BLAST/PSIBLAST alignment of GI: 254780892 and GI: 190893161 at iteration 1
>gi|190893161|ref|YP_001979703.1| two-component response regulator protein [Rhizobium etli CIAT 652] Length = 120
>gi|218516915|ref|ZP_03513755.1| probable two-component response regulator protein [Rhizobium etli 8C-3] Length = 120
>gi|190698440|gb|ACE92525.1| probable two-component response regulator protein [Rhizobium etli CIAT 652] Length = 120
 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S IVRKVG+ + ++  F+V EA++  EA + C+ EL P YL++D  MEG L
Sbjct: 1   MQRFMITDNSDIVRKVGKRILSELDFLVSEASTASEALQRCQAEL-PEYLIVDSGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + IA +R M  G DV +YY ++E D +K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  DLIAAIRAMDGGKDVKIYYCVIEADLKKLMAGKRAGATDFLLKPFDRKIL 109