGYKLALVSNA  120 (220)
T ss_dssp             HTTTCEEEECCSC
T ss_pred             HHCCCCEEEECCC
T ss_conf             8626544653388


No 258
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, PSI-2, protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans}
Probab=21.55  E-value=39  Score=13.95  Aligned_cols=52  Identities=13%  Similarity=0.089  Sum_probs=32.7

Q ss_pred             CCEEEEECCCHHHHHHHHHHHHHCCCEEEEECC-HHHHHHHHHHCCCCCEEEECC
Q ss_conf             977999739989999999999988989999999-799999997179994899707
Q gi|254780892|r    1 MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATS-VCEAREFCEKELLPNYLVIDE   54 (133)
Q Consensus         1 m~~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~-g~eAl~~~~~~~~pdlii~D~   54 (133)
                      | ||||.=-+-.....+.+.|...|++|....- +..+-+.. .....+++..|+
T Consensus        22 M-kIlI~GasG~iG~~lv~~Ll~~g~~V~~l~R~~~k~~~~~-~~~~~~~~~~d~   74 (236)
T 3e8x_A           22 M-RVLVVGANGKVARYLLSELKNKGHEPVAMVRNEEQGPELR-ERGASDIVVANL   74 (236)
T ss_dssp             C-EEEEETTTSHHHHHHHHHHHHTTCEEEEEESSGGGHHHHH-HTTCSEEEECCT
T ss_pred             C-EEEEECCCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHH-HCCCCCCCCCCH
T ss_conf             9-0899999888999999999978598999988878813555-235533113430


No 259
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.70A {Archaeoglobus fulgidus}
Probab=21.41  E-value=39  Score=13.93  Aligned_cols=102  Identities=20%  Similarity=0.156  Sum_probs=47.5

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEEECCH-HHHHHHHHHCCCCCEEEECCCCCCC---CHHHHHHHHCCCCCCCEEE
Q ss_conf             79997399899999999999889899999997-9999999717999489970789987---7389999614348897399
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSV-CEAREFCEKELLPNYLVIDESMEGV---LEFIAHVRQMPLGTDVFVY   78 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g-~eAl~~~~~~~~pdlii~D~~mP~~---~~l~~~ir~~~~~~~~pii   78 (133)
                      ++.+||.++.....+    ...|+.+....-. .+.|+.+. -...|.+++-.  ++-   .-.+..+|..   ...+++
T Consensus        31 ~vvvid~d~~~~~~~----~~~~~~~~~gd~~~~~~L~~~~-i~~a~~vi~~~--~~d~~n~~~~~~~k~~---~~~~ii  100 (141)
T 3llv_A           31 KVLAVDKSKEKIELL----EDEGFDAVIADPTDESFYRSLD-LEGVSAVLITG--SDDEFNLKILKALRSV---SDVYAI  100 (141)
T ss_dssp             CEEEEESCHHHHHHH----HHTTCEEEECCTTCHHHHHHSC-CTTCSEEEECC--SCHHHHHHHHHHHHHH---CCCCEE
T ss_pred             CEEEEECCHHHHHHH----HHCCCEEEEECCCCHHHHHHHH-HHCCCEEEEEE--CCCHHHHHHHHHHHHC---CCCCEE
T ss_conf             489995719999999----8459729993467888886666-72388999981--8809999999999855---899889


Q ss_pred             EEECCCCHHHHHHHHHCCCCEEEECCCCHHHHHHHHHHHHH
Q ss_conf             99638998999999976998899769898999999999999
Q gi|254780892|r   79 YLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ  119 (133)
Q Consensus        79 ~lT~~~~~~~~~~a~~~Ga~~yl~KP~~~~~L~~~i~~~~~  119 (133)
                      ..+.  +.+.......+|++..+..+   +.....+.+.++
T Consensus       101 ~~~~--~~~~~~~l~~~G~~~vv~~~---~~~~~~i~~~l~  136 (141)
T 3llv_A          101 VRVS--SPKKKEEFEEAGANLVVLVA---DAVKQAFMDKIK  136 (141)
T ss_dssp             EEES--CGGGHHHHHHTTCSEEEEHH---HHHHHHHHHHHH
T ss_pred             EEEC--CHHHHHHHHHCCCCEEECHH---HHHHHHHHHHHH
T ss_conf             9986--98899999977989999789---999999999974


No 260
>1gmx_A GLPE protein; transferase, rhodanese, sulfurtransferase, glycerol metabolism; 1.1A {Escherichia coli} SCOP: c.46.1.3 PDB: 1gn0_A
Probab=21.12  E-value=40  Score=13.89  Aligned_cols=68  Identities=13%  Similarity=0.089  Sum_probs=38.4

Q ss_pred             ECCHHHHHHHHHHCCCCCEEEECCCCC---------CC-----CHHHHHHHHCCCCCCCEEEEEECCCCHHH--HHHHHH
Q ss_conf             999799999997179994899707899---------87-----73899996143488973999963899899--999997
Q gi|254780892|r   31 ATSVCEAREFCEKELLPNYLVIDESME---------GV-----LEFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGAR   94 (133)
Q Consensus        31 a~~g~eAl~~~~~~~~pdlii~D~~mP---------~~-----~~l~~~ir~~~~~~~~pii~lT~~~~~~~--~~~a~~   94 (133)
                      .-+..++.+++.+   ++.+++|+.-|         |.     .++...+...  .++-|||+.-..+....  .....+
T Consensus         6 ~Is~~e~~~~l~~---~~~~liDvR~~~e~~~ghI~gai~ip~~~l~~~~~~~--~~~~~ii~~c~~g~~s~~~a~~l~~   80 (108)
T 1gmx_A            6 CINVADAHQKLQE---KEAVLVDIRDPQSFAMGHAVQAFHLTNDTLGAFMRDN--DFDTPVMVMCYHGNSSKGAAQYLLQ   80 (108)
T ss_dssp             EECHHHHHHHHHT---TCCEEEECSCHHHHHHCEETTCEECCHHHHHHHHHHS--CTTSCEEEECSSSSHHHHHHHHHHH
T ss_pred             EECHHHHHHHHHC---CCEEEEECCCHHHHHCCCCCCCCCCCCHHHHHHHHHH--HCCCCEEEECCCCHHHHHHHHHHHH
T ss_conf             7789999999978---9908997788899972887886467522169987653--2468704788998589999999998


Q ss_pred             CCCC-EEEEC
Q ss_conf             6998-89976
Q gi|254780892|r   95 AGAN-SFLLK  103 (133)
Q Consensus        95 ~Ga~-~yl~K  103 (133)
                      .|.. -|..+
T Consensus        81 ~G~~~v~~l~   90 (108)
T 1gmx_A           81 QGYDVVYSID   90 (108)
T ss_dssp             HTCSSEEEET
T ss_pred             CCCCCEEEEC
T ss_conf             4995779852


No 261
>1zx0_A Guanidinoacetate N-methyltransferase; structural genomics, structural genomics consortium; HET: SAH; 1.86A {Homo sapiens} SCOP: c.66.1.16 PDB: 3orh_A* 1xcj_A* 1xcl_A* 1p1c_A* 1p1b_A* 1khh_A*
Probab=20.88  E-value=40  Score=13.86  Aligned_cols=52  Identities=8%  Similarity=-0.116  Sum_probs=22.1

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEEEE-ECCHHHHHHHHHHCCCCCEEEECCC
Q ss_conf             7999739989999999999988989999-9997999999971799948997078
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMVFE-ATSVCEAREFCEKELLPNYLVIDES   55 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v~~-a~~g~eAl~~~~~~~~pdlii~D~~   55 (133)
                      ++..||-++.+.+..++.+...+..+.. ..++.+....+.. ..+|.|+.|..
T Consensus        85 ~vt~id~s~~~l~~a~~~~~~~~~~~~~~~~~~~~~~~~~~~-~~fD~i~~D~~  137 (236)
T 1zx0_A           85 EHWIIECNDGVFQRLRDWAPRQTHKVIPLKGLWEDVAPTLPD-GHFDGILYDTY  137 (236)
T ss_dssp             EEEEEECCHHHHHHHHHHGGGCSSEEEEEESCHHHHGGGSCT-TCEEEEEECCC
T ss_pred             EEEEEECCHHHHHHHHHHHHHCCCCCCEEECHHHHHHCCCCC-CCCCCEEECCE
T ss_conf             799980898999999998875588620232008876201223-56674452116


No 262
>1qxn_A SUD, sulfide dehydrogenase; polysulfide-sulfur transferase, homodimer; NMR {Wolinella succinogenes} SCOP: c.46.1.3
Probab=20.87  E-value=40  Score=13.86  Aligned_cols=70  Identities=11%  Similarity=0.031  Sum_probs=39.5

Q ss_pred             CCHHHHHHHHHHCCCCCEEEECCCCC------------CC----C-HHHHHHHHCCCCCCCEEEEEECCCC-HHHH-HHH
Q ss_conf             99799999997179994899707899------------87----7-3899996143488973999963899-8999-999
Q gi|254780892|r   32 TSVCEAREFCEKELLPNYLVIDESME------------GV----L-EFIAHVRQMPLGTDVFVYYLLMEVD-FEKM-IAG   92 (133)
Q Consensus        32 ~~g~eAl~~~~~~~~pdlii~D~~mP------------~~----~-~l~~~ir~~~~~~~~pii~lT~~~~-~~~~-~~a   92 (133)
                      -+.+++.+++..+  ++++|+|++-|            |.    . .+...+......++.|||+....+. .... ...
T Consensus        25 Isp~e~~~~l~~~--~~~~lIDvR~~~E~~~~~i~~~~~a~~ip~~~l~~~~~~~~~~~~~~ivv~C~~G~rS~~aa~~L  102 (137)
T 1qxn_A           25 LSPKDAYKLLQEN--PDITLIDVRDPDELKAMGKPDVKNYKHMSRGKLEPLLAKSGLDPEKPVVVFCKTAARAALAGKTL  102 (137)
T ss_dssp             ECHHHHHHHHHHC--TTSEEEECCCHHHHHHTCEECCSSEEECCTTTSHHHHHHHCCCTTSCEEEECCSSSCHHHHHHHH
T ss_pred             ECHHHHHHHHHCC--CCEEEEECCCHHHHHHHCCCCEEECCCCCHHHHHHHHHHHCCCCCCCEEEECCCCCCHHHHHHHH
T ss_conf             8499999999749--49899977988999861777300023336456554566514797763798738998399999999


Q ss_pred             HHCCCC-EEEEC
Q ss_conf             976998-89976
Q gi|254780892|r   93 ARAGAN-SFLLK  103 (133)
Q Consensus        93 ~~~Ga~-~yl~K  103 (133)
                      .+.|.. -|..+
T Consensus       103 ~~~G~~nV~~l~  114 (137)
T 1qxn_A          103 REYGFKTIYNSE  114 (137)
T ss_dssp             HHHTCSCEEEES
T ss_pred             HHCCCCCEEEEC
T ss_conf             984996679801


No 263
>2e6f_A Dihydroorotate dehydrogenase; chagas disease, pyrimidine biosynthesis, fumarate reductase, energy metabolism, redox homeostasis, flavoprotein; HET: FMN OXC; 1.26A {Trypanosoma cruzi} PDB: 2e6a_A* 2e6d_A* 2e68_A* 2djl_A* 2djx_A* 3c3n_A* 2b4g_A* 3c61_A*
Probab=20.71  E-value=40  Score=13.84  Aligned_cols=50  Identities=18%  Similarity=-0.010  Sum_probs=32.4

Q ss_pred             CCCCCEEEEEECCCCHHHHHHHHHCCCCEEEE------C-CCCHHHHHHHHHHHHHH
Q ss_conf             48897399996389989999999769988997------6-98989999999999999
Q gi|254780892|r   71 LGTDVFVYYLLMEVDFEKMIAGARAGANSFLL------K-PFNRETLRFAMRELPQM  120 (133)
Q Consensus        71 ~~~~~pii~lT~~~~~~~~~~a~~~Ga~~yl~------K-P~~~~~L~~~i~~~~~~  120 (133)
                      ..++.||+-..+-.+.++..+.+.+||+-.-.      + |--...+..-+.+.+++
T Consensus       241 ~~~~~~Iig~GGI~s~~Da~e~i~aGAs~Vqv~Tal~~~Gp~~i~~I~~~L~~~l~~  297 (314)
T 2e6f_A          241 RCPDKLVFGCGGVYSGEDAFLHILAGASMVQVGTALQEEGPGIFTRLEDELLEIMAR  297 (314)
T ss_dssp             HCTTSEEEEESSCCSHHHHHHHHHHTCSSEEECHHHHHHCTTHHHHHHHHHHHHHHH
T ss_pred             HCCCCEEEEECCCCCHHHHHHHHHCCCCCEEEEHHHHHCCCHHHHHHHHHHHHHHHH
T ss_conf             669845997178589999999998398840430556740919999999999999998


No 264
>1vhq_A Enhancing lycopene biosynthesis protein 2; structural genomics, unknown function; 1.65A {Escherichia coli} SCOP: c.23.16.2 PDB: 1oy1_A
Probab=20.60  E-value=41  Score=13.83  Aligned_cols=32  Identities=16%  Similarity=0.093  Sum_probs=22.8

Q ss_pred             CCEEEEE-------CCCHH-HHHHHHHHHHHCCCEEEEEC
Q ss_conf             9779997-------39989-99999999998898999999
Q gi|254780892|r    1 MDSLLLV-------DSSHI-VRKVGRHLFNDFGFMVFEAT   32 (133)
Q Consensus         1 m~~ILiV-------DD~~~-~r~~l~~~L~~~g~~v~~a~   32 (133)
                      ||||+|+       |.... -.-..-..|++.|++|..++
T Consensus         6 MKKvaviLsg~g~~DG~E~~E~~~p~~~L~raG~~V~~~s   45 (232)
T 1vhq_A            6 MKKIGVILSGCGVYDGSEIHEAVLTLLAISRSGAQAVCFA   45 (232)
T ss_dssp             CCEEEEECCSBSTTTSBCHHHHHHHHHHHHHTTCEEEEEE
T ss_pred             CCEEEEEECCCCCCCCHHHHHHHHHHHHHHHCCCEEEEEE
T ss_conf             6759999668878775029899999999998899799995


No 265
>2hpv_A FMN-dependent NADH-azoreductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: FMN; 2.00A {Enterococcus faecalis}
Probab=20.40  E-value=41  Score=13.80  Aligned_cols=31  Identities=13%  Similarity=0.014  Sum_probs=21.1

Q ss_pred             CCEEEEECCCH------HHHHHHHHHHHH-----CCCEEEEE
Q ss_conf             97799973998------999999999998-----89899999
Q gi|254780892|r    1 MDSLLLVDSSH------IVRKVGRHLFND-----FGFMVFEA   31 (133)
Q Consensus         1 m~~ILiVDD~~------~~r~~l~~~L~~-----~g~~v~~a   31 (133)
                      |+|||+|.-+|      .++.+...+++.     .|.+|...
T Consensus         1 M~kiL~I~asP~~~~~S~s~~l~~~f~~~~~~~~~~~eV~~~   42 (208)
T 2hpv_A            1 MSKLLVVKAHPLTKEESRSVRALETFLASYRETNPSDEIEIL   42 (208)
T ss_dssp             -CEEEEEECCSSCTTTCHHHHHHHHHHHHHHHHCTTSEEEEE
T ss_pred             CCEEEEEEECCCCCCCCHHHHHHHHHHHHHHHHCCCCEEEEE
T ss_conf             986999996899998788999999999999986899979999


No 266
>1sqg_A SUN protein, FMU protein; rossmann-fold, mixed beta sheet, methyltransferase-fold, RNA-binding domain; 1.65A {Escherichia coli} SCOP: a.79.1.3 c.66.1.38 PDB: 1sqf_A
Probab=20.28  E-value=41  Score=13.79  Aligned_cols=51  Identities=12%  Similarity=0.152  Sum_probs=31.6

Q ss_pred             EEEEECCCHHHHHHHHHHHHHCCCEE-EEECCHHHHHHHHHHCCCCCEEEECC
Q ss_conf             79997399899999999999889899-99999799999997179994899707
Q gi|254780892|r    3 SLLLVDSSHIVRKVGRHLFNDFGFMV-FEATSVCEAREFCEKELLPNYLVIDE   54 (133)
Q Consensus         3 ~ILiVDD~~~~r~~l~~~L~~~g~~v-~~a~~g~eAl~~~~~~~~pdlii~D~   54 (133)
                      +|.-+|-+..-...++..+...|... ....++........ ...+|.|++|-
T Consensus       272 ~i~a~d~~~~r~~~l~~~~~r~g~~~~~~~~~~~~~~~~~~-~~~fD~VLlDa  323 (429)
T 1sqg_A          272 QVVAVDIDEQRLSRVYDNLKRLGMKATVKQGDGRYPSQWCG-EQQFDRILLDA  323 (429)
T ss_dssp             EEEEEESSTTTHHHHHHHHHHTTCCCEEEECCTTCTHHHHT-TCCEEEEEEEC
T ss_pred             CCEEECCHHHHHHHHHHHHHHCCCCCEEECCCCCCCHHHCC-CCCCCEEEEEC
T ss_conf             65622342677888877786416431110234433101035-45664599707


No 267
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3}
Probab=20.16  E-value=41  Score=13.77  Aligned_cols=55  Identities=13%  Similarity=0.067  Sum_probs=37.0

Q ss_pred             CC-EEEEECCCHHHHHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCC
Q ss_conf             97-7999739989999999999988989999999799999997179994899707899
Q gi|254780892|r    1 MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME   57 (133)
Q Consensus         1 m~-~ILiVDD~~~~r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP   57 (133)
                      |+ +|||. ..=.+...+.+.|...||+|.......+.+..+..... +.+..|..-+
T Consensus         4 M~~~vlIt-GaGfIGs~lv~~Ll~~G~~V~~l~R~~~~~~~l~~~~~-~~~~~d~~~~   59 (286)
T 3ius_A            4 MTGTLLSF-GHGYTARVLSRALAPQGWRIIGTSRNPDQMEAIRASGA-EPLLWPGEEP   59 (286)
T ss_dssp             -CCEEEEE-TCCHHHHHHHHHHGGGTCEEEEEESCGGGHHHHHHTTE-EEEESSSSCC
T ss_pred             CCCEEEEE-CCCHHHHHHHHHHHHCCCEEEEEECCHHHHHHHHHCCC-EEEECCCCCH
T ss_conf             89838998-96199999999999789989999488365578875696-7996462001


No 268
>3lm8_A Thiamine pyrophosphokinase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: VIB; 2.60A {Bacillus subtilis}
Probab=20.13  E-value=17  Score=16.05  Aligned_cols=96  Identities=6%  Similarity=-0.129  Sum_probs=46.7

Q ss_pred             CCEEEEECCCHHH-HHHHHHHHHHCCCEEEEECCHHHHHHHHHHCCCCCEEEECCCCCCCCHHHHHHHHCCCCCCCEEEE
Q ss_conf             9779997399899-999999999889899999997999999971799948997078998773899996143488973999
Q gi|254780892|r    1 MDSLLLVDSSHIV-RKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYY   79 (133)
Q Consensus         1 m~~ILiVDD~~~~-r~~l~~~L~~~g~~v~~a~~g~eAl~~~~~~~~pdlii~D~~mP~~~~l~~~ir~~~~~~~~pii~   79 (133)
                      ||+|+||-.-+.. ...+...++ .+--+.+|..|..-+...  +..||+|+=|+.==+- +.....+.    ...+++.
T Consensus         1 Mk~i~IvagG~~~~~~~l~~~~~-~~~~vIaaDgG~~~l~~~--gi~Pd~iiGDfDSi~~-~~~~~~~~----~~~~i~~   72 (222)
T 3lm8_A            1 MKTINIVAGGPKNLIPDLTGYTD-EHTLWIGVDKGTVTLLDA--GIIPVEAFGDFDSITE-QERRRIEK----AAPALHV   72 (222)
T ss_dssp             -CEEEEECSSCGGGSCCSGGGCC-TTEEEEEETHHHHHHHHH--TCCCSEEESCSTTSCH-HHHHHHHH----HCTTCEE
T ss_pred             CCEEEEEECCCCCCCHHHHHHCC-CCCEEEEECCHHHHHHHC--CCCCCEEECCCCCCCH-HHHHHHHH----CCCCEEE
T ss_conf             96999998999766776886314-488899984189999977--9986989726889975-78789985----4983599


Q ss_pred             EECCCCHHHHHHH----HHCCCCEEEECC
Q ss_conf             9638998999999----976998899769
Q gi|254780892|r   80 LLMEVDFEKMIAG----ARAGANSFLLKP  104 (133)
Q Consensus        80 lT~~~~~~~~~~a----~~~Ga~~yl~KP  104 (133)
                      ....-+..+...|    .+.|+...+.=-
T Consensus        73 ~~~dkD~TD~ekAl~~~~~~~~~~i~i~G  101 (222)
T 3lm8_A           73 YQAEKDQTDLDLALDWALEKQPDIIQIFG  101 (222)
T ss_dssp             ECCCSSSCHHHHHHHHHHHHCCSEEEEES
T ss_pred             CCHHHCCCHHHHHHHHHHHCCCCEEEEEE
T ss_conf             58453658899999999974999899990


No 269
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA; 1.70A {Pyrococcus horikoshii OT3}
Probab=20.07  E-value=42  Score=13.76  Aligned_cols=82  Identities=9%  Similarity=0.114  Sum_probs=40.5

Q ss_pred             HHHHCCCEEEEECCHH--HHHHHHHH---CCCCCEEEECCCC----CCCCHHHHHHHHCCCCCCCEEEEEECCCCHHHHH
Q ss_conf             9998898999999979--99999971---7999489970789----9877389999614348897399996389989999
Q gi|254780892|r   20 LFNDFGFMVFEATSVC--EAREFCEK---ELLPNYLVIDESM----EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMI   90 (133)
Q Consensus        20 ~L~~~g~~v~~a~~g~--eAl~~~~~---~~~pdlii~D~~m----P~~~~l~~~ir~~~~~~~~pii~lT~~~~~~~~~   90 (133)
                      .+...|+.+..++++.  .+...+..   ...+|.|+.--..    |+..-+...++.....+. .++++ +.+-..+..
T Consensus       105 ~l~~~g~~~~i~Sn~~~~~~~~~l~~~gl~~~fd~i~~s~~~~~~KP~~~~~~~~~~~~~~~p~-~~v~I-gD~~~~Di~  182 (241)
T 2hoq_A          105 RLKELGYELGIITDGNPVKQWEKILRLELDDFFEHVIISDFEGVKKPHPKIFKKALKAFNVKPE-EALMV-GDRLYSDIY  182 (241)
T ss_dssp             HHHHHTCEEEEEECSCHHHHHHHHHHTTCGGGCSEEEEGGGGTCCTTCHHHHHHHHHHHTCCGG-GEEEE-ESCTTTTHH
T ss_pred             HHHHCCCEEEEECCCCHHHHHHHHHHHHCCCCCCCEEEHHHCCCCCCCHHHHHHHHHHHCCCHH-HEEEE-CCCCHHHHH
T ss_conf             9985894499835997899999876541023322001012304779828999999998258805-61575-358476699


Q ss_pred             HHHHCCCCEEEEC
Q ss_conf             9997699889976
Q gi|254780892|r   91 AGARAGANSFLLK  103 (133)
Q Consensus        91 ~a~~~Ga~~yl~K  103 (133)
                      .|.++|...+...
T Consensus       183 ~A~~~G~~~i~v~  195 (241)
T 2hoq_A          183 GAKRVGMKTVWFR  195 (241)
T ss_dssp             HHHHTTCEEEEEC
T ss_pred             HHHHCCCEEEEEC
T ss_conf             9998699899986


Done!