BLAST/PSIBLAST alignment of GI: 254780892 and GI: 86358933 at iteration 1
>gi|86358933|ref|YP_470825.1| two-component response regulator protein [Rhizobium etli CFN 42] Length = 120
>gi|86283035|gb|ABC92098.1| probable two-component response regulator protein [Rhizobium etli CFN 42] Length = 120
 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S IVRKVG+ + ++  F+V EA++  EA + C+ EL P YL++D  MEG L
Sbjct: 1   MQRFMITDNSDIVRKVGKRILSELDFLVSEASNAAEALQRCQTEL-PEYLIVDSGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + IA +R M  G +V +YY ++E D +K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  DLIAAIRAMDGGKEVKIYYCVIEADLKKLMAGKRAGATDFLLKPFDRKIL 109