BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.


Reference for composition-based statistics starting in round 2:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780892|ref|YP_003065305.1| probable two-component
response regulator protein [Candidatus Liberibacter asiaticus str.
psy62]
         (133 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done


Results from round 1


>gi|254780892|ref|YP_003065305.1| probable two-component response regulator protein [Candidatus
           Liberibacter asiaticus str. psy62]
 gi|254040569|gb|ACT57365.1| probable two-component response regulator protein [Candidatus
           Liberibacter asiaticus str. psy62]
          Length = 133

 Score =  273 bits (699), Expect = 4e-72,   Method: Compositional matrix adjust.
 Identities = 133/133 (100%), Positives = 133/133 (100%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL
Sbjct: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM
Sbjct: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120

Query: 121 QKSKDENQFLDAI 133
           QKSKDENQFLDAI
Sbjct: 121 QKSKDENQFLDAI 133


>gi|315122691|ref|YP_004063180.1| probable two-component response regulator protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
 gi|313496093|gb|ADR52692.1| probable two-component response regulator protein [Candidatus
           Liberibacter solanacearum CLso-ZC1]
          Length = 133

 Score =  192 bits (488), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 90/133 (67%), Positives = 111/133 (83%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M SLLLVDSSHIVRKVG  LF+ FGF V+EA+++ EAR+ CEKE LP+YL+IDE ME  L
Sbjct: 1   MPSLLLVDSSHIVRKVGTKLFSSFGFTVYEASNIYEARKLCEKESLPDYLIIDEFMEDAL 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           EFI  +R+MPLG +VF+YYLL+EVDF+KMIAGARAG NSFLLKPFNRE ++FAMR+LPQ+
Sbjct: 61  EFITCIRKMPLGINVFIYYLLIEVDFDKMIAGARAGVNSFLLKPFNREAIQFAMRDLPQI 120

Query: 121 QKSKDENQFLDAI 133
            + KD N   ++I
Sbjct: 121 NQLKDGNNLSNSI 133


>gi|190893161|ref|YP_001979703.1| two-component response regulator protein [Rhizobium etli CIAT 652]
 gi|218516915|ref|ZP_03513755.1| probable two-component response regulator protein [Rhizobium etli
           8C-3]
 gi|190698440|gb|ACE92525.1| probable two-component response regulator protein [Rhizobium etli
           CIAT 652]
          Length = 120

 Score =  115 bits (288), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S IVRKVG+ + ++  F+V EA++  EA + C+ EL P YL++D  MEG L
Sbjct: 1   MQRFMITDNSDIVRKVGKRILSELDFLVSEASTASEALQRCQAEL-PEYLIVDSGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + IA +R M  G DV +YY ++E D +K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  DLIAAIRAMDGGKDVKIYYCVIEADLKKLMAGKRAGATDFLLKPFDRKIL 109


>gi|218461319|ref|ZP_03501410.1| probable two-component response regulator protein [Rhizobium etli
           Kim 5]
 gi|218660685|ref|ZP_03516615.1| probable two-component response regulator protein [Rhizobium etli
           IE4771]
 gi|218675162|ref|ZP_03524831.1| probable two-component response regulator protein [Rhizobium etli
           GR56]
 gi|327190953|gb|EGE58007.1| putative two-component response regulator protein [Rhizobium etli
           CNPAF512]
          Length = 120

 Score =  114 bits (286), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S IVRKVG+ + ++  F+V EA++  EA + C+ EL P YL++D  MEG L
Sbjct: 1   MQRFMITDNSDIVRKVGKRILSELDFLVSEASNASEALQRCQAEL-PEYLIVDSGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + IA +R M  G DV +YY ++E D +K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  DLIAAIRAMDGGKDVKIYYCVIEADLKKLMAGKRAGATDFLLKPFDRKIL 109


>gi|227823288|ref|YP_002827260.1| putative two-component response regulator protein [Sinorhizobium
           fredii NGR234]
 gi|227342289|gb|ACP26507.1| putative two-component response regulator protein [Sinorhizobium
           fredii NGR234]
          Length = 120

 Score =  114 bits (286), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 75/110 (68%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  L++ D S +VRKVG+ + +  GF+V EA S  EA   CE EL PN L++D  ++G L
Sbjct: 1   MRRLMIADGSDVVRKVGKRILSGMGFLVLEAPSSLEALVRCEAEL-PNILIVDSGLDGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E IA++R++  G  V +YY ++E D  KM+AG RAGA+ FLLKPF+R+ L
Sbjct: 60  ELIANIRRLSEGASVRIYYCVVEADLRKMMAGKRAGADDFLLKPFDRKIL 109


>gi|222086834|ref|YP_002545368.1| two-component response regulator protein [Agrobacterium radiobacter
           K84]
 gi|221724282|gb|ACM27438.1| two-component response regulator protein [Agrobacterium radiobacter
           K84]
          Length = 120

 Score =  114 bits (284), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 74/110 (67%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S +VRKVG+ + ++  F+V EA    EA   C+ E+ P+YL++D  MEG L
Sbjct: 1   MQRFMITDTSDVVRKVGKRILSELDFLVSEAGDAREALARCQAEI-PDYLIVDAGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E I+ +R MP G DV +YY ++E D  K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  ELISSIRAMPNGKDVKIYYCVIEADLRKLMAGKRAGATDFLLKPFDRKIL 109


>gi|150397805|ref|YP_001328272.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|150029320|gb|ABR61437.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
          Length = 120

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 75/110 (68%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  L++ D S +VRKVG+ + +  GF+V EA S  EA   CE EL PN L++D  ++G L
Sbjct: 1   MRRLMIADGSDVVRKVGKRILSGMGFLVSEAPSSLEALVRCEAEL-PNILIVDAGLDGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + I ++R++P G  V +YY +++ D  KM+AG RAGA+ FLLKPF+R+ L
Sbjct: 60  DLIGNIRRLPEGASVRIYYCVVQADLRKMMAGKRAGADDFLLKPFDRKIL 109


>gi|86358933|ref|YP_470825.1| two-component response regulator protein [Rhizobium etli CFN 42]
 gi|86283035|gb|ABC92098.1| probable two-component response regulator protein [Rhizobium etli
           CFN 42]
          Length = 120

 Score =  113 bits (282), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S IVRKVG+ + ++  F+V EA++  EA + C+ EL P YL++D  MEG L
Sbjct: 1   MQRFMITDNSDIVRKVGKRILSELDFLVSEASNAAEALQRCQTEL-PEYLIVDSGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + IA +R M  G +V +YY ++E D +K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  DLIAAIRAMDGGKEVKIYYCVIEADLKKLMAGKRAGATDFLLKPFDRKIL 109


>gi|15966472|ref|NP_386825.1| putative 2-component receiver domain protein [Sinorhizobium
           meliloti 1021]
 gi|307300491|ref|ZP_07580271.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
 gi|307318356|ref|ZP_07597791.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|15075743|emb|CAC47298.1| Putative 2-component receiver domain protein [Sinorhizobium
           meliloti 1021]
 gi|306896038|gb|EFN26789.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|306904657|gb|EFN35241.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
          Length = 122

 Score =  112 bits (281), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 50/107 (46%), Positives = 75/107 (70%), Gaps = 1/107 (0%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           L++ D S +VRKVG+ + +  GF+V EA S  EA   CE EL PN L++D  ++G L+ I
Sbjct: 6   LMIADGSDVVRKVGKRILSGMGFLVSEAPSSLEALVRCEAEL-PNILIVDAGLDGALDLI 64

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            ++R++P G  V +YY +++ D +KM+AG RAGA+ FLLKPF+R+ L
Sbjct: 65  GNIRRLPEGASVRIYYCVVQADLKKMMAGKRAGADDFLLKPFDRKIL 111


>gi|209550656|ref|YP_002282573.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536412|gb|ACI56347.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 120

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S IVRKVG+ + ++  F+V EA++  EA + C+ EL P YL++D  MEG L
Sbjct: 1   MQRFMITDNSDIVRKVGKRILSELDFLVSEASNAGEALQRCQTEL-PEYLIVDSGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + IA +R M  G +V +YY ++E D +K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  DLIAAIRAMDGGKEVKIYYCVVEADLKKLMAGKRAGATDFLLKPFDRKIL 109


>gi|218682348|ref|ZP_03529949.1| response regulator receiver protein [Rhizobium etli CIAT 894]
          Length = 120

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S IVRKVG+ + ++  F+V EA++  EA + C+ EL P YL++D  MEG L
Sbjct: 1   MQRFMITDNSDIVRKVGKRILSELDFLVSEASNAGEALQRCQAEL-PEYLIVDSGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + IA +R M  G +V +YY ++E D +K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  DLIAAIRAMDGGKEVKIYYCVVEADLKKLMAGKRAGATDFLLKPFDRKIL 109


>gi|116253500|ref|YP_769338.1| two-component response regulator transcriptional regulatory protein
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|241206027|ref|YP_002977123.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|115258148|emb|CAK09249.1| putative two-component response regulator transcriptional
           regulatory protein [Rhizobium leguminosarum bv. viciae
           3841]
 gi|240859917|gb|ACS57584.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 120

 Score =  112 bits (279), Expect = 2e-23,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M   ++ D+S IVRKVG+ + ++  F+V EA++  EA + C+ EL P YL++D  MEG L
Sbjct: 1   MQRFMITDNSDIVRKVGKRILSELDFLVSEASNAGEALQRCQAEL-PEYLIVDSGMEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + IA +R M  G +V +YY ++E D +K++AG RAGA  FLLKPF+R+ L
Sbjct: 60  DLIAAIRAMEGGKEVKIYYCVVEADLKKLMAGKRAGATDFLLKPFDRKIL 109


>gi|222149589|ref|YP_002550546.1| two component response regulator [Agrobacterium vitis S4]
 gi|221736571|gb|ACM37534.1| two component response regulator [Agrobacterium vitis S4]
          Length = 119

 Score =  110 bits (275), Expect = 7e-23,   Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 76/110 (69%), Gaps = 1/110 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M +L++ DSS IVRKVGR + ++ GF V EA++  EA   CE +L P+ +++D  +EG L
Sbjct: 1   MKNLIIADSSDIVRKVGRKILSELGFGVTEASTAREAMLACEAQL-PHVIIVDSGLEGAL 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             I ++R MP G  V ++Y ++E D + M+ G RAGA+ FLLKPF+R+TL
Sbjct: 60  GLITNIRAMPEGKTVRIFYCVIEADLKHMMQGKRAGASDFLLKPFDRKTL 109


>gi|163758754|ref|ZP_02165841.1| putative two-component response regulator transcriptional
           regulatory protein [Hoeflea phototrophica DFL-43]
 gi|162284044|gb|EDQ34328.1| putative two-component response regulator transcriptional
           regulatory protein [Hoeflea phototrophica DFL-43]
          Length = 116

 Score = 97.8 bits (242), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 45/106 (42%), Positives = 70/106 (66%), Gaps = 1/106 (0%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIA 64
           ++ D S ++ KV + +     ++V EA++  EA   C+ EL P  L++D  M G L+ I+
Sbjct: 1   MIADDSAVICKVAKRILTGLDYLVVEASNAGEAMIMCDAEL-PEVLLVDSGMTGALDLIS 59

Query: 65  HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            VRQM  G DV ++YL++E +F++M+ G RAGA+ FLLKPF+R TL
Sbjct: 60  AVRQMEGGKDVQIHYLMIEKEFKQMMIGKRAGADGFLLKPFDRRTL 105


>gi|300022394|ref|YP_003755005.1| response regulator receiver protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299524215|gb|ADJ22684.1| response regulator receiver protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 122

 Score = 75.5 bits (184), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 65/114 (57%), Gaps = 3/114 (2%)

Query: 6   LVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFI 63
           +VD S I+RK  R +F + GF V EA     A E    E  P+Y+++D  +     +EFI
Sbjct: 6   IVDDSDIIRKFTRLIFENLGFRVSEADGPVAAFERLRTES-PDYILVDWRLPDTNSIEFI 64

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           A +R +PL    ++ YL+ E +  ++     AGA+SFLLKPFNRE +   + E+
Sbjct: 65  AKLRTLPLDQRPYIIYLVTENEPHEIKRALAAGADSFLLKPFNREIIEMKLAEI 118


>gi|85710378|ref|ZP_01041443.1| CheY protein [Erythrobacter sp. NAP1]
 gi|85689088|gb|EAQ29092.1| CheY protein [Erythrobacter sp. NAP1]
          Length = 121

 Score = 75.1 bits (183), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 66/117 (56%), Gaps = 3/117 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S L+VD S ++RKV RH+    GF V EA +  E  E CE   +P+ +++D +M  + 
Sbjct: 1   MKSCLVVDDSRVIRKVSRHILETLGFAVEEAENGREGLEACEAS-MPDVVLLDWNMPVMT 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +EFI  +R+ P G    V +   E D   +     AGA+ +++KPF+ ETL+  ++
Sbjct: 60  GIEFITQLRKRPGGDKPKVVFCTTENDVAHIREAISAGADEYVMKPFDHETLQIKLQ 116


>gi|254473174|ref|ZP_05086572.1| chemotaxis response regulator, CheY2 [Pseudovibrio sp. JE062]
 gi|211957895|gb|EEA93097.1| chemotaxis response regulator, CheY2 [Pseudovibrio sp. JE062]
          Length = 121

 Score = 74.3 bits (181), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 67/119 (56%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   L+VD S ++RKV R +  D GF + EA    +A + C K  +P+ +++D +M  + 
Sbjct: 1   MKKCLVVDDSSVIRKVARRILEDIGFEITEAEDGQKALDAC-KASMPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LEF+A +R+   G +  V +   E D   +    RAGAN +++KPF+RE L    +E+
Sbjct: 60  GLEFLAKLREEDGGEEPVVVFCTTENDVAHITKAIRAGANEYIMKPFDREILSAKFQEV 118


>gi|146343754|ref|YP_001208802.1| chemotaxis protein CheY [Bradyrhizobium sp. ORS278]
 gi|146196560|emb|CAL80587.1| Chemotaxis protein cheY [Bradyrhizobium sp. ORS278]
          Length = 129

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 39/123 (31%), Positives = 69/123 (56%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S +VRK+ R +  + GF V EA    +A E C K  LP+ +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVVRKIARRILEELGFSVVEAEDGEQALELCTKS-LPDAILLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             +F+  +R++P G    V +   E D + +     AGAN +++KPF++E +    +E+ 
Sbjct: 60  GYDFLGRLRRLPGGDGPKVVFCTTENDIDHISRALNAGANEYIMKPFDKEIVAAKFQEVG 119

Query: 119 QMQ 121
            +Q
Sbjct: 120 LIQ 122


>gi|148252128|ref|YP_001236713.1| chemotaxis protein CheY [Bradyrhizobium sp. BTAi1]
 gi|146404301|gb|ABQ32807.1| Chemotaxis protein cheY [Bradyrhizobium sp. BTAi1]
          Length = 129

 Score = 73.2 bits (178), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 41/129 (31%), Positives = 70/129 (54%), Gaps = 3/129 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S L+VD S +VRK+ R +  + GF V EA    +A E C K  LP  +++D +M  + 
Sbjct: 1   MKSCLVVDDSSVVRKIARRILEELGFSVVEAEDGEQALELCTKS-LPEAILLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             +F+  +R++P G    V +   E D + +     AGAN +++KPF++E +    +E+ 
Sbjct: 60  GYDFLGRLRRLPGGEGPKVVFCTTENDIDHISRALNAGANEYIMKPFDKEIVAAKFQEVG 119

Query: 119 QMQKSKDEN 127
            +Q    E+
Sbjct: 120 LIQAMSAES 128


>gi|85713638|ref|ZP_01044628.1| CheY protein [Nitrobacter sp. Nb-311A]
 gi|85699542|gb|EAQ37409.1| CheY protein [Nitrobacter sp. Nb-311A]
          Length = 121

 Score = 70.5 bits (171), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 67/119 (56%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +   F F + EA    +A E C +E LP+ +++D +M  + 
Sbjct: 1   MKTCLIVDDSSVIRKVARRILEGFSFHIVEAEDGEKALEVCRRE-LPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R+MP G    V +   E D   +     AGAN +++KPF+++ +    +E+
Sbjct: 60  GYEFLRNLRRMPGGDQPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEI 118


>gi|13472496|ref|NP_104063.1| two-component response regulator [Mesorhizobium loti MAFF303099]
 gi|14023242|dbj|BAB49849.1| two-component response regulator [Mesorhizobium loti MAFF303099]
          Length = 122

 Score = 70.1 bits (170), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 60/112 (53%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   + VD S ++RKV + +      +V EA S  +A E C  ++ P+ +V+D ++  V 
Sbjct: 1   MKRCMFVDDSSVIRKVAKRILGGSDMVVIEAASGLDALEMCAADM-PDIIVVDGALPDVQ 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            ++ I  VR M   T   +   L+E+D   ++   RAGA  +LLKPFNR  L
Sbjct: 60  AVDLIRRVRAMESPTRPQILISLVELDIASIMRAKRAGAQGYLLKPFNRPQL 111


>gi|328542570|ref|YP_004302679.1| Response regulator receiver domain protein (CheY-like) [polymorphum
           gilvum SL003B-26A1]
 gi|326412316|gb|ADZ69379.1| Response regulator receiver domain protein (CheY-like) [Polymorphum
           gilvum SL003B-26A1]
          Length = 121

 Score = 69.7 bits (169), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   L+VD S ++RKV R +  D  F + EA    +A + C K + P+ +++D +M  + 
Sbjct: 1   MKQCLVVDDSSVIRKVARRILEDMQFQITEAEDGQQALDACRKSM-PDAILLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LEF+  +R+   G    V +   E D   +    RAGAN +++KPF+RE +    +E+
Sbjct: 60  GLEFLTSLRREAGGEKPIVVFCTTENDVAHIARAIRAGANEYIMKPFDREIVEAKFQEV 118


>gi|158422287|ref|YP_001523579.1| chemotaxis response regulator [Azorhizobium caulinodans ORS 571]
 gi|158329176|dbj|BAF86661.1| chemotaxis response regulator [Azorhizobium caulinodans ORS 571]
          Length = 127

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 70/126 (55%), Gaps = 5/126 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---E 57
           M + L+VD S +VRKV R +  D  F V EA     A + CE E +P+ +++D +M   E
Sbjct: 1   MKTCLVVDDSGVVRKVARRILEDLSFNVREAADGQAALKACE-EAMPDGILLDWNMPVME 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+ EF+  +R+   G    V +     D E +     AGAN +++KPF+++ LR  + E+
Sbjct: 60  GI-EFLELLRKTEGGDVPRVIFCTTNNDIEHITRAIEAGANEYIMKPFDQDILREKLEEV 118

Query: 118 PQMQKS 123
             ++K+
Sbjct: 119 GLLEKA 124


>gi|260462503|ref|ZP_05810710.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
 gi|259031699|gb|EEW32968.1| response regulator receiver protein [Mesorhizobium opportunistum
           WSM2075]
          Length = 122

 Score = 69.3 bits (168), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   + VD S ++RKV + +      M+ EA S  +A E C  ++ P+ +V+D ++  V 
Sbjct: 1   MKRCMFVDDSSVIRKVAKRILGGSDMMIIEAASGLDALEMCAADM-PDIIVVDGALPDVQ 59

Query: 60  -LEFIAHVRQM--PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            ++ I  VR M  P+   + +   L+E+D   ++   RAGA  +LLKPFNR  L
Sbjct: 60  AVDLIRRVRAMESPIRPQILIS--LVELDIASIMRAKRAGAQGYLLKPFNRPQL 111


>gi|27377305|ref|NP_768834.1| chemotaxis two-component response regulator [Bradyrhizobium
           japonicum USDA 110]
 gi|27350448|dbj|BAC47459.1| chemotaxis two-component response regulator [Bradyrhizobium
           japonicum USDA 110]
          Length = 121

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C K  LP+ +++D +M  + 
Sbjct: 1   MRTCLVVDDSSVIRKVARRILEGLDFQILEAEDGEKALEAC-KRGLPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ H+R+MP G    V +   E D   +     AGAN +++KPF+++ +    +E+
Sbjct: 60  GYEFLGHLRRMPGGDQPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEV 118


>gi|197103763|ref|YP_002129140.1| chemotaxis protein CheYIV [Phenylobacterium zucineum HLK1]
 gi|196477183|gb|ACG76711.1| chemotaxis protein CheYIV [Phenylobacterium zucineum HLK1]
          Length = 132

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 63/112 (56%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +  D GF V EA    EA  +C  + +P+ +++D  M  + 
Sbjct: 1   MKTCLVVDDSRVIRKVARRILEDLGFEVAEAGDGLEAMSWCHAD-MPDAILLDWRMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            LEF+  +R  P G    V +  +E D E++     AGA+ +++KPF+ E +
Sbjct: 60  GLEFVRRLRAEPGGDRPRVVFCSVENDLERIREALDAGADEYIMKPFDGEIV 111


>gi|220921685|ref|YP_002496986.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
 gi|219946291|gb|ACL56683.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
          Length = 121

 Score = 68.9 bits (167), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 67/119 (56%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +    GF V EA    +A + C +E +P+ +++D  M  + 
Sbjct: 1   MRTCLIVDDSAVIRKVARRILEGIGFRVAEAEDGTDALDLC-REAMPDAILLDWRMPQMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+  +R++P G+   V +   E D   +     AGA+ +++KPF+++ +   ++E+
Sbjct: 60  GYEFLRELRRLPDGSRPKVVFCTTENDVASIARALHAGADEYIMKPFDKDIMTAKLQEV 118


>gi|307944610|ref|ZP_07659950.1| chemotaxis protein CheY [Roseibium sp. TrichSKD4]
 gi|307772359|gb|EFO31580.1| chemotaxis protein CheY [Roseibium sp. TrichSKD4]
          Length = 121

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   L+VD S ++RKV R +  D  F + EA    +A + C K + P+ +++D +M  + 
Sbjct: 1   MKQCLVVDDSSVIRKVARRILEDLNFEITEAEDGQQALDECRKNM-PDAILLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LEF+  +R    G +  V +   E D   +    RAGAN +++KPF+RE +    +E+
Sbjct: 60  GLEFLTSLRGEDGGENPIVVFCTTENDVAHIARAIRAGANEYIMKPFDREIVEAKFQEV 118


>gi|118588299|ref|ZP_01545708.1| response regulator receiver domain protein [Stappia aggregata IAM
           12614]
 gi|118439005|gb|EAV45637.1| response regulator receiver domain protein [Stappia aggregata IAM
           12614]
          Length = 121

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   L+VD S ++RKV R +  D  F + EA    +A + C K  +P+ +++D +M  + 
Sbjct: 1   MKQCLVVDDSSVIRKVARRILEDMNFEITEAEDGQQALDECRK-TMPDAILLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LEF+  +R    G +  V +   E D   +    RAGAN +++KPF+RE +    +E+
Sbjct: 60  GLEFLTSLRAEEGGENPIVVFCTTENDVAHIARAIRAGANEYIMKPFDREIVEAKFQEV 118


>gi|83859263|ref|ZP_00952784.1| chemotaxis protein CheYIV [Oceanicaulis alexandrii HTCC2633]
 gi|83852710|gb|EAP90563.1| chemotaxis protein CheYIV [Oceanicaulis alexandrii HTCC2633]
          Length = 121

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 62/112 (55%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV R +  D GF   EA    +A ++C+K  +P  +++D +M    
Sbjct: 1   MKTCLVVDDSRVIRKVARKIVEDLGFACEEAADGQQALDYCKKN-MPEAVLLDWNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            L+F+  +R+ P G    V +   E D   +    RAGA+ +++KPF+ + +
Sbjct: 60  GLDFLIKLREEPDGKKPVVVFCTTENDMAHITQALRAGADEYVMKPFDGDII 111


>gi|167644069|ref|YP_001681732.1| response regulator receiver protein [Caulobacter sp. K31]
 gi|167346499|gb|ABZ69234.1| response regulator receiver protein [Caulobacter sp. K31]
          Length = 121

 Score = 68.6 bits (166), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 62/112 (55%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV R +  D GF + EA    EA  +C +  +P+ +++D  M    
Sbjct: 1   MKTCLVVDDSRVIRKVARRVLEDIGFEIAEAADGVEALAWC-RAAMPDAVLLDWHMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +EF+ H+RQ P G    V +  +E   + +     AGA+ +++KPF+ + +
Sbjct: 60  GIEFLRHLRQEPGGQGPTVVFCTVENKIDSIREALDAGADEYIMKPFDGDII 111


>gi|92118835|ref|YP_578564.1| response regulator receiver domain-containing protein [Nitrobacter
           hamburgensis X14]
 gi|91801729|gb|ABE64104.1| response regulator receiver domain protein (CheY-like) [Nitrobacter
           hamburgensis X14]
          Length = 121

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +   F F + EA    +A + C++E LP+ +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVIRKVARRILEGFDFRIIEAEDGEKALDICKRE-LPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R MP G    V +   E D   +     AGAN +++KPF+++ +     E+
Sbjct: 60  GYEFLRNLRLMPGGDQPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFHEI 118


>gi|23016450|ref|ZP_00056206.1| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 121

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M S L+VD S ++R V + + ++  F   EA     A E C K  +P+ +++D +M    
Sbjct: 1   MKSCLIVDDSKVIRMVAKKILHELSFKTEEAEDGAAALEAC-KRAMPDAVLLDWNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +EF+  +RQ+P G    V +   E D E +     AGAN +++KPF+ E L+
Sbjct: 60  GIEFLRAMRQLPGGDHPIVVFCTTENDIEHIQEAITAGANEYIMKPFDSEILQ 112


>gi|319781795|ref|YP_004141271.1| response regulator receiver [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
 gi|317167683|gb|ADV11221.1| response regulator receiver [Mesorhizobium ciceri biovar biserrulae
           WSM1271]
          Length = 134

 Score = 67.8 bits (164), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/114 (33%), Positives = 62/114 (54%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   + VD S ++RKV + +      +V EA S  +A E C  ++ P+ +V+D ++  V 
Sbjct: 1   MKRCMFVDDSSVIRKVAKRILGGSEMIVIEAASGLDALEMCAADM-PDIIVVDGALPDVP 59

Query: 60  -LEFIAHVRQM--PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            ++ I  VR M  P+   + +   L+E+D   ++   RAGA  +LLKPFNR  L
Sbjct: 60  AVDLIRRVRAMESPIRPQILIS--LVELDIASIMRAKRAGAQGYLLKPFNRPQL 111


>gi|254501070|ref|ZP_05113221.1| response regulator receiver domain, putative [Labrenzia alexandrii
           DFL-11]
 gi|222437141|gb|EEE43820.1| response regulator receiver domain, putative [Labrenzia alexandrii
           DFL-11]
          Length = 121

 Score = 67.4 bits (163), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 63/119 (52%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   L+VD S ++RKV R +  D  F + EA    +A + C K  +P+ +++D +M  + 
Sbjct: 1   MKQCLVVDDSSVIRKVARRILEDMNFEIVEAEDGQKALDECRK-TMPDAILLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LEF+  +R    G    V +   E D   +    RAGAN +++KPF+RE +    +E+
Sbjct: 60  GLEFLTSLRAEEGGESPVVVFCTTENDVAHIARAIRAGANEYIMKPFDREIVEAKFQEV 118


>gi|170742945|ref|YP_001771600.1| response regulator receiver protein [Methylobacterium sp. 4-46]
 gi|168197219|gb|ACA19166.1| response regulator receiver protein [Methylobacterium sp. 4-46]
          Length = 121

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +    GF V EA    +A   C +E +P+ +++D  M  + 
Sbjct: 1   MRTCLIVDDSAVIRKVARRILEGIGFRVAEAEDGADAIGLC-REAMPDAILLDWRMPQMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+  +R++P G    V +   E D   +     AGA+ +++KPF+++ +   ++E+
Sbjct: 60  GYEFLRELRRLPSGEHPKVVFCTTENDVSSIARALHAGADEYIMKPFDKDIITAKLQEV 118


>gi|329891304|ref|ZP_08269647.1| cheY protein [Brevundimonas diminuta ATCC 11568]
 gi|328846605|gb|EGF96169.1| cheY protein [Brevundimonas diminuta ATCC 11568]
          Length = 127

 Score = 67.0 bits (162), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 66/122 (54%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S I+RKV R +  D  F V EA    EA ++C+   +P  +++D  M  +  L
Sbjct: 5   TCLIVDDSRIIRKVARRILEDLSFDVAEAADGAEALDYCQAA-MPQVVLLDWQMPVMDGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F+  +R +P G    V +  +E   +++     AGA+ +++KPF+ E L+  + E+  +
Sbjct: 64  AFLRRLRDLPEGRAPKVLFCSVETRADRIAEALSAGADEYVMKPFDGEILQAKLAEVGVV 123

Query: 121 QK 122
           Q 
Sbjct: 124 QS 125


>gi|75674720|ref|YP_317141.1| CheY protein [Nitrobacter winogradskyi Nb-255]
 gi|74419590|gb|ABA03789.1| CheY protein [Nitrobacter winogradskyi Nb-255]
          Length = 121

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 66/119 (55%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +   F F + EA +  +  E C  EL P+ +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVIRKVARRILEGFNFRIVEAENGEKGLEACRLEL-PDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R+MP G    V +   E D   +     AGAN +++KPF+++ +    +E+
Sbjct: 60  GYEFLRNLRRMPGGDQPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEI 118


>gi|146338555|ref|YP_001203603.1| chemotaxis protein CheY [Bradyrhizobium sp. ORS278]
 gi|148257786|ref|YP_001242371.1| chemotaxis protein CheY [Bradyrhizobium sp. BTAi1]
 gi|146191361|emb|CAL75366.1| Chemotaxis protein cheY [Bradyrhizobium sp. ORS278]
 gi|146409959|gb|ABQ38465.1| Chemotaxis protein cheY [Bradyrhizobium sp. BTAi1]
          Length = 121

 Score = 66.6 bits (161), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C K  LP+ +++D +M  + 
Sbjct: 1   MRTCLVVDDSSVIRKVARRILEGLDFQIVEAEDGEQALEIC-KRGLPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R+MP G    V +   E D   +     AGAN +++KPF+++ +    +E+
Sbjct: 60  GYEFLGNLRRMPGGDAPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEV 118


>gi|209886228|ref|YP_002290085.1| response regulator receiver [Oligotropha carboxidovorans OM5]
 gi|209874424|gb|ACI94220.1| response regulator receiver [Oligotropha carboxidovorans OM5]
          Length = 135

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C++ L P+ +++D +M  + 
Sbjct: 15  MKTCLVVDDSSVIRKVARRILEGLNFEIIEAEDGEKAMEVCKRSL-PDAVLLDWNMPVMD 73

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R MP G    V +   E D   +     AGAN +++KPF++E +    +E+
Sbjct: 74  GHEFLRNLRMMPNGEKPKVVFCTTENDVAHIARALHAGANEYIMKPFDKEIVTAKFQEV 132


>gi|209965051|ref|YP_002297966.1| chemotaxis protein CheY [Rhodospirillum centenum SW]
 gi|1621287|gb|AAB71331.1| CheY [Rhodospirillum centenum]
 gi|209958517|gb|ACI99153.1| chemotaxis protein CheY [Rhodospirillum centenum SW]
          Length = 121

 Score = 66.2 bits (160), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S L+VD S +VRKV R +  + GF   EA    +A E C  E +P+ +++D +M  + 
Sbjct: 1   MKSCLVVDDSRVVRKVARKILEELGFTCTEAEDGKQAMEKC-AEAMPDAVLLDWNMPVMT 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            +EF+  +R+M  G    V +   E D   +     AGAN +++KPF+ + ++   +++
Sbjct: 60  GIEFLRRLRKMTGGQAPKVVFCTTENDLAHIQEALSAGANEYIMKPFDSDIIQTKFQQV 118


>gi|83309423|ref|YP_419687.1| CheY-like receiver [Magnetospirillum magneticum AMB-1]
 gi|82944264|dbj|BAE49128.1| CheY-like receiver [Magnetospirillum magneticum AMB-1]
          Length = 123

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 62/113 (54%), Gaps = 3/113 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M S L+VD S ++R V + + ++  F   EA     A E C++ + P+ +++D +M    
Sbjct: 3   MKSCLIVDDSKVIRMVAKKILHELSFKTEEAEDGSAALEACKRSM-PDAVLLDWNMPVMN 61

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            ++F+  +RQ+P G    V +   E D E +     AGAN +++KPF+ E L+
Sbjct: 62  GIDFLRALRQLPGGEHPIVVFCTTENDIEHIQEAITAGANEYIMKPFDSEILQ 114


>gi|325108347|ref|YP_004269415.1| response regulator receiver protein [Planctomyces brasiliensis DSM
           5305]
 gi|324968615|gb|ADY59393.1| response regulator receiver protein [Planctomyces brasiliensis DSM
           5305]
          Length = 172

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 61/119 (51%), Gaps = 2/119 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD S  VR VGR + + FGF V EA     A    ++      +++D +M  + 
Sbjct: 51  MSKILVVDDSQTVRLVGRRIMSKFGFEVLEAEHGAAALNMVDQHPDVTAILLDWNMPVMD 110

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LEF+  +R +PL     V     E D E ++    AGAN +++KPF  + +R   +E+
Sbjct: 111 GLEFLKSLRALPLEKQPVVVMCTTENDMEHIMQAVEAGANEYIMKPFTEDIIRDKFQEV 169


>gi|299134360|ref|ZP_07027553.1| response regulator receiver protein [Afipia sp. 1NLS2]
 gi|298591107|gb|EFI51309.1| response regulator receiver protein [Afipia sp. 1NLS2]
          Length = 121

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/119 (31%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C K  LP+ +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVIRKVARRILEGLNFEIIEAEDGEKAMEVC-KRGLPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R MP G    V +   E D   +     AGAN +++KPF++E +    +E+
Sbjct: 60  GHEFLRNLRMMPNGEKPKVVFCTTENDVAHIARALHAGANEYIMKPFDKEIVTAKFQEV 118


>gi|239832476|ref|ZP_04680805.1| response regulator receiver protein [Ochrobactrum intermedium LMG
           3301]
 gi|239824743|gb|EEQ96311.1| response regulator receiver protein [Ochrobactrum intermedium LMG
           3301]
          Length = 127

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 61/108 (56%), Gaps = 3/108 (2%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEF 62
           LLVD S ++RKV R + ++      EA++  EA E C   + P+ +++D  +     LE 
Sbjct: 11  LLVDDSSVIRKVARRILSETIAEFAEASTGREALETCFSRM-PDVMLLDYDLPDMTALEV 69

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R MP G  + +   L E+D  +++   RAGAN ++LKPF+R  L
Sbjct: 70  VTELRAMPGGDKLRIILCLYELDVTRIMRAKRAGANGYILKPFDRAYL 117


>gi|85375078|ref|YP_459140.1| chemotaxis response regulator [Erythrobacter litoralis HTCC2594]
 gi|84788161|gb|ABC64343.1| chemotaxis response regulator [Erythrobacter litoralis HTCC2594]
          Length = 121

 Score = 65.9 bits (159), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 63/117 (53%), Gaps = 3/117 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++R+V RH+     F V EA    +A + C   + P+ +++D +M    
Sbjct: 1   MKTCLIVDDSRVIRRVSRHILESLDFSVEEAEHGQDALQKCAAAM-PDVILLDWNMPVMS 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +EFI  +R+ P G    V +   E D   +     AGA+ +++KPF+ ETL+  ++
Sbjct: 60  GIEFIHELRKRPDGAKPKVVFCTTENDVAHIREAIDAGADEYVMKPFDHETLQIKLQ 116


>gi|315497648|ref|YP_004086452.1| response regulator receiver protein [Asticcacaulis excentricus CB
           48]
 gi|315415660|gb|ADU12301.1| response regulator receiver protein [Asticcacaulis excentricus CB
           48]
          Length = 121

 Score = 65.5 bits (158), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/120 (31%), Positives = 63/120 (52%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES---ME 57
           M + L+VD S ++RKV R +  +  F V EA    EA  +C K  +PN +++D +   M+
Sbjct: 1   MKTCLVVDDSRVIRKVARRILENLQFEVAEANDGLEALNYC-KSSMPNAILLDWNMPVMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+  F+  +R+   GTD  V +   E D   +      GA+ +++KPF+ E L     E+
Sbjct: 60  GIT-FLRQLRKEEGGTDPVVVFCTTENDLAHITEALTEGASEYIMKPFDGEILEAKFTEV 118


>gi|149186906|ref|ZP_01865215.1| chemotaxis response regulator [Erythrobacter sp. SD-21]
 gi|148829415|gb|EDL47857.1| chemotaxis response regulator [Erythrobacter sp. SD-21]
          Length = 121

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 63/117 (53%), Gaps = 3/117 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV RH+    GF V EA +  E    C  E +P  +++D +M  + 
Sbjct: 1   MKTCLIVDDSRVIRKVSRHILETLGFTVDEAENGQEGLNKC-LESMPEVVLLDWNMPVMT 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +EFI  +R+   G    V +   E D   +     AGA+ +++KPF+ ETL+  ++
Sbjct: 60  GIEFIHELRKHEGGDKPKVVFCTTENDVAHIREAISAGADEYVMKPFDHETLQIKLQ 116


>gi|91978140|ref|YP_570799.1| response regulator receiver [Rhodopseudomonas palustris BisB5]
 gi|91684596|gb|ABE40898.1| response regulator receiver [Rhodopseudomonas palustris BisB5]
          Length = 121

 Score = 65.5 bits (158), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C K  LP+ +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVIRKVARRILEGLDFEIVEAEDGEKALEVC-KHGLPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R+MP G    V +   E D   +     AGAN +++KPF+++ +    +E+
Sbjct: 60  GYEFLRNLRRMPGGDQPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEV 118


>gi|148552996|ref|YP_001260578.1| response regulator receiver protein [Sphingomonas wittichii RW1]
 gi|148498186|gb|ABQ66440.1| response regulator receiver protein [Sphingomonas wittichii RW1]
          Length = 122

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 2/112 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV RH+     F V EA    EA + C+   LP+ +++D +M    
Sbjct: 1   MKTCLVVDDSKVIRKVARHILEALHFKVEEAGDGREALDRCQAGKLPDVILLDWNMPVMS 60

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +EF+  +          V +   E D   + A   AGA+ +++KPF+RETL
Sbjct: 61  GMEFLRSLGSSDFAQRPKVVFCTTENDVAHIRAAIEAGADEYMMKPFDRETL 112


>gi|86751026|ref|YP_487522.1| response regulator receiver domain-containing protein
           [Rhodopseudomonas palustris HaA2]
 gi|86574054|gb|ABD08611.1| response regulator receiver domain protein [Rhodopseudomonas
           palustris HaA2]
          Length = 121

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C K  LP+ +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVIRKVARRILEGLDFEIVEAEDGEKALELC-KNGLPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R+MP G    V +   E D   +     AGAN +++KPF+++ +    +E+
Sbjct: 60  GYEFLRNLRRMPGGDHPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEV 118


>gi|90425718|ref|YP_534088.1| response regulator receiver domain-containing protein
           [Rhodopseudomonas palustris BisB18]
 gi|90107732|gb|ABD89769.1| response regulator receiver domain protein (CheY-like)
           [Rhodopseudomonas palustris BisB18]
          Length = 121

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 62/112 (55%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C++ L P  +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVIRKVARRILEGLDFQIVEAEDGEKALEICKRSL-PEAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             EF+ ++R+MP G    V +   E D   +     AGAN +++KPF+++ +
Sbjct: 60  GYEFLRNLRRMPGGDQPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIV 111


>gi|254420392|ref|ZP_05034116.1| hypothetical protein BBAL3_2702 [Brevundimonas sp. BAL3]
 gi|196186569|gb|EDX81545.1| hypothetical protein BBAL3_2702 [Brevundimonas sp. BAL3]
          Length = 125

 Score = 65.1 bits (157), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 64/117 (54%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S I+RKV R +    G+ V EA    EA  +C   ++P+ L+ID +M  +  L
Sbjct: 5   TCLIVDDSRIIRKVARRIVEGLGYEVDEAADGAEALAYCSG-VMPDVLLIDWNMPVMDGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            F+  +R  P G    V +  +E   E++     AGA+ +++KPF+ E L+  + E+
Sbjct: 64  TFLRRLRASPGGEVPKVLFCTIETRPERIAEALAAGADDYVMKPFDGEILQSKLMEV 120


>gi|27375502|ref|NP_767031.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
 gi|27348639|dbj|BAC45656.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
          Length = 123

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 60/107 (56%), Gaps = 3/107 (2%)

Query: 6   LVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFI 63
           +VD S +VRK+ R +     F V EA    +A E C+++L P+ +++D +M  +   EF+
Sbjct: 1   MVDDSSVVRKIARRILEGLEFQVTEAEDGSKALEICQRQL-PDAVLLDWNMPVMDGFEFM 59

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            H+R++P G    V +   E +   +      GAN +++KPF+++ +
Sbjct: 60  GHMRRLPGGDQPKVVFCTTENNVAHIAQALSGGANEYIMKPFDKDII 106


>gi|144897865|emb|CAM74729.1| CheY-like receiver [Magnetospirillum gryphiswaldense MSR-1]
          Length = 121

 Score = 64.7 bits (156), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M S L+VD S ++R V + + ++  F   EA    +A ++C+ ++ P+ +++D +M    
Sbjct: 1   MKSCLIVDDSKVIRMVAKKILHELTFSTAEAEDGQQALDYCKVQM-PDAVLLDWNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            ++F+  +R++P G    V +   E D E +     AGAN +++KPF+ E L+
Sbjct: 60  GIDFLRELRKLPGGDHPVVVFCTTENDIEHIQEAITAGANEYIMKPFDSEILQ 112


>gi|114569211|ref|YP_755891.1| response regulator receiver protein [Maricaulis maris MCS10]
 gi|114339673|gb|ABI64953.1| response regulator receiver protein [Maricaulis maris MCS10]
          Length = 124

 Score = 64.3 bits (155), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 60/112 (53%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV R +  +  F   EA    EA E C K+ +P+ +++D +M    
Sbjct: 1   MKTCLIVDDSRVIRKVARKILEELDFECVEAGDGSEALEACRKQ-MPDAILLDWNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            L+F+  +R+   G    V +   E D   +    RAGA+ +++KPF+ + +
Sbjct: 60  GLDFVKALRREETGDQPVVVFCTTENDMAHITEALRAGADEYVMKPFDGDII 111


>gi|188580965|ref|YP_001924410.1| response regulator receiver protein [Methylobacterium populi BJ001]
 gi|179344463|gb|ACB79875.1| response regulator receiver protein [Methylobacterium populi BJ001]
          Length = 137

 Score = 64.3 bits (155), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 57/110 (51%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S ++RKV R +     F V +A     A   C  E +P  +++D +M  +   
Sbjct: 12  TALIVDDSAVIRKVARRILETLDFSVRDAEDGATALALC-AEAMPTVILLDWNMPNMDGY 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E +  +RQ PLG    + +   E D   +    RAGA+ +++KPF+RE +
Sbjct: 71  EVLRQLRQSPLGDRPKILFCTTENDVGAIARALRAGADEYIMKPFDREIM 120


>gi|39934699|ref|NP_946975.1| chemotaxis response regulator CheY2 [Rhodopseudomonas palustris
           CGA009]
 gi|192290215|ref|YP_001990820.1| response regulator receiver protein [Rhodopseudomonas palustris
           TIE-1]
 gi|316935203|ref|YP_004110185.1| response regulator receiver protein [Rhodopseudomonas palustris
           DX-1]
 gi|39648549|emb|CAE27070.1| chemotaxis response regulator, CheY2 [Rhodopseudomonas palustris
           CGA009]
 gi|192283964|gb|ACF00345.1| response regulator receiver protein [Rhodopseudomonas palustris
           TIE-1]
 gi|315602917|gb|ADU45452.1| response regulator receiver protein [Rhodopseudomonas palustris
           DX-1]
          Length = 121

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 65/119 (54%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C K  LP+ +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVIRKVARRILEGLDFEIVEAEDGEKALEAC-KHGLPDAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R+MP G    V +   E D   +     AGAN +++KPF+++ +    +E+
Sbjct: 60  GYEFLRNLRRMPGGDAPKVVFCTTENDVAHIARALHAGANEYIMKPFDKDIVTAKFQEV 118


>gi|302382296|ref|YP_003818119.1| response regulator receiver protein [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302192924|gb|ADL00496.1| response regulator receiver protein [Brevundimonas subvibrioides
           ATCC 15264]
          Length = 123

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 62/117 (52%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S I+RKV R +    GF V EA    EA  +C   L+P+ +++D +M  +  L
Sbjct: 5   TCLIVDDSRIIRKVARRIVEGLGFEVDEAADGVEALSYCAG-LMPDVILLDWNMPVMDGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            F+  +R    G    V +  +E   E++     AGAN +++KPF+ E L   + E+
Sbjct: 64  TFLRRLRAQTGGDHPKVLFCTIETAPERISEALSAGANDYIMKPFDGEILHSKLSEV 120


>gi|254292523|ref|YP_003058546.1| response regulator receiver [Hirschia baltica ATCC 49814]
 gi|254041054|gb|ACT57849.1| response regulator receiver protein [Hirschia baltica ATCC 49814]
          Length = 121

 Score = 63.9 bits (154), Expect = 6e-09,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M   L+VD S +VRKV R +  D  F   EA    +A E C  ++ P  +++D +M    
Sbjct: 1   MKRCLIVDDSRVVRKVARRILEDLKFDTMEAADGQQALEQCRADM-PEAILLDWNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            ++F+  +R+ P G    V +   E D   +    R+GAN +++KPF+ E +
Sbjct: 60  GIDFLRALRREPGGDRPTVVFCTTENDMSHIAEAIRSGANEYIMKPFDSEII 111


>gi|83591861|ref|YP_425613.1| response regulator receiver domain-containing protein
           [Rhodospirillum rubrum ATCC 11170]
 gi|83574775|gb|ABC21326.1| Response regulator receiver domain protein (CheY) [Rhodospirillum
           rubrum ATCC 11170]
          Length = 123

 Score = 63.5 bits (153), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 63/119 (52%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S L+VD S ++R V + +  +  F   EA     A + C K L P  +++D +M  + 
Sbjct: 1   MKSCLIVDDSKVIRMVAKKILQELQFETLEAEDGQVALDACLKAL-PTAVLLDWNMPVMN 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LEF+  +R++P G  V V +   E D + +      GAN +++KPF+ E L+   +++
Sbjct: 60  GLEFLQRLRKLPGGDQVIVVFCTTENDIDHIQEAIAHGANEYIMKPFDSEILQAKFQQV 118


>gi|114799911|ref|YP_759368.1| chemotaxis protein CheY [Hyphomonas neptunium ATCC 15444]
 gi|114740085|gb|ABI78210.1| chemotaxis protein CheY [Hyphomonas neptunium ATCC 15444]
          Length = 121

 Score = 63.2 bits (152), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 64/112 (57%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S +VRKV   +  D GF V EA    EA + C +E +P+ +++D +M  + 
Sbjct: 1   MRTCLVVDDSRVVRKVASRIVRDLGFSVTEAGDGAEALKMC-RESMPDAILLDWNMPTMN 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            ++F+  +R+   G    + +  +E D E +    R+GA+ F++KPF+ + L
Sbjct: 60  GIDFLRALRREEGGKVPRIVFCSIENDPEHINEALRSGADEFIMKPFDADIL 111


>gi|16124850|ref|NP_419414.1| chemotaxis protein CheYIV [Caulobacter crescentus CB15]
 gi|221233569|ref|YP_002516005.1| chemotaxis receiver domain-containing protein CheYII [Caulobacter
           crescentus NA1000]
 gi|13421798|gb|AAK22582.1| chemotaxis protein CheYIV [Caulobacter crescentus CB15]
 gi|220962741|gb|ACL94097.1| chemotaxis receiver domain protein cheYII [Caulobacter crescentus
           NA1000]
          Length = 122

 Score = 62.8 bits (151), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD S ++RKV R +    G+ V EA    +A   C+  + P+ +++D +M  + 
Sbjct: 1   MTCVLVVDDSAVIRKVARRMLERMGYAVEEAEDGLDALNACQARM-PDAVLLDWNMPRMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            L F+  +R  P G D  V +   E D + +     AGA+ ++ KPF+   L
Sbjct: 60  GLTFLKTLRAAPAGRDAKVVFCTTENDLDHITQAMAAGADEYIFKPFDEPAL 111


>gi|288962378|ref|YP_003452673.1| two-component response regulator [Azospirillum sp. B510]
 gi|288914644|dbj|BAI76129.1| two-component response regulator [Azospirillum sp. B510]
          Length = 121

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S L+VD S +VRKV R +  +  F   EA    +A E C  + +P+ +++D +M  + 
Sbjct: 1   MKSCLVVDDSRVVRKVARKILEELSFTCSEAEDGKQAMEACAVQ-MPDAILLDWNMPVMT 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +EF+  +R+M  G    V +   E D   +     AGAN +++KPF+ + ++
Sbjct: 60  GIEFLRRLRKMSGGDQPKVVFCTTENDLAHIQEALSAGANEYIMKPFDSDIIQ 112


>gi|153008900|ref|YP_001370115.1| response regulator receiver protein [Ochrobactrum anthropi ATCC
           49188]
 gi|151560788|gb|ABS14286.1| response regulator receiver protein [Ochrobactrum anthropi ATCC
           49188]
          Length = 127

 Score = 62.8 bits (151), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/108 (34%), Positives = 59/108 (54%), Gaps = 3/108 (2%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEF 62
           LLVD S ++RKV R + ++      EA++  EA E C     P+ +++D  +     LE 
Sbjct: 11  LLVDDSSVIRKVARRVLSETIAEFAEASTGREALEICFARK-PDVVLLDYDLPDMTALEV 69

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R MP G    +   L E+D  +++   RAGAN ++LKPF+R  L
Sbjct: 70  VTELRAMPGGDRPRIILCLYELDVTRIMRAKRAGANGYILKPFDRAYL 117


>gi|115526275|ref|YP_783186.1| response regulator receiver protein [Rhodopseudomonas palustris
           BisA53]
 gi|115520222|gb|ABJ08206.1| response regulator receiver protein [Rhodopseudomonas palustris
           BisA53]
          Length = 121

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M + L+VD S ++RKV R +     F + EA    +A E C++ L P  +++D +M  + 
Sbjct: 1   MKTCLVVDDSSVIRKVARRILEGLDFQIVEAEDGEKALEACKRSL-PEAVLLDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+ ++R+MP G    V +   E D   +     AGA+ +++KPF+++ +     E+
Sbjct: 60  GYEFLRNLRRMPGGEAPKVVFCTTENDVAHIARALHAGADEYIMKPFDKDIVTAKFHEV 118


>gi|16127701|ref|NP_422265.1| chemotaxis protein CheYIV [Caulobacter crescentus CB15]
 gi|13425193|gb|AAK25433.1| chemotaxis protein CheYIV [Caulobacter crescentus CB15]
          Length = 121

 Score = 62.0 bits (149), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 61/112 (54%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV R +  D GF + EA    EA  +C +  +P+ +++D +M    
Sbjct: 1   MKTCLVVDDSRVIRKVARRVLEDIGFEIAEAADGMEALAWC-RAAMPDAVLLDWNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +EF+  +R  P G    V +  +E   + +     AGA+ +++KPF+ + +
Sbjct: 60  GIEFLRQLRAEPGGMTPKVVFCTVENSPDHIRTALDAGADEYIMKPFDGDII 111


>gi|170750428|ref|YP_001756688.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170656950|gb|ACB26005.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 130

 Score = 61.6 bits (148), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 60/117 (51%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S ++RKV R +  D G  V EA     A E C    +P+ +++D +M  +   
Sbjct: 8   TCLVVDDSAVIRKVARRIIEDLGMNVSEAEDGSAALEACAAS-MPDAILLDWNMPNMDGY 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            F+  +RQ   G    V +   E D   +    RAGA+ +++KPF+R+ L   + ++
Sbjct: 67  AFLQALRQSEGGGAPKVLFCTTENDVGAIARALRAGADEYIMKPFDRDILTAKLEQV 123


>gi|85373792|ref|YP_457854.1| chemotaxis protein CheYIV [Erythrobacter litoralis HTCC2594]
 gi|84786875|gb|ABC63057.1| chemotaxis protein CheYIV [Erythrobacter litoralis HTCC2594]
          Length = 170

 Score = 61.6 bits (148), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 62/116 (53%), Gaps = 5/116 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES---MEGVLE 61
           L+VD S +VRK+ R +  D G+ V EA +  EA   C K  +P+ ++ D     M GV +
Sbjct: 55  LIVDDSRVVRKLSRMIAEDMGYRVAEAENGEEALARCAK-AMPDLVITDWQMPVMSGV-D 112

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           F+A +R +P      V +   + +   + AG  AGA+ +++KPF+   L+  +  L
Sbjct: 113 FVAKLRAIPGADRTKVMFCTSKGETTDIHAGISAGADDYIVKPFDEAKLKAKLERL 168


>gi|329849919|ref|ZP_08264765.1| chemotaxis cheY-like protein [Asticcacaulis biprosthecum C19]
 gi|328841830|gb|EGF91400.1| chemotaxis cheY-like protein [Asticcacaulis biprosthecum C19]
          Length = 121

 Score = 60.8 bits (146), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES---ME 57
           M + L+VD S ++RKV R +  +  F V EA    EA   C K+ +P  +++D +   M+
Sbjct: 1   MKTCLVVDDSRVIRKVARRILENLQFEVLEANDGLEALNLC-KDKMPAAVLLDWNMPVMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+  F+  +R+   G D  V +   E D   +      GA+ +++KPF+ E L     E+
Sbjct: 60  GIT-FLRQLRKEEGGKDPIVVFCTTENDLAHITEALTEGASEYIMKPFDGEILEAKFSEV 118


>gi|295691367|ref|YP_003595060.1| response regulator receiver protein [Caulobacter segnis ATCC 21756]
 gi|295433270|gb|ADG12442.1| response regulator receiver protein [Caulobacter segnis ATCC 21756]
          Length = 121

 Score = 60.5 bits (145), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 64/113 (56%), Gaps = 3/113 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV R +  D GF + EA+   EA  +C +  +P+ +++D +M    
Sbjct: 1   MKTCLVVDDSRVIRKVARRVLEDIGFDIAEASDGMEALAWC-RAAMPDAVLLDWNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            LEF+  +R+   G    V +  +E   +++     AGA+ +++KPF+ + ++
Sbjct: 60  GLEFLKLLRKERHGDTPKVIFCTVENSVDRIREALDAGADEYIMKPFDGDIIQ 112


>gi|221236521|ref|YP_002518958.1| chemotaxis receiver domain-containing protein CheYIV [Caulobacter
           crescentus NA1000]
 gi|220965694|gb|ACL97050.1| chemotaxis receiver domain protein cheYIV [Caulobacter crescentus
           NA1000]
          Length = 125

 Score = 60.5 bits (145), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 60/110 (54%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           + L+VD S ++RKV R +  D GF + EA    EA  +C +  +P+ +++D +M     +
Sbjct: 7   TCLVVDDSRVIRKVARRVLEDIGFEIAEAADGMEALAWC-RAAMPDAVLLDWNMPVMNGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           EF+  +R  P G    V +  +E   + +     AGA+ +++KPF+ + +
Sbjct: 66  EFLRQLRAEPGGMTPKVVFCTVENSPDHIRTALDAGADEYIMKPFDGDII 115


>gi|85708364|ref|ZP_01039430.1| chemotaxis response regulator [Erythrobacter sp. NAP1]
 gi|85689898|gb|EAQ29901.1| chemotaxis response regulator [Erythrobacter sp. NAP1]
          Length = 165

 Score = 60.1 bits (144), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 62/116 (53%), Gaps = 5/116 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVLE 61
           L+VD S ++RKV   +    G++  EA    EA   C+K  +P+ ++ D     M+G LE
Sbjct: 49  LIVDDSRVIRKVSSKIAKSLGYVPVEAQDGLEALARCKKS-MPHVVLTDWDMPEMDG-LE 106

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           F+ ++R +P      V +   +     + AG +AGA+ +++KPF+   L+  + +L
Sbjct: 107 FVKNLRAIPTPKAPVVIFCTSKNKAADVHAGIKAGADDYIVKPFDEAGLKAKLEKL 162


>gi|294011031|ref|YP_003544491.1| two-component system response regulator CheY [Sphingobium japonicum
           UT26S]
 gi|292674361|dbj|BAI95879.1| two-component system response regulator CheY [Sphingobium japonicum
           UT26S]
          Length = 121

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 58/112 (51%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV RH+       V EA    +A   CE   +P+ +++D +M    
Sbjct: 1   MKNCLVVDDSKVIRKVARHILESLDLSVSEAVDGRDALTQCETS-VPDVVLLDWNMPVMS 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +EF+  +    L T   + +   E     + A   AGA+ +++KPF+RETL
Sbjct: 60  GMEFLQALPDANLATRPKIIFCTTENGIGHIKAAVEAGADEYVMKPFDRETL 111


>gi|163850958|ref|YP_001639001.1| response regulator receiver [Methylobacterium extorquens PA1]
 gi|163662563|gb|ABY29930.1| response regulator receiver [Methylobacterium extorquens PA1]
          Length = 140

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S ++RKV R +     F V +A     A   C  E +P  +++D +M  +   
Sbjct: 15  TALIVDDSAVIRKVARRILETLDFSVRDAEDGATALVMC-AEAMPTVILLDWNMPNMDGY 73

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E +  +RQ PLG    V +   E D   +     AGA+ +++KPF+RE +
Sbjct: 74  EVLRLLRQSPLGDQPKVLFCTTENDVGAIARALHAGADEYIMKPFDREIM 123


>gi|218529786|ref|YP_002420602.1| response regulator receiver protein [Methylobacterium
           chloromethanicum CM4]
 gi|240138090|ref|YP_002962562.1| Chemotaxis response regulator receiver [Methylobacterium extorquens
           AM1]
 gi|218522089|gb|ACK82674.1| response regulator receiver protein [Methylobacterium
           chloromethanicum CM4]
 gi|240008059|gb|ACS39285.1| Chemotaxis response regulator receiver [Methylobacterium extorquens
           AM1]
          Length = 140

 Score = 59.7 bits (143), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S ++RKV R +     F V +A     A   C  E +P  +++D +M  +   
Sbjct: 15  TALIVDDSAVIRKVARRILETLDFSVRDAEDGATALVMC-AEAMPTVILLDWNMPNMDGY 73

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E +  +RQ PLG    V +   E D   +     AGA+ +++KPF+RE +
Sbjct: 74  EVLRLLRQSPLGDQPKVLFCTTENDVGAIARALHAGADEYIMKPFDREIM 123


>gi|103487223|ref|YP_616784.1| response regulator receiver protein [Sphingopyxis alaskensis
           RB2256]
 gi|98977300|gb|ABF53451.1| response regulator receiver protein [Sphingopyxis alaskensis
           RB2256]
          Length = 124

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 59/112 (52%), Gaps = 5/112 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           S L+VD S ++RKV RH+     F V EA    EA  +C +   P+ +++D +M     +
Sbjct: 4   SCLVVDDSKVIRKVARHILESMSFAVEEAADGQEALTYC-RAHRPDVILLDWNMPVMSGM 62

Query: 61  EFIAHVRQMPLGTD--VFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           EF+     +  G +    V +   E   + + A   AGA+ +++KPF+RETL
Sbjct: 63  EFLGAFNDLDYGHEERPRVVFCTTENSIDHIRAAIEAGADEYVMKPFDRETL 114


>gi|307294724|ref|ZP_07574566.1| response regulator receiver protein [Sphingobium chlorophenolicum
           L-1]
 gi|306879198|gb|EFN10416.1| response regulator receiver protein [Sphingobium chlorophenolicum
           L-1]
          Length = 121

 Score = 59.3 bits (142), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 57/112 (50%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV RH+       V EA    +A   CE   LP+ +++D +M    
Sbjct: 1   MKNCLVVDDSKVIRKVARHILESLDLSVSEAVDGRDALTQCESS-LPDVVLLDWNMPVMS 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +EF+  +    L     + +   E     + A   AGA+ +++KPF+RETL
Sbjct: 60  GMEFLQALPGAKLAARPKIIFCTTENGIGHIKAAVEAGADEYVMKPFDRETL 111


>gi|254560651|ref|YP_003067746.1| chemotaxis response regulator receiver [Methylobacterium extorquens
           DM4]
 gi|254267929|emb|CAX23797.1| Chemotaxis response regulator receiver [Methylobacterium extorquens
           DM4]
          Length = 140

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 56/110 (50%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S ++RKV R +     F V +A     A   C  E +P  +++D +M  +   
Sbjct: 15  TALIVDDSAVIRKVARRILETLDFSVRDAEDGATALVMC-AEAMPTVILLDWNMPNMDGY 73

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E +  +RQ PLG    V +   E D   +     AGA+ +++KPF+RE +
Sbjct: 74  EVLRLLRQSPLGDHPKVLFCTTENDVGAIARALHAGADEYIMKPFDREIM 123


>gi|17864027|gb|AAL47023.1|AF450326_3 chemotaxis response regulator protein [Azospirillum brasilense]
          Length = 121

 Score = 58.9 bits (141), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   L+VD S +VRKV R +  +  F   EA    +A E C ++ +P+ +++D +M  + 
Sbjct: 1   MKVCLVVDDSRVVRKVARKILEELHFACTEAEDGRQAMEACAQK-MPDAILLDWNMPVMT 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +EF+  +R+M  G    V +   E D   +     AGAN +++KPF+ + ++
Sbjct: 60  GIEFLRRLRKMSGGDIPKVVFCTTENDLAHIQEALSAGANEYIMKPFDSDIIQ 112


>gi|323137581|ref|ZP_08072658.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
 gi|322397207|gb|EFX99731.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
          Length = 121

 Score = 58.5 bits (140), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 61/119 (51%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD S ++RKV R +     F   EA     A   CEK + P+ +++D +M  + 
Sbjct: 1   MKQVLVVDDSAVIRKVARRILEGLHFRTSEACDGKSALAECEKGM-PDAILLDWNMPEMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+  +R++P G    V +   E +   +     AGA+ +++KPF++  +R    E+
Sbjct: 60  GFEFLCALRKLPGGAAPKVVFCTTENEVGHIARAMHAGADEYIMKPFDQNIVRSKFEEI 118


>gi|332185661|ref|ZP_08387408.1| response regulator [Sphingomonas sp. S17]
 gi|332014019|gb|EGI56077.1| response regulator [Sphingomonas sp. S17]
          Length = 121

 Score = 57.8 bits (138), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (53%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV RH+       V EA    EA E C  E +P+ +++D +M    
Sbjct: 1   MKTCLVVDDSKVIRKVARHILETLDLEVREAGDGREALEAC-LESVPDVVLLDWNMPVMS 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            ++F+  +R+  L     + +   E     + A   AGA+ +++KPF+R+TL
Sbjct: 60  GMDFLRALREANLERRPRIVFCTTENGMAHIRAAIDAGADEYIMKPFDRDTL 111


>gi|149175782|ref|ZP_01854401.1| response regulator receiver domain protein (CheY-like)
           [Planctomyces maris DSM 8797]
 gi|148845501|gb|EDL59845.1| response regulator receiver domain protein (CheY-like)
           [Planctomyces maris DSM 8797]
          Length = 122

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 59/119 (49%), Gaps = 4/119 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES---ME 57
           M ++LLVD S  VR VGR +   FG  V EA    +A E        + +++D +   M+
Sbjct: 1   MKTILLVDDSRAVRLVGRRIMGTFGLNVLEAEDGKQALEVARANPELDAVLLDWNMPIMD 60

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           G +EF+  +R         V     E D  +++   +AGAN +++KPF  + +R  + E
Sbjct: 61  G-MEFLKALRAEAREKQPIVVMCTTENDMPQIVQAMQAGANEYIMKPFTEDIVRDKLEE 118


>gi|56694950|ref|YP_165295.1| response regulator [Ruegeria pomeroyi DSS-3]
 gi|56676687|gb|AAV93353.1| response regulator [Ruegeria pomeroyi DSS-3]
          Length = 445

 Score = 57.4 bits (137), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 62/112 (55%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S  EA E C +  +P+ ++ D  M G+  ++
Sbjct: 43  VLVVDDSRLQRRILSSSLKKWGFEVIEAESGEEAMEICARA-MPDLVLSDWVMPGMSGVD 101

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    RQ  L +D + Y++L+    EK  +  G  AGA+ FL+KP + + LR
Sbjct: 102 FCEAFRQ--LNSDRYCYFILLTSKSEKNEVAQGLDAGADDFLIKPVSSDELR 151


>gi|94495512|ref|ZP_01302092.1| chemotaxis response regulator [Sphingomonas sp. SKA58]
 gi|94424900|gb|EAT09921.1| chemotaxis response regulator [Sphingomonas sp. SKA58]
          Length = 121

 Score = 57.0 bits (136), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M + L+VD S ++RKV RH+       V EA    +A   CE    P+ +++D +M    
Sbjct: 1   MKNCLVVDDSKVIRKVARHILESLDLSVSEAVDGQDALTQCEAA-APDVVLLDWNMPIMS 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +EF+  +    +     + +   E     + A   AGA+ +++KPF+RETL
Sbjct: 60  GMEFLQALSSAKMTARPKIIFCTTENGISHIKAAVDAGADEYVMKPFDRETL 111


>gi|83950753|ref|ZP_00959486.1| response regulator [Roseovarius nubinhibens ISM]
 gi|83838652|gb|EAP77948.1| response regulator [Roseovarius nubinhibens ISM]
          Length = 405

 Score = 56.2 bits (134), Expect = 2e-06,   Method: Composition-based stats.
 Identities = 38/110 (34%), Positives = 57/110 (51%), Gaps = 3/110 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+VD S + R++   L   +G+ V EA S  EA   C+ E LP+ ++ D  M G+   E
Sbjct: 1   MLIVDDSRLQRRIAGGLLRRWGYRVREAGSGAEALALCD-EALPDLVLSDWMMPGMSGPE 59

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           F    R++      +   L  + D E++ AG  AGA+ FL KP N   LR
Sbjct: 60  FCTAFRRLAGARYGYFILLTAKSDKEEVAAGLDAGADDFLTKPVNGGELR 109


>gi|239908512|ref|YP_002955254.1| response regulator receiver protein [Desulfovibrio magneticus RS-1]
 gi|239798379|dbj|BAH77368.1| response regulator receiver protein [Desulfovibrio magneticus RS-1]
          Length = 380

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/113 (32%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 1   MDSLLLVDSSHIVRKV-GRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M  +L+ D + I R+V  RH+ + FG+ V EA +  +A +  E    P+ +++D  M G+
Sbjct: 1   MTQVLIADDNAIFREVLKRHVASLFGYDVIEAATGLDAVDLAETRH-PDLILLDLVMPGL 59

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             +E I  +R  P   DV + +L  E D         AGAN F+ KP++R  L
Sbjct: 60  DGIEVIRRIRANPRLADVPIIFLSAETDRRVWAEALSAGANDFMPKPYHRSEL 112


>gi|294675738|ref|YP_003576353.1| response regulator receiver domain/protein phosphatase 2C
           domain-containing protein [Rhodobacter capsulatus SB
           1003]
 gi|294474558|gb|ADE83946.1| response regulator receiver domain/protein phosphatase 2C domain
           protein [Rhodobacter capsulatus SB 1003]
          Length = 409

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 63/112 (56%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++   L +  G+ V EA +  EA + C + + P++++ D  M G+  +E
Sbjct: 5   VLVVDDSKMQRRILSALLSRSGYEVLEAGTAEEALDICGR-IEPDFVLSDWMMPGMSGIE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R MP   + + Y++L+    EK  +  G ++GA+ FL KP N + LR
Sbjct: 64  FCQQFRAMP--REGYGYFILLTSKTEKHDVAEGLQSGADDFLAKPVNGDELR 113


>gi|260431985|ref|ZP_05785956.1| response regulator [Silicibacter lacuscaerulensis ITI-1157]
 gi|260415813|gb|EEX09072.1| response regulator [Silicibacter lacuscaerulensis ITI-1157]
          Length = 421

 Score = 55.8 bits (133), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 39/115 (33%), Positives = 62/115 (53%), Gaps = 7/115 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           +  +L+VD S + R++       +GF V EA S  EA + C ++ LP+ ++ D  M G+ 
Sbjct: 16  IQKVLVVDDSRLQRRILVASLKRWGFTVVEADSGEEALDLC-RQGLPDLVLSDWVMPGMG 74

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
            LEF    R+M    D + Y++L+    EK  +  G  AGA+ FL+KP   + LR
Sbjct: 75  GLEFCRAFREME--KDQYTYFILLTSKSEKQEVARGLDAGADDFLIKPLEADELR 127


>gi|294055133|ref|YP_003548791.1| response regulator receiver sensor signal transduction histidine
           kinase [Coraliomargarita akajimensis DSM 45221]
 gi|293614466|gb|ADE54621.1| response regulator receiver sensor signal transduction histidine
           kinase [Coraliomargarita akajimensis DSM 45221]
          Length = 382

 Score = 55.5 bits (132), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 65/126 (51%), Gaps = 9/126 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD   I+RK+ R +    GF+V E+ S  EA   C  E  P+ +++D  M+G+  FI
Sbjct: 14  ILVVDDDEIIRKLLRRVLERSGFIVDESDS-GEAAIQCIVENQPDLILLDVVMDGIDGFI 72

Query: 64  A--HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNR-ETL-----RFAMR 115
               ++ M     V + ++    D   ++ G  AG + ++ KP NR E+L        MR
Sbjct: 73  TCRKIKSMEGMESVPIIFVTGRSDTGSIVEGLDAGGSDYITKPINRHESLARIRNHLKMR 132

Query: 116 ELPQMQ 121
           +L QMQ
Sbjct: 133 KLMQMQ 138


>gi|296536798|ref|ZP_06898850.1| chemotaxis response regulator CheY [Roseomonas cervicalis ATCC
           49957]
 gi|296262878|gb|EFH09451.1| chemotaxis response regulator CheY [Roseomonas cervicalis ATCC
           49957]
          Length = 134

 Score = 55.1 bits (131), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/110 (33%), Positives = 57/110 (51%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S +VRKV R +    G +V EA    EA   C +E LP  +++D +M  +  L
Sbjct: 10  TCLVVDDSRVVRKVARRMLERHGAVVREAADGQEALFACREE-LPRLVLLDWNMPVMDGL 68

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           EF+   R      +  V     E DFE+++    AGA  +++KPF+   L
Sbjct: 69  EFLKAARAEFGADEPVVVLCTTENDFERILMALGAGAQEYIMKPFDDAIL 118


>gi|114762219|ref|ZP_01441687.1| response regulator [Pelagibaca bermudensis HTCC2601]
 gi|114545243|gb|EAU48246.1| response regulator [Roseovarius sp. HTCC2601]
          Length = 415

 Score = 55.1 bits (131), Expect = 4e-06,   Method: Composition-based stats.
 Identities = 38/115 (33%), Positives = 62/115 (53%), Gaps = 7/115 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           +  +LLVD S +  K+   +   +GF V++A S  EA   CE E+  + ++ D  M G+ 
Sbjct: 18  LQRILLVDDSAVQLKILAAMMRHWGFEVWQAESGAEALALCE-EIAFDAVLSDWMMPGMD 76

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
            LE     RQ+P   D + Y++L+    E+  ++ G  AGA+ FL KP + + LR
Sbjct: 77  GLELCRQFRQLP--RDSYGYFILLTSKNERGAIVRGLDAGADDFLTKPVSSDELR 129


>gi|320355079|ref|YP_004196418.1| response regulator receiver modulated diguanylate cyclase
           [Desulfobulbus propionicus DSM 2032]
 gi|320123581|gb|ADW19127.1| response regulator receiver modulated diguanylate cyclase
           [Desulfobulbus propionicus DSM 2032]
          Length = 326

 Score = 54.7 bits (130), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD + +V K+   +    G+ V +A S  +A      + LP+ +++D  M GV  L
Sbjct: 14  SILIVDDNPVVIKLLHAMLARAGYQVVQAASGQQALALLASDCLPDLILLDIDMPGVSGL 73

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E    +++ P   D+ V ++    D E ++ G  AGA  +++KP  +E L
Sbjct: 74  EACRLIKENPRTADIPVIFVTASNDKEHIVNGFAAGAQDYIIKPSTQEEL 123


>gi|83311739|ref|YP_422003.1| FOG: CheY-like receiver [Magnetospirillum magneticum AMB-1]
 gi|82946580|dbj|BAE51444.1| FOG: CheY-like receiver [Magnetospirillum magneticum AMB-1]
          Length = 136

 Score = 54.3 bits (129), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 59/128 (46%), Gaps = 10/128 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   L++D S ++R +   +    G  V EA    +A E C   + P+ +++D +M  + 
Sbjct: 1   MSHCLVIDDSKLIRTIHTRMLEQLGLRVSEAEHGADALEICATGM-PDLVLVDWNMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR------- 111
              F+  +R MP G    V    +E D E +      GA+ +++KPF+ E L        
Sbjct: 60  GFAFLKALRAMPGGQAPKVVLCTIEGDLEHITCALAEGADEYIMKPFDAEILAAKLAATG 119

Query: 112 FAMRELPQ 119
            A+ E PQ
Sbjct: 120 IAIPERPQ 127


>gi|114566146|ref|YP_753300.1| response regulator receiver protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337081|gb|ABI67929.1| response regulator receiver modulated diguanylate cyclase
           [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
          Length = 301

 Score = 54.3 bits (129), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+ D   I R V + L + +G+ V EA    +A +  +++  P  +++D  M G+  LE
Sbjct: 3   VLIADDDLISRTVVKALLSKWGYEVLEAGDGIQAWDILKEKDSPQLVLLDWMMPGIDGLE 62

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
               +RQ+   T  ++  L      E +I G  AGA+ ++ KPF  E L   +R
Sbjct: 63  LCRRLRQLDNNTYHYIILLTGRDSKEDIIGGLNAGADDYITKPFMPEELEVRLR 116


>gi|111075018|gb|ABH04870.1| CheY [Heliobacillus mobilis]
          Length = 127

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 39/127 (30%), Positives = 62/127 (48%), Gaps = 3/127 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD S +VRK    +    GF VF++   C A E   KE L + ++ D +M  + 
Sbjct: 1   MARILVVDDSAMVRKYHAFVLTSLGFEVFQSEDGCLALETMLKESL-DLIITDINMPRMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             +FIA +R MP   +  V  +  +   E    G + GAN + +KP   E L  ++R L 
Sbjct: 60  GFQFIAEIRSMPAYRETPVIIVTTQDHQEDADRGVKVGANVYFIKPTEPEKLVDSVRRLL 119

Query: 119 QMQKSKD 125
             +  K+
Sbjct: 120 DGKSGKE 126


>gi|121997279|ref|YP_001002066.1| response regulator receiver protein [Halorhodospira halophila SL1]
 gi|121588684|gb|ABM61264.1| response regulator receiver protein [Halorhodospira halophila SL1]
          Length = 133

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 59/112 (52%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  + G+  V EA     A    +K  +  +L+ D +M G+  
Sbjct: 8   KILVVDDFSTMRRIIKNLLRELGYNNVVEADDGNTALPILQKGGI-QFLITDWNMPGMTG 66

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE + HVR  P   D+    +  E   E+++  A+AG N +++KPF   TLR
Sbjct: 67  LELLKHVRADPNLKDLPTLMVTAEAKREQIMEAAQAGVNGYIVKPFTAATLR 118


>gi|260428849|ref|ZP_05782826.1| response regulator receiver modulated serine phosphatase
           [Citreicella sp. SE45]
 gi|260419472|gb|EEX12725.1| response regulator receiver modulated serine phosphatase
           [Citreicella sp. SE45]
          Length = 415

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Composition-based stats.
 Identities = 39/115 (33%), Positives = 62/115 (53%), Gaps = 7/115 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           +  +L+VD S +  K+   +   +GF V EA+S  +A E C + ++P+ ++ D  M G+ 
Sbjct: 18  LQRVLVVDDSPVQLKILCAVMRRWGFKVLEASSGEQALEIC-RTMVPDAVLSDWMMPGMD 76

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
            LEF    R+  L  D + Y++L+    EK  +  G  AGA+ FL KP N   LR
Sbjct: 77  GLEFCRQFRE--LKRDSYGYFILLTSKGEKEEIARGLDAGADDFLTKPVNSYELR 129


>gi|114320146|ref|YP_741829.1| response regulator receiver protein [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226540|gb|ABI56339.1| response regulator receiver protein [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 131

 Score = 53.5 bits (127), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 60/112 (53%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    ++  + ++LV D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFNNTVEADDGKTALPILKRGGI-DFLVTDWNMPGMSG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L+ +  VR  P   D+ V  +  E   +++IA A+AG N +++KPF   TLR
Sbjct: 65  LDLLKEVRADPELKDLPVLMVTAEAKRDQIIAAAQAGVNGYIVKPFTAVTLR 116


>gi|302877367|ref|YP_003845931.1| response regulator receiver modulated diguanylate cyclase
           [Gallionella capsiferriformans ES-2]
 gi|302580156|gb|ADL54167.1| response regulator receiver modulated diguanylate cyclase
           [Gallionella capsiferriformans ES-2]
          Length = 632

 Score = 53.1 bits (126), Expect = 1e-05,   Method: Composition-based stats.
 Identities = 37/134 (27%), Positives = 68/134 (50%), Gaps = 12/134 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE--KELLPNYLVID---ESMEG 58
           +LLVD    +R + + L    G  V   T+ C  RE  E  +  +P  ++ D     M+G
Sbjct: 323 ILLVDDDRAIRLLYKTLLEKSGHTV---TTACNGREALESLQASVPQLIISDWMMPEMDG 379

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR--- 115
           + EF   +R+ P    ++V+ +  +   +++I    AGAN +L KP N + L   +R   
Sbjct: 380 I-EFCRELRKNPEWHKIYVFIVTAQESTDRLIEAFEAGANDYLSKPINPKVLAARLRSAQ 438

Query: 116 ELPQMQKSKDENQF 129
            + QMQ++++E++ 
Sbjct: 439 RIVQMQEAQEEDRL 452


>gi|302878209|ref|YP_003846773.1| response regulator receiver modulated diguanylate cyclase
           [Gallionella capsiferriformans ES-2]
 gi|302580998|gb|ADL55009.1| response regulator receiver modulated diguanylate cyclase
           [Gallionella capsiferriformans ES-2]
          Length = 635

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 39/133 (29%), Positives = 67/133 (50%), Gaps = 10/133 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEGV 59
           +LLVD    +R + + L    G  V  A +  EA E  +    P  L+I +     M+G+
Sbjct: 326 ILLVDDDRAIRLLYKALLEKSGHSVTTANNGREALESVKAS--PPQLIISDWMMPEMDGI 383

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE--- 116
            EF   +R+ P    ++V+ +  +   EK+I    AGAN +L KP N + L   +R    
Sbjct: 384 -EFCRELRKNPDWHRIYVFIVTAQESTEKLIEAFEAGANDYLSKPINPKVLAARLRSAQR 442

Query: 117 LPQMQKSKDENQF 129
           + QMQ++++E++ 
Sbjct: 443 IVQMQEAQEEDRL 455


>gi|226310142|ref|YP_002770036.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226093090|dbj|BAH41532.1| probable two-component response regulator [Brevibacillus brevis
           NBRC 100599]
          Length = 139

 Score = 52.8 bits (125), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEA-REFCEKELLPNYLVIDESMEG 58
           M+S+L+VD +   R+V R++F   G  +V EA S  EA R +C  +  P+ + +D +M G
Sbjct: 1   MNSILIVDDTAFTRRVLRNIFETLGLHVVAEAASGEEAVRNYCLYK--PSLVTMDITMPG 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +    A  + M L  D  +         + +I   +AGA  F+ KP   E + +A+++L
Sbjct: 59  MNGLTASRKIMELDKDAKIIICSAVSRNDTVIKAIQAGARDFIAKPLQLERIEWAVQKL 117


>gi|300914725|ref|ZP_07132041.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter sp. X561]
 gi|307724041|ref|YP_003903792.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter sp. X513]
 gi|300889660|gb|EFK84806.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter sp. X561]
 gi|307581102|gb|ADN54501.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter sp. X513]
          Length = 310

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD + + RK+ + +  + G+ V EA    EA +   K  LP+ +++D  M G+  F
Sbjct: 5   NILIVDDNKLTRKILKDILENAGYGVLEAKDGEEALQIY-KNKLPDMVILDIVMPGMTGF 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             +  +R+      + +  L  + +FE+ I G   GA+ +L+KPFN + L F +  L Q
Sbjct: 64  DLLRILRKEEENLMLPIILLTSQDNFEEKIKGLELGADDYLVKPFNDKELLFKVNNLFQ 122


>gi|167040684|ref|YP_001663669.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter sp. X514]
 gi|166854924|gb|ABY93333.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter sp. X514]
          Length = 318

 Score = 52.4 bits (124), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD + + RK+ + +  + G+ V EA    EA +   K  LP+ +++D  M G+  F
Sbjct: 13  NILIVDDNKLTRKILKDILENAGYGVLEAKDGEEALQIY-KNKLPDMVILDIVMPGMTGF 71

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             +  +R+      + +  L  + +FE+ I G   GA+ +L+KPFN + L F +  L Q
Sbjct: 72  DLLRILRKEEENLMLPIILLTSQDNFEEKIKGLELGADDYLVKPFNDKELLFKVNNLFQ 130


>gi|302037676|ref|YP_003797998.1| chemotaxis regulator CheY [Candidatus Nitrospira defluvii]
 gi|300605740|emb|CBK42073.1| Chemotaxis regulator CheY [Candidatus Nitrospira defluvii]
          Length = 123

 Score = 52.0 bits (123), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 57/118 (48%), Gaps = 4/118 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L+VD S  +R++        G+ V EA +  EA         P+ +V D     M+G+
Sbjct: 4   TVLVVDDSPTMRQMVAFTLTSAGYQVVEAGNGKEAVGKVNGGAKPDLVVTDLNMPEMDGI 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              I  +R+MP      +  L  E   +K  AG  AGA  +++KPFN E +   ++++
Sbjct: 64  -TLIKEIRKMPALKFTPILMLTTEASDDKKKAGQAAGATGWIVKPFNPEQMMAVIKKV 120


>gi|193215291|ref|YP_001996490.1| response regulator receiver protein [Chloroherpeton thalassium ATCC
           35110]
 gi|193088768|gb|ACF14043.1| response regulator receiver protein [Chloroherpeton thalassium ATCC
           35110]
          Length = 237

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 59/111 (53%), Gaps = 3/111 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD +  V K+  H     GF V EA SV EA++  + EL P+ ++ D  M G   L
Sbjct: 15  TILVVDDNQAVLKLVSHQLLLEGFHVAEAESVKEAKKIVD-ELSPSVIICDWMMPGEDGL 73

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            F  ++R+ P  + V+   L  +   E+ I    +G + +++KPF  + +R
Sbjct: 74  SFCRYLRENPKTSGVYFIMLTAQGLHEQKIFALNSGVDDYIIKPFENQEMR 124


>gi|126738480|ref|ZP_01754185.1| response regulator [Roseobacter sp. SK209-2-6]
 gi|126720279|gb|EBA16985.1| response regulator [Roseobacter sp. SK209-2-6]
          Length = 423

 Score = 51.6 bits (122), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 60/115 (52%), Gaps = 7/115 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++ +L+VD S + R++       +GF V EA S   A E C +E  P+ ++ D  M G+ 
Sbjct: 18  INRVLVVDDSRLQRRILVASLKKWGFEVIEADSGEAAMEICLQE-SPDLILSDWMMPGMS 76

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
            +EF    RQ     D + Y++L+    EK  +  G  AGA+ FL KP + + LR
Sbjct: 77  GIEFCQAFRQRS--KDNYAYFILLTSKSEKNEVAEGLDAGADDFLTKPVSSDELR 129


>gi|197106841|ref|YP_002132218.1| chemotaxis protein CheYI [Phenylobacterium zucineum HLK1]
 gi|196480261|gb|ACG79789.1| chemotaxis protein CheYI [Phenylobacterium zucineum HLK1]
          Length = 121

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L VD S  +R + R    D GF V +A       E   +E  P+ +V D +M  +   
Sbjct: 4   TILTVDDSRTMRDMLRMALTDAGFNVLQAEDGEHGLEVL-REGAPDVIVTDINMPRLDGY 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            FIA VR  P+   + +  L  E   EK +    AGA+ +++KPF+ + L  A+R +
Sbjct: 63  GFIAGVRASPVHRAIPILVLSTESSPEKKLRAREAGASGWIVKPFSPDKLVAAIRRV 119


>gi|86136783|ref|ZP_01055361.1| response regulator [Roseobacter sp. MED193]
 gi|85826107|gb|EAQ46304.1| response regulator [Roseobacter sp. MED193]
          Length = 410

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 58/112 (51%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S   A E C K+  P+ ++ D  M G+  LE
Sbjct: 8   VLVVDDSRLQRRILVASLQKWGFDVVEAESGEAAMEICRKD-PPDLILSDWMMPGMNGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R+     D + Y++L+    EK  +  G  AGA+ FL KP + + LR
Sbjct: 67  FCQAFREQS--RDNYAYFILLTSKSEKNEVAEGLDAGADDFLTKPVSSDELR 116


>gi|298530015|ref|ZP_07017417.1| response regulator receiver modulated serine phosphatase
           [Desulfonatronospira thiodismutans ASO3-1]
 gi|298509389|gb|EFI33293.1| response regulator receiver modulated serine phosphatase
           [Desulfonatronospira thiodismutans ASO3-1]
          Length = 376

 Score = 51.6 bits (122), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 40/117 (34%), Positives = 56/117 (47%), Gaps = 10/117 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--ELLPNYLVID---ESMEG 58
           LL+ + S I RK    L  D     FE    C+  E  +K     P+ +++D     M+G
Sbjct: 6   LLIAEDSSINRKFLIRLLGD----EFEIEESCDGEEAVDKFAAFAPDIVLLDIHMPVMDG 61

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            LE I H+R   +  DVF+  L  E   E  +     GAN F+LKPF RE L+  +R
Sbjct: 62  -LEVIRHIRNTSVDRDVFILVLTGEESTEVKVEALNQGANDFVLKPFVREELQARVR 117


>gi|296536468|ref|ZP_06898563.1| chemotaxis response regulator CheY [Roseomonas cervicalis ATCC
           49957]
 gi|296263212|gb|EFH09742.1| chemotaxis response regulator CheY [Roseomonas cervicalis ATCC
           49957]
          Length = 131

 Score = 51.2 bits (121), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 35/107 (32%), Positives = 56/107 (52%), Gaps = 5/107 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           + L+VD S +VRK  R +    GF V EA    +A   C +  LP  +++D +M  +  L
Sbjct: 7   TCLVVDDSRVVRKAARRILERHGFTVTEAEDGQQALYAC-RATLPRLVLLDWNMPVMDGL 65

Query: 61  EFIAHVRQMPLGTDVFVYYLL-MEVDFEKMIAGARAGANSFLLKPFN 106
           EF+   R    G D  V  L   E +F++++    AGA  +++KPF+
Sbjct: 66  EFLKAARA-EFGPDEPVIMLCTTESEFDRIVMALGAGAQEYIMKPFD 111


>gi|256751275|ref|ZP_05492155.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|307266238|ref|ZP_07547780.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|320115595|ref|YP_004185754.1| diguanylate cyclase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|326390556|ref|ZP_08212112.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter ethanolicus JW 200]
 gi|256749830|gb|EEU62854.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|306918768|gb|EFN49000.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|319928686|gb|ADV79371.1| diguanylate cyclase [Thermoanaerobacter brockii subsp. finnii
           Ako-1]
 gi|325993381|gb|EGD51817.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 310

 Score = 51.2 bits (121), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD + + RK+ + +  + G+ V EA    EA +    +L P+ +++D  M G+   
Sbjct: 5   NILIVDDNKLTRKILKDILENAGYGVLEAKDGEEALQIYRNKL-PDMVILDIVMPGMNGF 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           + +  +R+      + +  L  + +FE+ I G   GA+ +L+KPFN + L F +  L Q
Sbjct: 64  DLLRILRKEEENLMLPIILLTSQDNFEEKIKGLELGADDYLVKPFNDKELLFKVNNLFQ 122


>gi|156741162|ref|YP_001431291.1| two component transcriptional regulator [Roseiflexus castenholzii
           DSM 13941]
 gi|156232490|gb|ABU57273.1| two component transcriptional regulator, winged helix family
           [Roseiflexus castenholzii DSM 13941]
          Length = 229

 Score = 50.8 bits (120), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 31/106 (29%), Positives = 55/106 (51%), Gaps = 6/106 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+++    +R V R      GF V  A S  E  E    E  P+ +++D ++ G+  +
Sbjct: 4   TILIIEDEASIRTVARAYLEQAGFRVLLADSGPEGVELARHEC-PDLVILDLNLPGMDGM 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           E  A +RQ    +DVF+  L    +    +AG R GA+ +++KPF+
Sbjct: 63  EVAARLRQ---DSDVFIVMLTARSEESDRVAGLRIGADDYVIKPFS 105


>gi|167037177|ref|YP_001664755.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|166856011|gb|ABY94419.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
          Length = 318

 Score = 50.8 bits (120), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 64/119 (53%), Gaps = 3/119 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD + + RK+ + +  + G+ V EA    EA +    +L P+ +++D  M G+   
Sbjct: 13  NILIVDDNKLTRKILKDILENAGYGVLEAKDGEEALQIYRNKL-PDMVILDIVMPGMNGF 71

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           + +  +R+      + +  L  + +FE+ I G   GA+ +L+KPFN + L F +  L Q
Sbjct: 72  DLLRILRKEEENLMLPIILLTSQDNFEEKIKGLELGADDYLVKPFNDKELLFKVNNLFQ 130


>gi|163849322|ref|YP_001637366.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222527316|ref|YP_002571787.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
 gi|163670611|gb|ABY36977.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222451195|gb|ACM55461.1| response regulator receiver protein [Chloroflexus sp. Y-400-fl]
          Length = 390

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +LL+VD    V ++   +    G+ V  A S  EA +   K L P+ L+ D  + G+   
Sbjct: 5   TLLIVDDDDTVAEMLELVLRGAGYEVRRAASGEEALQQIYKNL-PDALICDVLLPGIDGY 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                VRQ PL   + +  L  + D    IAG  AGAN +L KPF  + L + ++ +
Sbjct: 64  TLCKRVRQHPLTKTLPILMLTAQGDISAKIAGFEAGANDYLAKPFEPQELVYRVKNI 120


>gi|148654964|ref|YP_001275169.1| two component transcriptional regulator [Roseiflexus sp. RS-1]
 gi|148567074|gb|ABQ89219.1| two component transcriptional regulator, winged helix family
           [Roseiflexus sp. RS-1]
          Length = 229

 Score = 50.4 bits (119), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 30/106 (28%), Positives = 56/106 (52%), Gaps = 6/106 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+++    +R V R      GF V  A +  E  E   +E  P+ +++D ++ G+  +
Sbjct: 4   TILIIEDEASIRTVARAYLEQAGFRVLLADNGPEGVELARRER-PDLVILDLNLPGMDGM 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           E  A +RQ    +DVF+  L    +    +AG R GA+ +++KPF+
Sbjct: 63  EVAARLRQE---SDVFIIMLTARSEESDRVAGLRIGADDYVIKPFS 105


>gi|261855331|ref|YP_003262614.1| response regulator receiver protein [Halothiobacillus neapolitanus
           c2]
 gi|261835800|gb|ACX95567.1| response regulator receiver protein [Halothiobacillus neapolitanus
           c2]
          Length = 128

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 57/111 (51%), Gaps = 2/111 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD    +R++ ++L  + GF   E            K+   ++LV D +M G+  +
Sbjct: 6   KILVVDDFSTMRRIIKNLLKELGFSNIEEADDGTTALPMLKQGKFDFLVTDWNMPGMTGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR  P   ++ V  +  E   E++I  A+AG N +++KPFN  TL+
Sbjct: 66  DLLKAVRADPALVNLPVLMVTAEAKREQIIMAAQAGVNGYVVKPFNGPTLK 116


>gi|258592576|emb|CBE68885.1| Chemotaxis protein cheY [NC10 bacterium 'Dutch sediment']
          Length = 125

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 60/121 (49%), Gaps = 5/121 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGVL 60
           +L+VD S+ +R + R    D G  V EA +  +A    ++  + + ++ D +M   +G+ 
Sbjct: 5   ILIVDDSNSMRGIIRSALTDGGHDVIEAANGRDALVALDRHSV-DVIITDMNMPIMDGI- 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+ P      V  L  E D     AG  AGA  +++KPFN + LR  + ++  +
Sbjct: 63  TLVKEIRRRPTNKSTPVLILTTECDAAMKQAGKAAGATGWIVKPFNPQQLRQVITKVLPL 122

Query: 121 Q 121
           Q
Sbjct: 123 Q 123


>gi|163742633|ref|ZP_02150019.1| response regulator [Phaeobacter gallaeciensis 2.10]
 gi|161384218|gb|EDQ08601.1| response regulator [Phaeobacter gallaeciensis 2.10]
          Length = 422

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 57/112 (50%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S   A E CE +  P+ ++ D  M G+  LE
Sbjct: 20  VLVVDDSRLQRRILVASLKKWGFEVVEAESGEAAMEICESD-PPDLILSDWMMPGMNGLE 78

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R      D + Y++L+    EK  +  G  AGA+ FL KP + + LR
Sbjct: 79  FCRAFRTKS--QDNYSYFILLTSKSEKNEVAQGLDAGADDFLTKPVSSDELR 128


>gi|163737971|ref|ZP_02145387.1| response regulator receiver modulated serine phosphatase
           [Phaeobacter gallaeciensis BS107]
 gi|161388587|gb|EDQ12940.1| response regulator receiver modulated serine phosphatase
           [Phaeobacter gallaeciensis BS107]
          Length = 423

 Score = 50.4 bits (119), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 57/112 (50%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S   A E CE +  P+ ++ D  M G+  LE
Sbjct: 21  VLVVDDSRLQRRILVASLKKWGFEVVEAESGEAAMEICESD-PPDLILSDWMMPGMNGLE 79

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R      D + Y++L+    EK  +  G  AGA+ FL KP + + LR
Sbjct: 80  FCRAFRTKS--QDNYSYFILLTSKSEKNEVAQGLDAGADDFLTKPVSSDELR 129


>gi|163845708|ref|YP_001633752.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222523414|ref|YP_002567884.1| winged helix family two component transcriptional regulator
           [Chloroflexus sp. Y-400-fl]
 gi|163666997|gb|ABY33363.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222447293|gb|ACM51559.1| two component transcriptional regulator, winged helix family
           [Chloroflexus sp. Y-400-fl]
          Length = 228

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 64/130 (49%), Gaps = 6/130 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD    +R V +      G+ V  AT+  E  +   +E  P+ +V+D  + G+  +
Sbjct: 4   TILVVDDEASIRNVAKAYLEHAGYRVLCATTGPEGLQMALEEQ-PDLIVLDLMLPGMDGM 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E  A +R+    +DV++  L    D    +AG R GA+ +L KPF+   L   +  + + 
Sbjct: 63  EITARLRER---SDVYILMLTARSDEMDRVAGLRVGADDYLTKPFSPRELVARVEAILRR 119

Query: 121 QKSKDENQFL 130
           Q++K     L
Sbjct: 120 QRNKTAKSSL 129


>gi|254464929|ref|ZP_05078340.1| response regulator receiver modulated serine phosphatase
           [Rhodobacterales bacterium Y4I]
 gi|206685837|gb|EDZ46319.1| response regulator receiver modulated serine phosphatase
           [Rhodobacterales bacterium Y4I]
          Length = 417

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 58/112 (51%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S   A E C+ E  P+ ++ D  M G+  LE
Sbjct: 15  VLVVDDSRLQRRILVASLKKWGFEVVEAESGEAAMEICQAE-TPDLILSDWMMPGMNGLE 73

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R     ++ + Y++L+    EK  +  G  AGA+ FL KP + + LR
Sbjct: 74  FCRAFRSRS--SEDYAYFILLTSKSEKNEVAEGLDAGADDFLTKPVSSDELR 123


>gi|85706910|ref|ZP_01038000.1| response regulator [Roseovarius sp. 217]
 gi|85668521|gb|EAQ23392.1| response regulator [Roseovarius sp. 217]
          Length = 421

 Score = 50.1 bits (118), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 58/112 (51%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S   A   C  E  P+ ++ D  M G+  LE
Sbjct: 17  VLVVDDSRLQRRILSASLQRWGFEVQEADSGDAALILCRDEP-PDLVMSDWMMPGLSGLE 75

Query: 62  FIAHVRQMPLGTDVFVYYLLM--EVDFEKMIAGARAGANSFLLKPFNRETLR 111
           F    R+M    D + Y++L+  + D +++  G  AGA+ FL KP N   LR
Sbjct: 76  FCKRFREMS--RDSYGYFILLTSKSDKDEVALGLDAGADDFLTKPVNAAELR 125


>gi|296122161|ref|YP_003629939.1| response regulator receiver [Planctomyces limnophilus DSM 3776]
 gi|296014501|gb|ADG67740.1| response regulator receiver [Planctomyces limnophilus DSM 3776]
          Length = 122

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 31/114 (27%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---E 57
           M +LLLVD S  VR   + +    G  + EA    +A E  +     + +++D +M   +
Sbjct: 1   MKTLLLVDDSRAVRLATKRMVTSLGVNILEAEDGSQAWERVQSHPEIDAILLDWNMPVMD 60

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G+  F+  +R+        V     E D  +++   +AGAN +++KPF  E +R
Sbjct: 61  GIT-FLRKLREDKSQPQPAVIMCTTENDLPRILEAMQAGANEYIMKPFTEEIVR 113


>gi|94500299|ref|ZP_01306832.1| CheY-like receiver protein [Oceanobacter sp. RED65]
 gi|94427598|gb|EAT12575.1| CheY-like receiver protein [Oceanobacter sp. RED65]
          Length = 122

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 61/118 (51%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 2   KILVVDDFSTMRRIIKNLLRDLGF-----TNTQEADD--GNTALPMLKSGDFDFLVTDWN 54

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  +E + HVR+     D+ V  +  E   ++++A A+AG N +++KPF    L+
Sbjct: 55  MPGMTGIELLKHVREDERLKDLPVLMVTAEAKRDQIVAAAQAGVNGYVVKPFTAAVLK 112


>gi|149194982|ref|ZP_01872075.1| chemotaxis protein [Caminibacter mediatlanticus TB-2]
 gi|149134903|gb|EDM23386.1| chemotaxis protein [Caminibacter mediatlanticus TB-2]
          Length = 126

 Score = 49.7 bits (117), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 65/123 (52%), Gaps = 10/123 (8%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM---VFEATSVCEAREFCEK---ELLPNYLVIDESM 56
            +L+VD +  +RK+  ++    GF    + EAT   +A E  +K   E+    + +D +M
Sbjct: 2   KVLIVDDAMTMRKIIGNVLKQLGFKPEDLIEATDGEDAWEKLQKYKDEV--KIIFLDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
             +   EF+  VR+ P   DV +     E    K+I   +AGAN+++ KPF+ +TL+  +
Sbjct: 60  PKMDGYEFLTLVRKHPEFNDVKIIMTTTETAKPKVIKALKAGANNYIAKPFSPQTLKEKL 119

Query: 115 REL 117
           ++L
Sbjct: 120 QKL 122


>gi|260776785|ref|ZP_05885679.1| chemotaxis regulator CheY [Vibrio coralliilyticus ATCC BAA-450]
 gi|260606451|gb|EEX32725.1| chemotaxis regulator CheY [Vibrio coralliilyticus ATCC BAA-450]
          Length = 119

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 52/114 (45%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI--DESME- 57
           M  +L VD S  +R++  H   D G+   E  +  + R+   K     + V+  D +M  
Sbjct: 1   MTKILAVDDSVSIRQMVSHTLRDAGY---EVETANDGRDALNKVASSKFDVVISDVNMPN 57

Query: 58  -GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            G  E +  +R  P    V +  L  E   EK   G  AGA  +L+KPFN ETL
Sbjct: 58  MGGFELVKALRDKPQYKFVPILMLTTETSTEKKQQGKSAGATGWLVKPFNPETL 111


>gi|283781112|ref|YP_003371867.1| response regulator receiver protein [Pirellula staleyi DSM 6068]
 gi|283439565|gb|ADB18007.1| response regulator receiver protein [Pirellula staleyi DSM 6068]
          Length = 111

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 28/90 (31%), Positives = 47/90 (52%), Gaps = 2/90 (2%)

Query: 20  LFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV 77
           L       V EA++  EA ++     LPN  ++D +M  +  LEF+  VR+ P    + V
Sbjct: 5   LLRGLAIEVGEASNGREALQWLRANSLPNIALVDWNMPEMDGLEFLREVRRTPSLRQLPV 64

Query: 78  YYLLMEVDFEKMIAGARAGANSFLLKPFNR 107
             +  E + ++M+    AGAN +L+KPF +
Sbjct: 65  MMVTTETEMDQMVRALAAGANEYLMKPFTQ 94


>gi|283852249|ref|ZP_06369521.1| response regulator receiver modulated serine phosphatase
           [Desulfovibrio sp. FW1012B]
 gi|283572331|gb|EFC20319.1| response regulator receiver modulated serine phosphatase
           [Desulfovibrio sp. FW1012B]
          Length = 372

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 57/113 (50%), Gaps = 4/113 (3%)

Query: 1   MDSLLLVDSSHIVRKV-GRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M  +L+ D + I R+V  RH+   FGF   EA     A    E    P+ +++D  M G+
Sbjct: 1   MTRVLIADDNAIFREVIKRHVVALFGFETVEAADGAAAVALAEAGR-PDLILLDLMMPGM 59

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             +E I  +R +P   DV + +L  E D  K      AGAN F+ KP++R+ L
Sbjct: 60  DGIEAIRRIRALPAMRDVPIVFLSAETDRRKWAEALSAGANDFISKPYHRQEL 112


>gi|255021342|ref|ZP_05293390.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Acidithiobacillus
           caldus ATCC 51756]
 gi|254969205|gb|EET26719.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Acidithiobacillus
           caldus ATCC 51756]
          Length = 140

 Score = 49.3 bits (116), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 59/114 (51%), Gaps = 8/114 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDE----SME 57
            +L+VD    +R++ R+L  + GF  F EA    +A +    +  P  LV+ +    +M+
Sbjct: 11  QILVVDDFSTMRRIIRNLLRELGFSNFDEAEDGVQALQKLRAK--PFDLVVSDWNMPNMQ 68

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G+ + +  +R  P      V  +  E   E ++  A+AG N +++KPFN ETLR
Sbjct: 69  GI-DLLRAIRADPRLRHTPVLMVTAEAKRENILEAAKAGVNGYIVKPFNAETLR 121


>gi|295097229|emb|CBK86319.1| Response regulator containing CheY-like receiver, AAA-type ATPase,
           and DNA-binding domains [Enterobacter cloacae subsp.
           cloacae NCTC 9394]
          Length = 128

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFE-------ATSVCEAREFCEKELLPNYLVIDESME 57
           L+VD    +R++ R+L  D G+   E       A +   A EF       +++V D +M 
Sbjct: 9   LVVDDFATMRRIVRNLLQDLGYSNIEEAEDGQDALNKLRAGEF-------DFVVSDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  LE +  +R  P  + + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 62  NLDGLELLKTIRLDPAMSKLPVLMVTAEAKRENIIAAAQAGANGYIVKPFTAATL 116


>gi|323137028|ref|ZP_08072108.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
 gi|322397789|gb|EFY00311.1| response regulator receiver protein [Methylocystis sp. ATCC 49242]
          Length = 121

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 58/117 (49%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L VD S  +R++     +D GF+V +A    +  E  E+   P+ +V D +M  +   
Sbjct: 4   TILTVDDSRTMRQMLELALSDAGFIVVQAEDGVDGLEALER-TKPDAIVTDINMPRLDGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            FI  VR+      V +  L  E D EK     RAGA  +++KPF+   L  A+R +
Sbjct: 63  GFIEGVRKHETCRVVPILVLTTESDNEKKERARRAGATGWIVKPFDPAKLVNAIRRV 119


>gi|167644579|ref|YP_001682242.1| response regulator receiver protein [Caulobacter sp. K31]
 gi|167347009|gb|ABZ69744.1| response regulator receiver protein [Caulobacter sp. K31]
          Length = 121

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M ++L VD S  +R+  +   +  G+ V EA +  E  E        + +V D     M+
Sbjct: 1   MTAILTVDDSASIRQAIKIALSGEGYSVTEAVNGAEGLEKGSAGGF-DLIVTDLNMPVMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           G L  I  +RQ P G  V + +L  E D E       AGA  +L KPF+ E L
Sbjct: 60  G-LAMIRELRQRPAGAGVPILFLTTESDAEIKAQAKAAGATGWLTKPFDPEQL 111


>gi|83648472|ref|YP_436907.1| chemotaxis protein histidine kinase-like kinase [Hahella chejuensis
            KCTC 2396]
 gi|83636515|gb|ABC32482.1| Chemotaxis protein histidine kinase and related kinase [Hahella
            chejuensis KCTC 2396]
          Length = 1151

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 55/117 (47%), Gaps = 5/117 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
            +L+VD S  VR   + L  D GF V  A+   +A E   + + PN L++D     M+G L
Sbjct: 1035 ILVVDDSLSVRSTLKQLLQDCGFEVVTASDGLDAVEKL-RHITPNLLLVDMEMPRMDG-L 1092

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            E   H+RQ     ++ V  L      +      +AG  ++  KP+N   L   +REL
Sbjct: 1093 ELTRHLRQQQDWANMPVVMLTSRSHEKHRSLAHKAGVTAYATKPYNDNELMDTIREL 1149


>gi|254505487|ref|ZP_05117634.1| chemotaxis protein CheY [Vibrio parahaemolyticus 16]
 gi|219551604|gb|EED28582.1| chemotaxis protein CheY [Vibrio parahaemolyticus 16]
          Length = 127

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 54/114 (47%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI--DESME- 57
           M  +L VD S  +R++  H   D G+ V  A    + ++   K +   + V+  D +M  
Sbjct: 9   MTKILAVDDSVSIRQMVSHTLKDAGYQVETAN---DGQDALSKVMSTKFDVVISDVNMPN 65

Query: 58  -GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            G  E +  +R  P    + +  L  E   +K + G  AGA  +L+KPFN ETL
Sbjct: 66  MGGFELVKALRAKPQYKFIPILMLTTETSTDKKMQGKSAGATGWLVKPFNPETL 119


>gi|219848093|ref|YP_002462526.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219542352|gb|ACL24090.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 234

 Score = 48.9 bits (115), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 54/106 (50%), Gaps = 6/106 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD    +R V +      G+ V  AT+  E  +    E  P+ +V+D  + G+  +
Sbjct: 4   TILVVDDEASIRNVAKAYLEHAGYRVLCATTGPEGLQMALDEE-PDLIVLDLMLPGMDGM 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           E  A +R+    +DVF+  L    D    +AG R GA+ +L KPF+
Sbjct: 63  EITARLREK---SDVFILMLTARSDEIDRVAGLRVGADDYLTKPFS 105


>gi|323496265|ref|ZP_08101323.1| chemotaxis protein CheY [Vibrio sinaloensis DSM 21326]
 gi|323318542|gb|EGA71495.1| chemotaxis protein CheY [Vibrio sinaloensis DSM 21326]
          Length = 119

 Score = 48.9 bits (115), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 54/114 (47%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI--DESME- 57
           M  +L VD S  +R++  H   D G+ V  A    + R+   K     + V+  D +M  
Sbjct: 1   MTKILAVDDSVSIRQMVSHTLRDAGYDVETAN---DGRDALSKITGTKFDVVISDVNMPN 57

Query: 58  -GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            G  E +  +R+ P    V +  L  E   +K + G  AGA  +L+KPFN ETL
Sbjct: 58  MGGFELVKALREKPQYKFVPILMLTTETSADKKMQGKSAGATGWLVKPFNPETL 111


>gi|296125149|ref|YP_003632401.1| response regulator receiver protein [Brachyspira murdochii DSM
           12563]
 gi|296016965|gb|ADG70202.1| response regulator receiver protein [Brachyspira murdochii DSM
           12563]
          Length = 122

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 50/111 (45%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L+VD S+  R    +      + V  A       E   K    + ++ D     M+G+
Sbjct: 4   TILIVDDSNTARASVEYTLKKGSYTVVSADDGTTGLEVLGKTPNVDMIITDLNMPKMDGI 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            EFI HVRQ+       +  L  E   EK + G  AGA+ +L+KPFN   L
Sbjct: 64  -EFIKHVRQVDQHKYTPILMLTTESQDEKKMEGKAAGASGWLVKPFNPTQL 113


>gi|329896030|ref|ZP_08271266.1| sensory box/GGDEF family protein [gamma proteobacterium IMCC3088]
 gi|328921990|gb|EGG29354.1| sensory box/GGDEF family protein [gamma proteobacterium IMCC3088]
          Length = 594

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 37/128 (28%), Positives = 59/128 (46%), Gaps = 7/128 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+ D   + R + R      G +V EA +   A +   +E  P+ + +D  M G+  L
Sbjct: 11  TILVTDDDAMTRMLTRQCLEAEGMIVLEAENGPAAIDLFVRES-PDLVFMDVQMPGMSGL 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL----RFAMRE 116
           E    +R+MP G DV +  +    D E +  G RAGA  +  KP N   L    +F +R 
Sbjct: 70  EVCERIRRMPQGRDVPILLVTGADDEESIDRGFRAGATQYKTKPVNWSLLGRDVKFMLRS 129

Query: 117 LPQMQKSK 124
              +Q  K
Sbjct: 130 SQHVQALK 137


>gi|152980357|ref|YP_001353780.1| CheY chemotaxis protein [Janthinobacterium sp. Marseille]
 gi|151280434|gb|ABR88844.1| CheY chemotaxis protein [Janthinobacterium sp. Marseille]
          Length = 132

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + G+  V EA     A      E   +++V D +M  +  L 
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGYTNVDEAEDGAMALAKLRSEQF-DFVVSDWNMPNMDGLT 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            + H+R  P  + + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 68  MLQHIRADPALSKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|302342665|ref|YP_003807194.1| response regulator receiver protein [Desulfarculus baarsii DSM
           2075]
 gi|301639278|gb|ADK84600.1| response regulator receiver protein [Desulfarculus baarsii DSM
           2075]
          Length = 128

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 66/120 (55%), Gaps = 7/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA----REFCEKELLPNYLVIDESMEG 58
           ++L+VD S  +R       +  GF V +AT+  E     ++  ++   P+ ++ D +M  
Sbjct: 4   TILVVDDSATLRMSVEMTLSPAGFTVVQATNGSEGLQALKKMEQQRTQPDMIISDINMP- 62

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFE--KMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +++ IA ++++   +  FV  L++  + E  K + G +AGA+ +L+KPF  +TL   +R+
Sbjct: 63  IMDGIAFIKEVKKTSFKFVPILVLTTEREDSKKLEGKQAGASGWLVKPFKPDTLLTVVRK 122


>gi|258591511|emb|CBE67812.1| Response regulator receiver protein [NC10 bacterium 'Dutch
           sediment']
          Length = 397

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 3/114 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    +R++  H    +G+ V +A    +A +  + E   ++++ D  M  +  LE
Sbjct: 3   ILIVDDDVDMRRLLLHTLQSWGYDVVQAIDGAQAWDLLQNEPF-SFVITDWIMPNLDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
               +R       +++  L  +   E++I G  AGA+ FL+KPFN   L+  +R
Sbjct: 62  LCRRIRGARFTRYIYIILLTAKHSKEELIKGMEAGADDFLIKPFNAGELKVRIR 115


>gi|27367550|ref|NP_763077.1| Chemotaxis regulator [Vibrio vulnificus CMCP6]
 gi|37677352|ref|NP_937748.1| chemotaxis protein CheY [Vibrio vulnificus YJ016]
 gi|320159405|ref|YP_004191783.1| chemotaxis regulator [Vibrio vulnificus MO6-24/O]
 gi|27359122|gb|AAO08067.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio vulnificus
           CMCP6]
 gi|37201898|dbj|BAC97718.1| chemotaxis protein CheY [Vibrio vulnificus YJ016]
 gi|319934717|gb|ADV89580.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio vulnificus
           MO6-24/O]
          Length = 119

 Score = 48.5 bits (114), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L VD S  +R++  H   D G+ V  A    +A +  +     + ++ D +M   G
Sbjct: 1   MVKILAVDDSVSIRQMVSHTLKDAGYDVETANDGSDALQKSKTTKF-DVVISDVNMPNMG 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             E +  +R +P    + +  L  E   EK + G  AGA  +L+KPFN +TL
Sbjct: 60  GFELVRAMRAIPQYKFIPILMLTTETSPEKKMEGKSAGATGWLVKPFNPDTL 111


>gi|110634561|ref|YP_674769.1| response regulator receiver protein [Mesorhizobium sp. BNC1]
 gi|110285545|gb|ABG63604.1| response regulator receiver protein [Chelativorans sp. BNC1]
          Length = 122

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M   L+VD S ++R V + + +    +V EA S  +A + C  E +P+ +V+D  +  + 
Sbjct: 1   MKRCLIVDDSSVIRLVAKKVLSGPEMLVAEAASADDALDICAHE-MPDIVVVDYLLPDMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
             + IA +  +       +   + E D   ++   RAGA  ++ KPF R  L  + RE
Sbjct: 60  SCDLIACLMALKAERKPVILLCMCEFDVGLLMRARRAGAVGYIQKPFTRPQLLESFRE 117


>gi|296445202|ref|ZP_06887162.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
 gi|296257376|gb|EFH04443.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
          Length = 121

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 56/118 (47%), Gaps = 5/118 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R++     +D GF V +A       E  E E  P+ +V D     M+G 
Sbjct: 4   TILTVDDSRTMREMLLLALSDAGFSVVQAEDGVHGLEVLETET-PDVIVTDINMPRMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             FI  VR+      V +  L  E D +K     RAGA  +++KPFN   L  A+R +
Sbjct: 62  FGFIEGVRRHQKHRAVPILVLTTESDGDKKDRARRAGATGWIVKPFNPVKLVDAIRRV 119


>gi|319442731|ref|ZP_07991887.1| two-component system response regulator TcsR5 [Corynebacterium
           variabile DSM 44702]
          Length = 231

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 38/116 (32%), Positives = 57/116 (49%), Gaps = 5/116 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR   R      G+ V +AT   EA+    KE  P+ +++D  +  V  LE
Sbjct: 3   ILVVDDDRSVRDTLRQSLTFNGYDVVQATDGEEAQTLIGKEN-PDLVIMDGILPKVDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            +  +R    G++V V  L  + D    +AG  AGA+ +L KPF  E L   +R L
Sbjct: 62  ILRSLRGS--GSEVLVLMLSQKSDVADRVAGLDAGADDYLTKPFALEELLARVRSL 115


>gi|291280727|ref|YP_003497561.1| two-component system, chemotaxis family, response regulator CheY
           [Deferribacter desulfuricans SSM1]
 gi|290755429|dbj|BAI81805.1| two-component system, chemotaxis family, response regulator CheY
           [Deferribacter desulfuricans SSM1]
          Length = 126

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 60/112 (53%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           ++L VD S  +R++ +++ N  GF  + EA++  EA    +++ L + ++ D +M  +  
Sbjct: 6   TILTVDDSSTMRRIIKNILNKLGFTNILEASNGAEALNILKEKQL-DLIITDWNMPEMDG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L F+  VR       + +  +  E   E ++   + G N++++KPF  ETL+
Sbjct: 65  LSFVQAVRSNKKYNVIPILMVTTEAAKEDILIALKNGVNNYIVKPFTPETLK 116


>gi|303245728|ref|ZP_07332011.1| response regulator receiver modulated serine phosphatase
           [Desulfovibrio fructosovorans JJ]
 gi|302492991|gb|EFL52856.1| response regulator receiver modulated serine phosphatase
           [Desulfovibrio fructosovorans JJ]
          Length = 374

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 57/113 (50%), Gaps = 4/113 (3%)

Query: 1   MDSLLLVDSSHIVRKV-GRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M  +L+ D + I R+V  RH+   F   V EA    EA +   +   P+ +++D  M G+
Sbjct: 1   MARVLIADDNPIFREVIKRHVTGLFDCDVIEARDGAEAVDLSGRAR-PDMILLDLVMPGM 59

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             +E I  +R +P   +V + +L  E D         AGAN F+ KP++R+ L
Sbjct: 60  DGIEAIRRIRALPGLAEVPIVFLSAETDRRVWAEALSAGANDFISKPYHRQEL 112


>gi|189425499|ref|YP_001952676.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter lovleyi SZ]
 gi|189421758|gb|ACD96156.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter lovleyi SZ]
          Length = 316

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLV--IDESMEGVLE 61
           +LLVD    +R V      D G+ V +A +  EA E C     P  L   +   M+G+  
Sbjct: 8   ILLVDDDRFMRTVLCQTLQDAGYRVSQAANGKEALELCRSTYFPIILTDWVMPEMDGI-A 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F    R++      ++  L  +   EK+I G  AGA+ +L+KP N   L
Sbjct: 67  FCRAFRELAAECYTYLILLTSQEGKEKLIEGLEAGADEYLIKPVNEAEL 115


>gi|90418377|ref|ZP_01226289.1| chemotaxis protein CheY [Aurantimonas manganoxydans SI85-9A1]
 gi|90338049|gb|EAS51700.1| chemotaxis protein CheY [Aurantimonas manganoxydans SI85-9A1]
          Length = 123

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 53/107 (49%), Gaps = 3/107 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPNYLVIDESM--EGV 59
           ++L +D S  +R++ R   +  GF+V +A       E  E  E+ P+ ++ D +M  +  
Sbjct: 4   TVLTIDDSRTMREMLRATLSSQGFIVVQAEDGAHGIEVLEGMEVEPDVIITDINMPRKDG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            +FI  VR  P    + +  L  E D EK      AGA  +++KPF+
Sbjct: 64  FQFIEEVRVDPRRRAIPILVLTTESDAEKKQRARTAGATGWIVKPFD 110


>gi|119470004|ref|ZP_01612809.1| chemotaxis protein cheY [Alteromonadales bacterium TW-7]
 gi|119446714|gb|EAW27987.1| chemotaxis protein cheY [Alteromonadales bacterium TW-7]
          Length = 123

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 62/118 (52%), Gaps = 4/118 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF  V EA     A    + ++  +++V D +M G+  
Sbjct: 2   KILVVDDFSTMRRIIKNLLRDLGFTNVQEADDGSTALPMLQNQVF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+  + ++
Sbjct: 61  IDLLRAIRADDKLKHIPVLMVTAEAKKEQIIAAAQAGVNGYIVKPFTAGTLKTKLEKV 118


>gi|332186410|ref|ZP_08388154.1| response regulator [Sphingomonas sp. S17]
 gi|332013393|gb|EGI55454.1| response regulator [Sphingomonas sp. S17]
          Length = 125

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 56/119 (47%), Gaps = 5/119 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE---KELLPNYLVIDESMEGVL 60
           ++ VD S  +R + R    D G+ V EA     A +  +    E  P+ ++ D +M  + 
Sbjct: 5   IMTVDDSPSMRMLLRAALTDMGYRVLEAEDGVHALDTLDGVTAETAPDLVITDINMPRMD 64

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            F  I  +R+ P   ++ +  L  E   EK      AGA  +++KPFN E L  A+R +
Sbjct: 65  GFGLIEALRRQPDHRNLPILVLTTESSDEKKARAREAGATGWIVKPFNPEKLAAAIRRV 123


>gi|170078637|ref|YP_001735275.1| two-component response regulator [Synechococcus sp. PCC 7002]
 gi|169886306|gb|ACB00020.1| two-component response regulator [Synechococcus sp. PCC 7002]
          Length = 219

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 67/136 (49%), Gaps = 6/136 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M  +L++D   I++K+  +L    G++V    S  +  +    E  P+ +V D     M+
Sbjct: 1   MKRILVIDDDPILQKILENLLTQAGYLVAVVLSGKQGLDIW-LEFQPDLIVSDVRMPEMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRE 116
           G  EF  ++R  P G  +   +L  + D E  + G  +GA+ ++ KPF  +E L    R+
Sbjct: 60  G-FEFCRYIRSQPTGQLIPFLFLSSQTDVEARVEGHFSGADDYIAKPFEMKELLAKIERQ 118

Query: 117 LPQMQKSKDENQFLDA 132
           L +++  + E Q L A
Sbjct: 119 LARIENIRAEMQRLAA 134


>gi|23012560|ref|ZP_00052615.1| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 136

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 53/108 (49%), Gaps = 3/108 (2%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L++D S ++R++   +       V +A +  EA + C   + P+ +++D +M  +    F
Sbjct: 5   LVIDDSKLIRRIHSRMLEQLDLQVSQAENGAEALDLCAAGM-PDLVLVDWNMPVMDGFTF 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R  P G    V    +E D E +      GA+ +++KPF+ E L
Sbjct: 64  LTRLRATPGGMAPKVVLCTIESDLEHIKRALNEGADEYIMKPFDVEIL 111


>gi|332533107|ref|ZP_08408976.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037389|gb|EGI73843.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 123

 Score = 48.1 bits (113), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 62/118 (52%), Gaps = 4/118 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF  V EA     A    + ++  +++V D +M G+  
Sbjct: 2   KILVVDDFSTMRRIIKNLLRDLGFTNVQEADDGSTALPMLQNQVF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+  + ++
Sbjct: 61  IDLLRAIRADEKLKHIPVLMVTAEAKKEQIIAAAQAGVNGYIVKPFTAGTLKTKLEKV 118


>gi|296444662|ref|ZP_06886626.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
 gi|296257930|gb|EFH04993.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
          Length = 121

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 63/119 (52%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD S ++RKV R +         EA    +A + C    +P+ +++D +M  + 
Sbjct: 1   MKQILVVDDSAVIRKVARRILEGLELSTSEAADGRKALDACAA-AMPDAILLDWNMPEMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             EF+  +R+MP G    V +   E +   + A   AGA+ +++KPF+++ +R  + E+
Sbjct: 60  GFEFLRELRRMPGGRTPKVVFCTTENEAGHIAAAIDAGADEYIMKPFDQQIVRSKLEEI 118


>gi|260769733|ref|ZP_05878666.1| chemotaxis regulator CheY [Vibrio furnissii CIP 102972]
 gi|260615071|gb|EEX40257.1| chemotaxis regulator CheY [Vibrio furnissii CIP 102972]
 gi|315182272|gb|ADT89185.1| chemotaxis protein CheY [Vibrio furnissii NCTC 11218]
          Length = 119

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 52/114 (45%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI--DESME- 57
           M  +L VD S  +R++  H   D G+ V  A    + RE   K     + V+  D +M  
Sbjct: 1   MTKILAVDDSISIRQMVSHTLKDAGYDVETAN---DGREALTKAQSTKFDVVISDVNMPN 57

Query: 58  -GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            G  E +  +R  P    + +  L  E   EK   G  AGA  +L+KPFN +TL
Sbjct: 58  MGGFELVKAIRGNPQYKFIPILMLTTETSMEKKQEGKLAGATGWLVKPFNPDTL 111


>gi|149912907|ref|ZP_01901441.1| response regulator [Roseobacter sp. AzwK-3b]
 gi|149813313|gb|EDM73139.1| response regulator [Roseobacter sp. AzwK-3b]
          Length = 422

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S   R++     + +GF V EA     A   C     P+ ++ D  M G+  L+
Sbjct: 21  VLVVDDSPAQRRIVSAALSRWGFDVMEADDGAAAMAICTSSP-PDLVISDWVMPGMNGLD 79

Query: 62  FIAHVRQMPLGTDVFVYYLLM--EVDFEKMIAGARAGANSFLLKPFNRETLR 111
           F    R MP   + + Y++L+  +   E +  G  AGA+ FL KP N   LR
Sbjct: 80  FCRMFRDMP--RENYGYFILLTSKSGKEDIACGLDAGADDFLTKPVNSSELR 129


>gi|254476369|ref|ZP_05089755.1| response regulator receiver modulated serine phosphatase [Ruegeria
           sp. R11]
 gi|214030612|gb|EEB71447.1| response regulator receiver modulated serine phosphatase [Ruegeria
           sp. R11]
          Length = 423

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 57/112 (50%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S   A E C  +  P+ ++ D  M G+  LE
Sbjct: 21  VLVVDDSRLQRRILVASLKKWGFEVVEAESGEAAMEICLADP-PDLILSDWMMPGMNGLE 79

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R+     D + Y++L+    EK  +  G  AGA+ FL KP + + LR
Sbjct: 80  FCRAFREQS--KDNYSYFILLTSKSEKNEVAEGLDAGADDFLTKPVSSDELR 129


>gi|254448586|ref|ZP_05062045.1| phosphate regulon transcriptional regulatory protein PhoB [gamma
           proteobacterium HTCC5015]
 gi|198261775|gb|EDY86061.1| phosphate regulon transcriptional regulatory protein PhoB [gamma
           proteobacterium HTCC5015]
          Length = 236

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 64/130 (49%), Gaps = 4/130 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+V+    +R++        G+   EA SV EA E    E +P+ +++D  + G   +E
Sbjct: 15  ILVVEDEQAIREMIGFALRREGYHFIEAGSVAEA-EDAIAEQVPDLMLVDWMLPGTSGVE 73

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F+ H ++  L  DV V  L    + +  I G  AGA+ ++ KPF+   L   +R + +  
Sbjct: 74  FVRHTKRDELTQDVPVIMLTARTEEDDKIVGLDAGADDYVSKPFSPRELIARIRAVLRRI 133

Query: 122 KSKDENQFLD 131
            S D  Q L+
Sbjct: 134 GSAD-GQLLE 142


>gi|163732982|ref|ZP_02140426.1| response regulator [Roseobacter litoralis Och 149]
 gi|161393517|gb|EDQ17842.1| response regulator [Roseobacter litoralis Och 149]
          Length = 429

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 59/113 (52%), Gaps = 9/113 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFC---EKELLPNYLVIDESMEGVL 60
           +L+VD S + RK+       +G+ V EA S  EA + C     EL+ +  V+  +M+G+ 
Sbjct: 25  ILVVDDSRLQRKILSSSLVRWGYDVIEAASGEEALDICIAKRPELVISDWVM-PTMDGI- 82

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           +F    R   L +D + Y++L+    EK  +  G  AGA+ FL KP N   LR
Sbjct: 83  QFCKEFRA--LTSDSYGYFILLTSKSEKNDVAEGLDAGADDFLTKPVNGNELR 133


>gi|322419913|ref|YP_004199136.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter sp. M18]
 gi|320126300|gb|ADW13860.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter sp. M18]
          Length = 311

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 59/115 (51%), Gaps = 4/115 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+ +     R + + +   +G+ V  A    EA +  + E  P  +++D  M G L+ I
Sbjct: 3   ILIAEDEPQFRDLLKEILEKWGYEVVVARDGNEAWQVLQSEDAPRLVILDWMMPG-LKGI 61

Query: 64  AHVRQMPLGT-DVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLRFAMR 115
              R++  G+ D +VY +L+    +   ++AG  AGA+ +++KPF    LR  +R
Sbjct: 62  DICRKVREGSQDPYVYIILLTAQRQDDDLVAGMEAGADDYIIKPFKSNELRVRLR 116


>gi|302879182|ref|YP_003847746.1| response regulator receiver protein [Gallionella capsiferriformans
           ES-2]
 gi|302581971|gb|ADL55982.1| response regulator receiver protein [Gallionella capsiferriformans
           ES-2]
          Length = 121

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 54/112 (48%), Gaps = 2/112 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M ++ LVD S  +      + +  G+   +A S  E     +  L P+ L+ D +M G+ 
Sbjct: 1   MKTIFLVDDSVTILLSMSAILSKAGYATEKAASAEEGLAKLKGGLKPDLLITDLNMPGMN 60

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +EFI  VR++P    + + +L  E    K      AGA+ +L+KP N E L
Sbjct: 61  GIEFIREVRKLPNHRFMPILFLTTESQQSKRDEAKAAGASGWLVKPVNAEQL 112


>gi|88802016|ref|ZP_01117544.1| response regulator DrrA [Polaribacter irgensii 23-P]
 gi|88782674|gb|EAR13851.1| response regulator DrrA [Polaribacter irgensii 23-P]
          Length = 232

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 69/128 (53%), Gaps = 6/128 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           LL+ D   I+  VG +L N+ G+ +F AT+  EA +  +K + P+ +++D     M+G+ 
Sbjct: 9   LLVDDEPDIIEIVGYNLRNE-GYQIFTATNGQEAIKSAKKNI-PHLILLDIMMPEMDGI- 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R++    +V + +L    +    +AG  AGA+ ++ KP   + L   ++ L + 
Sbjct: 66  EACEKIRKISSLENVLIAFLTARGEDYSQVAGFEAGADDYITKPIKPKVLVSKVKSLLRR 125

Query: 121 QKSKDENQ 128
            KS+ +N+
Sbjct: 126 LKSEKQNE 133


>gi|304317247|ref|YP_003852392.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
 gi|302778749|gb|ADL69308.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 320

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+L+VD     R + +++ +  G+ ++E+    EA +   + +LP+ +++D  M G+  F
Sbjct: 15  SILIVDDDKFSRTILKNILSGAGYKIYESQDGDEALKLY-RLILPDMIILDVVMPGLSGF 73

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             +  +R       V V  L    DFE+ I G   GA++++ KPFN + L   ++ L Q
Sbjct: 74  DLLRILRDEEENQLVPVILLTSSDDFEEKIHGLELGADAYITKPFNEKELLAQVKNLFQ 132


>gi|89073431|ref|ZP_01159954.1| chemotaxis protein CheY [Photobacterium sp. SKA34]
 gi|89050695|gb|EAR56176.1| chemotaxis protein CheY [Photobacterium sp. SKA34]
          Length = 127

 Score = 47.8 bits (112), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTLEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLRHIRSDDQLKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|186681380|ref|YP_001864576.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
 gi|186463832|gb|ACC79633.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
          Length = 1177

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD +  +R     +F   G+ V  A +  E      KE++P+ +V D  M  V  L
Sbjct: 820 SILVVDDNPDLRTYVSEIFRRNGYYVRTARNGYEGHSLA-KEIIPSLIVTDLMMPLVSGL 878

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E I  +R         +  L  +VD E  I G   GA+++L KPFN   L   +R L  +
Sbjct: 879 EMIQMIRNEEKLKGTPIILLTAKVDEETRIEGTEHGADAYLAKPFNDRELLAEVRNLLAL 938

Query: 121 QKSK 124
           ++++
Sbjct: 939 KENE 942


>gi|325294249|ref|YP_004280763.1| response regulator receiver protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
 gi|325064697|gb|ADY72704.1| response regulator receiver protein [Desulfurobacterium
           thermolithotrophum DSM 11699]
          Length = 133

 Score = 47.8 bits (112), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 60/116 (51%), Gaps = 10/116 (8%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNY--LVIDE----S 55
           ++L VD    +RK+ + L    G+  V EA    +A E  +K   PN   LVI +    +
Sbjct: 9   NILTVDDMAAMRKILKTLLAQLGYKNVDEAEDGKQALEILKKN--PNKYGLVITDWNMPN 66

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+ E +  +R+ P   ++ +  +  E   E ++   +AG N++++KPF  ETL+
Sbjct: 67  MTGI-ELVQEIRKDPELKNIPILMVTAEAKKENVLMAIKAGVNNYIVKPFTAETLK 121


>gi|90579945|ref|ZP_01235753.1| chemotaxis protein CheY [Vibrio angustum S14]
 gi|330445384|ref|ZP_08309036.1| response regulator [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|90438830|gb|EAS64013.1| chemotaxis protein CheY [Vibrio angustum S14]
 gi|328489575|dbj|GAA03533.1| response regulator [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 123

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIVKNLLRDLGFNNTLEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLRHIRSDDQLKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|254410153|ref|ZP_05023933.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183189|gb|EDX78173.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 237

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 52/109 (47%), Gaps = 5/109 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M  +L+VD    +R        + G+ V + +S  EA E C K   P+ +V D     M+
Sbjct: 1   MKKILVVDDDRTLRITLTRALENMGYQVQQVSSGAEALEACVKNP-PDLVVSDVMMPEMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           G+ EF   +R  P G  +   +L  + + E  I G   GA+ +L+KP N
Sbjct: 60  GI-EFCRRLRATPSGQLMPFIFLSGKGELEDRIHGHSIGADDYLIKPVN 107


>gi|163750531|ref|ZP_02157769.1| chemotaxis protein CheY [Shewanella benthica KT99]
 gi|161329686|gb|EDQ00675.1| chemotaxis protein CheY [Shewanella benthica KT99]
          Length = 127

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFSNTQEADDGTTALPMLQKGNF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R      ++ V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLKAIRADDQLKNIPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|77359759|ref|YP_339334.1| chemotaxis protein [Pseudoalteromonas haloplanktis TAC125]
 gi|76874670|emb|CAI85891.1| chemotaxis protein cheY [Pseudoalteromonas haloplanktis TAC125]
          Length = 127

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF  V EA     A    + +   +++V D +M G+  
Sbjct: 6   KILVVDDFSTMRRIIKNLLRDLGFTNVLEADDGSTALPMLQNQSF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+  + ++
Sbjct: 65  IDLLRAIRADDKLKHLPVLMVTAEAKKEQIIAAAQAGVNGYIVKPFTAGTLKTKLEKV 122


>gi|149204359|ref|ZP_01881326.1| response regulator receiver modulated serine phosphatase
           [Roseovarius sp. TM1035]
 gi|149142244|gb|EDM30291.1| response regulator receiver modulated serine phosphatase
           [Roseovarius sp. TM1035]
          Length = 428

 Score = 47.4 bits (111), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 59/112 (52%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S  EA   C ++  P+ ++ D  M G+  LE
Sbjct: 24  VLVVDDSRLQRRILTASLQRWGFEVQEAESGEEALRLC-RDQPPDLVMSDWMMPGLSGLE 82

Query: 62  FIAHVRQMPLGTDVFVYYLLM--EVDFEKMIAGARAGANSFLLKPFNRETLR 111
           F    R   L  + + Y++L+  + D +++  G  AGA+ FL KP N   LR
Sbjct: 83  FCRKFRD--LQQESYGYFILLTSKSDKDEVALGLDAGADDFLTKPVNAAELR 132


>gi|332974891|gb|EGK11804.1| DNA-binding response regulator [Desmospora sp. 8437]
          Length = 233

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+ D    +RK+ RH     G+ V EA    EA E+ EKE  P  L + + M    +  
Sbjct: 12  VLVADDDAHIRKLLRHHLQREGYRVLEAADGLEAAEWLEKE--PIELAVVDIMMPNKDGY 69

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              R++    D+ V  L  +   +   AG RAG + +L KPF  + L F ++ L
Sbjct: 70  QLCREIREDYDLPVILLTAKDQLQDKEAGYRAGTDDYLTKPFEPKELLFRIKAL 123


>gi|254510175|ref|ZP_05122242.1| response regulator [Rhodobacteraceae bacterium KLH11]
 gi|221533886|gb|EEE36874.1| response regulator [Rhodobacteraceae bacterium KLH11]
          Length = 424

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 36/112 (32%), Positives = 57/112 (50%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA +   A + C  +  P  ++ D  M G+  LE
Sbjct: 22  VLVVDDSRLQRRILVASLKKWGFEVLEADNGEAALDLCLSDP-PQLVLSDWVMPGMSGLE 80

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R   L T+ + Y++L+    EK  +  G  AGA+ FL+KP   + LR
Sbjct: 81  FCHAFRN--LATEQYSYFILLTSKSEKQEVAKGLDAGADDFLIKPLEADELR 130


>gi|315127301|ref|YP_004069304.1| chemotaxis protein [Pseudoalteromonas sp. SM9913]
 gi|315015815|gb|ADT69153.1| chemotaxis protein [Pseudoalteromonas sp. SM9913]
          Length = 127

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF  V EA     A    + +   +++V D +M G+  
Sbjct: 6   KILVVDDFSTMRRIIKNLLRDLGFTNVQEADDGSTALPMLQNQAF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+  + ++
Sbjct: 65  IDLLRAIRADEKLKHIPVLMVTAEAKKEQIIAAAQAGVNGYIVKPFTAGTLKTKLEKV 122


>gi|292489166|ref|YP_003532053.1| chemotaxis regulator CheY [Erwinia amylovora CFBP1430]
 gi|292900284|ref|YP_003539653.1| chemotaxis protein [Erwinia amylovora ATCC 49946]
 gi|291200132|emb|CBJ47258.1| chemotaxis protein [Erwinia amylovora ATCC 49946]
 gi|291554600|emb|CBA22246.1| Chemotaxis regulator CheY [Erwinia amylovora CFBP1430]
 gi|312173325|emb|CBX81580.1| Chemotaxis regulator CheY [Erwinia amylovora ATCC BAA-2158]
          Length = 127

 Score = 47.4 bits (111), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  D G+  + EA    +A          +++V D +M  +  L+
Sbjct: 8   LVVDDFATMRRIVRNLLQDLGYKNIEEAEDGQDALNRLRTSSF-DFVVSDWNMPNIDGLQ 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +RQ P    + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 67  LLKTIRQEPELMKLPVLMVTAEAKRENIIAAAQAGANGYIVKPFTAVTL 115


>gi|296445710|ref|ZP_06887664.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
 gi|296256813|gb|EFH03886.1| response regulator receiver protein [Methylosinus trichosporium
           OB3b]
          Length = 121

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/120 (30%), Positives = 58/120 (48%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M  +L VD S  VR++ R +    G+ V EA    EA      E   N ++ D     M+
Sbjct: 1   MKKVLTVDDSVSVRQMVRAVLTVAGYSVMEAKDGREALGAARSEQ-ANMVITDLNMPVMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G L FI  +R++P  + V + +L  E D         AGA  ++ KPF+++ L   +++L
Sbjct: 60  G-LTFIRELRKLPAYSGVPIVFLSTESDTAVKQEAKAAGATGWITKPFSQDQLLAVVKKL 118


>gi|259907602|ref|YP_002647958.1| Chemotaxis protein CheY [Erwinia pyrifoliae Ep1/96]
 gi|224963224|emb|CAX54708.1| Chemotaxis protein CheY [Erwinia pyrifoliae Ep1/96]
 gi|283477444|emb|CAY73360.1| Chemotaxis regulator CheY [Erwinia pyrifoliae DSM 12163]
 gi|310764892|gb|ADP09842.1| Chemotaxis protein CheY [Erwinia sp. Ejp617]
          Length = 130

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 54/108 (50%), Gaps = 2/108 (1%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L+VD    +R++ R+L  D G+   E     +      +    +++V D +M  +  L+ 
Sbjct: 8   LVVDDFATMRRIVRNLLQDLGYKNIEEAEDGQDALNKLRTSSFDFVVSDWNMPHIDGLQL 67

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +RQ P    + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 68  LKTIRQEPELMTLPVLMVTAEAKRENIIAAAQAGANGYIVKPFTAATL 115


>gi|189424819|ref|YP_001951996.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter lovleyi SZ]
 gi|189421078|gb|ACD95476.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter lovleyi SZ]
          Length = 473

 Score = 47.4 bits (111), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 36/131 (27%), Positives = 60/131 (45%), Gaps = 9/131 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY--LVIDESMEG 58
           MD +L+V+     R++   L    G+ V   T+ C   E  E+     +  +V D +M G
Sbjct: 7   MDEILIVEDDRFFRELYADLLRQAGYSV---TTACSGEEATEQLACSRFGLVVTDLTMPG 63

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +  LE +  ++      DV +  +    D E  +   + GA  FLLKP N + L  A+R 
Sbjct: 64  ISGLELLVKIKSQDPSIDVIL--VTANADLESALFSLKHGARDFLLKPINSDELLHAVRL 121

Query: 117 LPQMQKSKDEN 127
             + ++  DEN
Sbjct: 122 CMEQRRLLDEN 132


>gi|126730082|ref|ZP_01745894.1| response regulator [Sagittula stellata E-37]
 gi|126709462|gb|EBA08516.1| response regulator [Sagittula stellata E-37]
          Length = 421

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 38/112 (33%), Positives = 55/112 (49%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S +  K+   +   +GF V  ATS  EA   C  E  P+ ++ D  M G+  LE
Sbjct: 19  VLVVDDSQLQLKIVGLVLARWGFEVLTATSGPEALRIC-AETPPDLVLSDWMMPGMDGLE 77

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
                R   L  + + Y++L+    EK  +  G  AGA+ FL KP N   LR
Sbjct: 78  LCRRFRA--LDREKYGYFILLTSKSEKGDVAQGLDAGADDFLTKPVNNHELR 127


>gi|296158228|ref|ZP_06841060.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. Ch1-1]
 gi|295891564|gb|EFG71350.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. Ch1-1]
          Length = 538

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  AT++ EAR    +  +P+ +++D ++     L+ + H+   P G D+ V  +  
Sbjct: 103 GFSVDTATTLAEARAALTR-FIPDVVLVDLNLPDGSGLDLLQHLPAHPPGGDLPVIVMTG 161

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 162 NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQTLRA 211


>gi|89094437|ref|ZP_01167377.1| Chemotaxis protein CheY [Oceanospirillum sp. MED92]
 gi|89081329|gb|EAR60561.1| Chemotaxis protein CheY [Oceanospirillum sp. MED92]
          Length = 123

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 60/118 (50%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D G      T+V EA +   +  LP       ++LV D +
Sbjct: 2   KILVVDDFSTMRRIIKNLLRDLGM-----TNVQEADD--GQTALPILKQGGIDFLVTDWN 54

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  VR  P    + V  +  E   E++IA A+AG N +++KPF    L+
Sbjct: 55  MPGMTGIDLLKEVRSDPNLAHMPVLMVTAEAKKEQIIAAAQAGVNGYVVKPFTAAVLK 112


>gi|269792454|ref|YP_003317358.1| response regulator receiver protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
 gi|269100089|gb|ACZ19076.1| response regulator receiver protein [Thermanaerovibrio
           acidaminovorans DSM 6589]
          Length = 251

 Score = 47.0 bits (110), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 5/116 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLPNYLVIDESMEGVLE 61
           ++L+VD + I+R   +++  + G  V EA++  EA   F      P+ L+ D  M G+  
Sbjct: 132 TVLVVDDASIIRTGLKYILTEMGIKVLEASNGNEAYNIFLSSP--PDMLITDLIMPGMDG 189

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           F  ++  R  P  +   +  +    D  +++   R+GAN F++KPF  E ++  +R
Sbjct: 190 FALMSRFRGNPATSKRPIIVVSSYGDKPRLVKALRSGANDFIVKPFRPEVVKDKVR 245


>gi|114331271|ref|YP_747493.1| response regulator receiver protein [Nitrosomonas eutropha C91]
 gi|114308285|gb|ABI59528.1| response regulator receiver protein [Nitrosomonas eutropha C91]
          Length = 131

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 59/120 (49%), Gaps = 8/120 (6%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP---NYLVIDESMEGV-- 59
           L+VD    +R++ R+L  D GF   E     E      K+L     +++V D +M  +  
Sbjct: 9   LVVDDFSTMRRIIRNLLKDLGFNNVEE---AEDGAMALKKLRDGSFDFIVSDWNMPNMDG 65

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L  + ++R      D+ V  +  E   E +IA A+AGAN +++KPF   TL   + ++ Q
Sbjct: 66  LTMLQNIRADNALKDIPVLMVTAEAKKENIIAAAQAGANGYIVKPFTAATLDEKLNKILQ 125


>gi|300311339|ref|YP_003775431.1| CheY chemotaxis protein [Herbaspirillum seropedicae SmR1]
 gi|300074124|gb|ADJ63523.1| CheY chemotaxis protein [Herbaspirillum seropedicae SmR1]
          Length = 131

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 58/109 (53%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + G+  V EA    +A +    +   +++V D +M  +  L 
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGYTNVDEAEDGVQALQKLRSDQF-DFVVSDWNMPNMDGLT 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R+ P  + + V  +  E   E ++A A+AGAN +++KPF   TL
Sbjct: 68  MLQEIRKDPALSKLPVLMVTAEAKKENIVAAAQAGANGYVVKPFTAATL 116


>gi|225619431|ref|YP_002720659.1| chemotaxis response regulator CheY [Brachyspira hyodysenteriae WA1]
 gi|46360449|gb|AAS89036.1| chemotaxis response regulator [Brachyspira hyodysenteriae]
 gi|225214250|gb|ACN82984.1| chemotaxis response regulator CheY [Brachyspira hyodysenteriae WA1]
          Length = 122

 Score = 47.0 bits (110), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 50/111 (45%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L+VD S+  R    +      + V  A       E   K    + ++ D     M+G+
Sbjct: 4   TILIVDDSNTARASVEYTLKKGSYTVVSADDGTTGLEVLGKTPNVDMIITDLNMPKMDGI 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            EFI HVR++       +  L  E   EK + G  AGA+ +L+KPFN   L
Sbjct: 64  -EFIKHVRKVDQHKYTPILMLTTESQDEKKMEGKAAGASGWLVKPFNPTQL 113


>gi|163801863|ref|ZP_02195760.1| chemotaxis protein CheY [Vibrio sp. AND4]
 gi|159174371|gb|EDP59175.1| chemotaxis protein CheY [Vibrio sp. AND4]
          Length = 126

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPLLKKGGF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKHIRADAELKQLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|256833214|ref|YP_003161941.1| response regulator receiver protein [Jonesia denitrificans DSM
           20603]
 gi|256686745|gb|ACV09638.1| response regulator receiver protein [Jonesia denitrificans DSM
           20603]
          Length = 127

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 2/108 (1%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L++D S  +R++   +  + GF   EA    EA E  E E       ID +M  +  L +
Sbjct: 4   LVIDDSRTMRRIVSGVLKNLGFETLEAGDGQEALEVMESESDITLCCIDWNMPVMDGLTY 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  VR      DV +  +  E +  +++    AGA+ +L+KPF  E +
Sbjct: 64  VKEVRARAEWRDVTLMMITTESEHGQIVRALAAGAHEYLIKPFTPEAI 111


>gi|296272592|ref|YP_003655223.1| integral membrane sensor hybrid histidine kinase [Arcobacter
           nitrofigilis DSM 7299]
 gi|296096766|gb|ADG92716.1| integral membrane sensor hybrid histidine kinase [Arcobacter
           nitrofigilis DSM 7299]
          Length = 765

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD   + R +   + N  GF V +A+S  EA E  +KE L   + +D  M G+  L
Sbjct: 568 TILVVDDIEVNRNLLTQILNSHGFEVLQASSGYEAIELFKKEDLS-LIFMDIKMSGLDGL 626

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E I  +R+   G D+ +  +   V  E       +GAN FL KP + + L
Sbjct: 627 ETIKIIRKEEKGKDISIVAVSANVFNEDKEIAIVSGANDFLAKPVDEKEL 676


>gi|91784701|ref|YP_559907.1| two component, sigma-54 specific, Fis family transcriptional
           regulator [Burkholderia xenovorans LB400]
 gi|91688655|gb|ABE31855.1| two component, sigma54 specific, transcriptional regulator, NtrC
           subfamily, Fis family [Burkholderia xenovorans LB400]
          Length = 460

 Score = 47.0 bits (110), Expect = 0.001,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  AT++ EAR    +  +P+ +++D ++     L+ + H+   P G D+ V  +  
Sbjct: 25  GFSVDTATTIAEARTALTR-FIPDVVLVDLNLPDGSGLDVLQHLPAHPPGGDLPVIVMTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQTLRA 133


>gi|262403141|ref|ZP_06079701.1| chemotaxis regulator CheY [Vibrio sp. RC586]
 gi|262350640|gb|EEY99773.1| chemotaxis regulator CheY [Vibrio sp. RC586]
          Length = 119

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 52/112 (46%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L VD S  +R++  H   D G+ V  A+   +A    +K    + ++ D +M   G
Sbjct: 1   MTKVLAVDDSISIRQMVSHTLQDAGYEVETASDGRDALTKAQKTRF-DVIISDVNMPVMG 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             +F+  VR       + +  L  E   EK   G   GA  +L+KPFN ETL
Sbjct: 60  GFDFVKAVRMQSQYKFIPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETL 111


>gi|20808142|ref|NP_623313.1| response regulator [Thermoanaerobacter tengcongensis MB4]
 gi|20516731|gb|AAM24917.1| Response regulators consisting of a CheY-like receiver domain and a
           HTH DNA-binding domain [Thermoanaerobacter tengcongensis
           MB4]
          Length = 334

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 59/118 (50%), Gaps = 3/118 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+VD     R++ R +    G+ + EA    EA     KE+LP+ +++D  + G+  F 
Sbjct: 30  ILIVDDDRFTRRILRDILEKEGYSIIEARDGEEAFRLY-KEMLPDMVILDVVLPGMSGFD 88

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            +  +R+      + +  L  + DFE+ I G   GA+ +L+KP N + L   +  L Q
Sbjct: 89  LLKILRKEEENLMLPILVLTAKGDFEEKIKGLELGADDYLVKPVNEKELVIKVNNLFQ 146


>gi|92114140|ref|YP_574068.1| response regulator receiver domain-containing protein
           [Chromohalobacter salexigens DSM 3043]
 gi|91797230|gb|ABE59369.1| response regulator receiver domain protein (CheY-like)
           [Chromohalobacter salexigens DSM 3043]
          Length = 129

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           S+L+VD    +R++ R L  + GF  V EA    EA           ++V D +M  +  
Sbjct: 7   SILVVDDFPTMRRIVRSLLKELGFNNVDEAEDGQEALNKLRAGGF-EFVVSDWNMPNLDG 65

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  +  +RQ    +D+ V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 66  LSMLKEIRQDDALSDLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|46202470|ref|ZP_00053158.2| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 121

 Score = 47.0 bits (110), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M ++L VD S  +R++ + +    G  V EA    E         L N ++ D +M    
Sbjct: 1   MATILAVDDSPSIRQMIKVVLGPAGHTVIEAGDGAEGLAKAGSSAL-NLVITDLNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LE IA +R +P  T V + +L  E D        +AGA  ++ KPF  E L   + +L
Sbjct: 60  GLEMIAKLRGLPSCTGVPILFLSTESDEGIKQRAKQAGATGWITKPFKPEQLLAVVSKL 118


>gi|323493714|ref|ZP_08098834.1| chemotaxis protein CheY [Vibrio brasiliensis LMG 20546]
 gi|323312054|gb|EGA65198.1| chemotaxis protein CheY [Vibrio brasiliensis LMG 20546]
          Length = 119

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 53/114 (46%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI--DESME- 57
           M  +L VD S  +R++  H   D G+ V  A    + R+   K     + V+  D +M  
Sbjct: 1   MTKILAVDDSVSIRQMVSHTLRDAGYDVETAN---DGRDALSKVTSAKFDVVISDVNMPN 57

Query: 58  -GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            G  E +  +R+ P    + +  L  E   +K   G  AGA  +L+KPFN +TL
Sbjct: 58  MGGFELVKALREKPQYKFIPILMLTTETSTDKKQQGKSAGATGWLVKPFNPDTL 111


>gi|261251935|ref|ZP_05944509.1| chemotaxis regulator CheY [Vibrio orientalis CIP 102891]
 gi|260938808|gb|EEX94796.1| chemotaxis regulator CheY [Vibrio orientalis CIP 102891]
          Length = 119

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 53/114 (46%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI--DESME- 57
           M  +L VD S  +R++  H   D G+ V  A    + R+   K     + V+  D +M  
Sbjct: 1   MTKILAVDDSVSIRQMVSHTLRDAGYDVETAN---DGRDALSKVTAGKFDVVISDVNMPN 57

Query: 58  -GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            G  E +  +R+ P    + +  L  E   +K   G  AGA  +L+KPFN +TL
Sbjct: 58  MGGFELVKALREKPQYKFIPILMLTTETSTDKKQQGKSAGATGWLVKPFNPDTL 111


>gi|149188103|ref|ZP_01866398.1| chemotaxis protein CheY [Vibrio shilonii AK1]
 gi|148838091|gb|EDL55033.1| chemotaxis protein CheY [Vibrio shilonii AK1]
          Length = 122

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIVKNLLRDLGFSNTLEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLRHIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|1731161|sp|P51586|YSO1_PLEBO RecName: Full=Uncharacterized 14.6 kDa protein in sodA1 3'region;
           AltName: Full=ORF131
 gi|608552|gb|AAA69951.1| OmpR-like protein [Leptolyngbya boryana]
          Length = 131

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD     R + R +  D G +V  A +  EA    E+EL P  LV D +M  +   
Sbjct: 8   DILVVDDDPDTRDLLRFMLEDEGAIVTVAPNAKEALSLLEREL-PKLLVSDVAMPEMDGF 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           E I  VR++P G  +    L      E   A  R+G N +L KP +
Sbjct: 67  ELIGRVRELPKGETLPAIALTAYAREEDRQAALRSGFNDYLTKPVD 112


>gi|229495757|ref|ZP_04389485.1| DNA-binding response regulator/sensor histidine kinase
           [Porphyromonas endodontalis ATCC 35406]
 gi|229317331|gb|EEN83236.1| DNA-binding response regulator/sensor histidine kinase
           [Porphyromonas endodontalis ATCC 35406]
          Length = 969

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 61/117 (52%), Gaps = 7/117 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           L++ D+  I   +G  L N +   +  A +  E  E  + EL+P+ ++ D     M+G L
Sbjct: 713 LIVEDNRDIAAYIGSQLANHYA--ISYAANGLEGLEKAQ-ELVPDLIITDLMMPEMDG-L 768

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E    VR+  + + + +  +  ++  E+ I G  AGA+++L KPFN + LR  + +L
Sbjct: 769 ELCRQVRKNEIISHIPIIVVTAKISEEERIKGIEAGADAYLAKPFNSDELRTRVEKL 825


>gi|120436048|ref|YP_861734.1| two-component system sensor histidine kinase/response regulator
            hybrid [Gramella forsetii KT0803]
 gi|117578198|emb|CAL66667.1| two-component system sensor histidine kinase/response regulator
            hybrid [Gramella forsetii KT0803]
          Length = 1406

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 6/117 (5%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
            +L+VD +  +RK  R    D  + + EA +  E  E   KE++PN ++ D     M+G+ 
Sbjct: 1157 ILVVDDNKDIRKFIRQSLQD-NYNIQEAENGREGFEKA-KEIVPNIIISDLIMPEMDGI- 1213

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            EF  H +  P  + +    L  +   E  +    +GA+ +L+KPFN E L+  ++ +
Sbjct: 1214 EFCHHCKNDPATSHIPFLLLTAKDSQESELVAMESGADDYLIKPFNLELLQLKLKNI 1270


>gi|226310141|ref|YP_002770035.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226093089|dbj|BAH41531.1| probable two-component response regulator [Brevibacillus brevis
           NBRC 100599]
          Length = 123

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 61/119 (51%), Gaps = 4/119 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEA-REFCEKELLPNYLVIDESMEG 58
           M+++L+VD +   R V R++F   G  +V EA S  EA R +C     P+ +++D +M G
Sbjct: 1   MNTILIVDDTAFTRLVLRNMFEKLGIEVVAEADSGEEAVRNYCLYR--PSLVIMDITMPG 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +   +A  + + L  +  +         + +I   +AGA  F+ KP   E + +A++ L
Sbjct: 59  MNGLVASRKIIELDKNAKIIICSAVARRDTVIKAIQAGARDFIAKPLQFERIEWAVQHL 117


>gi|302036175|ref|YP_003796497.1| putative hybrid histidine kinase [Candidatus Nitrospira defluvii]
 gi|300604239|emb|CBK40571.1| putative Hybrid histidine kinase [Candidatus Nitrospira defluvii]
          Length = 415

 Score = 46.6 bits (109), Expect = 0.001,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 54/113 (47%), Gaps = 3/113 (2%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+ D   I+R   R      G++V EA +  EA E  +K   P+ +++D  M G+  F  
Sbjct: 13  LITDDDIIIRMFAREALEQAGWVVEEAQNGSEACELFQK-CPPDVVLLDVMMPGMDGFAT 71

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            A +R++P G    +  +    DFE +     AGA  F++KP N   L   +R
Sbjct: 72  CAALRRLPGGEHTPILIMTGLDDFESITKAYDAGATDFIVKPLNAMLLTHRIR 124


>gi|254444971|ref|ZP_05058447.1| hypothetical protein VDG1235_3214 [Verrucomicrobiae bacterium
           DG1235]
 gi|198259279|gb|EDY83587.1| hypothetical protein VDG1235_3214 [Verrucomicrobiae bacterium
           DG1235]
          Length = 121

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 54/113 (47%), Gaps = 5/113 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M  +L VD +  +RK+        G  V EA    EA +  ++  + + ++ D     M+
Sbjct: 1   MKRILTVDDAATMRKMVGFTLKSAGHQVLEAADGIEAFDTVQRNQV-DLVITDVNMPRMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           G+ E    +R +P    V +  L  E D  K  AG  AGA  +++KPF+++ L
Sbjct: 60  GI-ELTRRLRTLPAYRSVPIVLLTTESDPAKKSAGRAAGATGWIVKPFSQDQL 111


>gi|86146118|ref|ZP_01064444.1| chemotaxis protein CheY [Vibrio sp. MED222]
 gi|85836065|gb|EAQ54197.1| chemotaxis protein CheY [Vibrio sp. MED222]
          Length = 126

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + HVR       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKHVRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|219847767|ref|YP_002462200.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
 gi|219542026|gb|ACL23764.1| response regulator receiver protein [Chloroflexus aggregans DSM
           9485]
          Length = 390

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +LL+VD    V ++   +  + G+ V  A S  EA +   K   P+ L+ D  + G+   
Sbjct: 5   TLLIVDDDDAVAEMIELMLRNAGYEVRRAASGEEALQQIFKSP-PDALICDVLLPGIDGY 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                VRQ PL   + +  L  + D    IAG  AGAN +L KPF    L + ++ L
Sbjct: 64  TLCKRVRQHPLTRMLPILMLTAQGDISAKIAGFEAGANDYLAKPFEPPELVYRVKNL 120


>gi|218708841|ref|YP_002416462.1| chemotaxis protein CheY [Vibrio splendidus LGP32]
 gi|218321860|emb|CAV17840.1| chemotaxis protein CheY [Vibrio splendidus LGP32]
          Length = 122

 Score = 46.6 bits (109), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + HVR       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLKHVRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|317122420|ref|YP_004102423.1| transcriptional regulator [Thermaerobacter marianensis DSM 12885]
 gi|315592400|gb|ADU51696.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter marianensis DSM 12885]
          Length = 235

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 6/122 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    +R + R      GF V EA    EA E    E  P+ +++D  + G+ +  
Sbjct: 3   ILVVDDEAPMRALLRLFLEQHGFAVSEAEDGYEALERVRTER-PDLVLLDIMLPGI-DGW 60

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL----RFAMRELPQ 119
           A  R +   +DV V  L    D    ++G  AGA+ +L+KPF  E L    R  +R  P+
Sbjct: 61  AVCRILRRESDVPVIMLTARDDVRDRVSGLEAGADDYLVKPFAEEELLARIRAVLRRTPK 120

Query: 120 MQ 121
           ++
Sbjct: 121 VE 122


>gi|134094532|ref|YP_001099607.1| chemotactic response regulator [Herminiimonas arsenicoxydans]
 gi|133738435|emb|CAL61480.1| Chemotaxis protein CheY [Herminiimonas arsenicoxydans]
          Length = 132

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + G+  V EA     A      E   +++V D +M  +  L 
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGYTNVDEAEDGVMALSKLRSETF-DFVVSDWNMPNMDGLT 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R  P  + + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 68  MLQQIRADPALSKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|170725991|ref|YP_001760017.1| response regulator receiver protein [Shewanella woodyi ATCC 51908]
 gi|294140221|ref|YP_003556199.1| chemotaxis protein CheY [Shewanella violacea DSS12]
 gi|169811338|gb|ACA85922.1| response regulator receiver protein [Shewanella woodyi ATCC 51908]
 gi|293326690|dbj|BAJ01421.1| chemotaxis protein CheY [Shewanella violacea DSS12]
          Length = 127

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILVVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R      ++ V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLKAIRADDELKNIPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|284031819|ref|YP_003381750.1| winged helix family two component transcriptional regulator
           [Kribbella flavida DSM 17836]
 gi|283811112|gb|ADB32951.1| two component transcriptional regulator, winged helix family
           [Kribbella flavida DSM 17836]
          Length = 233

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 51/103 (49%), Gaps = 2/103 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+V+    +R V R    D G+ V EA     A +   K + P+ +++D  M G  +  
Sbjct: 5   VLIVEDDDRIRAVLRLALEDEGYQVAEAGDADTALDLTRKAM-PDLMIVD-LMLGATDGY 62

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
             +R++   +D+ +  +    D   ++AG  AGA+ ++ KPF 
Sbjct: 63  TCIREVRRSSDIPIVVVSARSDTHDIVAGLEAGADDYVTKPFQ 105


>gi|84388129|ref|ZP_00991025.1| chemotaxis protein CheY [Vibrio splendidus 12B01]
 gi|84377196|gb|EAP94066.1| chemotaxis protein CheY [Vibrio splendidus 12B01]
          Length = 126

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKHIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|218264787|ref|ZP_03478491.1| hypothetical protein PRABACTJOHN_04200 [Parabacteroides johnsonii
           DSM 18315]
 gi|218221793|gb|EEC94443.1| hypothetical protein PRABACTJOHN_04200 [Parabacteroides johnsonii
           DSM 18315]
          Length = 548

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 64/128 (50%), Gaps = 6/128 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           LL++D S  +R   +H+FN   + + EA +  +  +   KE  P+ ++ D  M  +   E
Sbjct: 303 LLVIDDSDQIRWFLKHVFNK-EYQILEARNGQDGIDVALKEE-PDLILCDVMMPVKDGYE 360

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++  P      V  L  +V+ E +I G  AGA+ ++ KPF+ E LR  +  L  M+
Sbjct: 361 TCREIKSDPKMAQTPVVMLTAKVESEDVITGIEAGADDYITKPFDVEILRSKINSL--MK 418

Query: 122 KSKDENQF 129
           K +D  ++
Sbjct: 419 KREDMKRY 426


>gi|119897751|ref|YP_932964.1| chemotaxis response regulator [Azoarcus sp. BH72]
 gi|119670164|emb|CAL94077.1| chemotaxis response regulator [Azoarcus sp. BH72]
          Length = 133

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 58/113 (51%), Gaps = 12/113 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE----FCEKELLP-NYLVIDESMEGV 59
           L+VD    +R++ R+L  + G+     T+V EA +      +    P +++V D +M  +
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGY-----TNVDEAEDGAVALQKLNSAPFDFVVTDWNMPNM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             L  +  +RQ P    + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 64  DGLTLLQTIRQTPQLKHLPVLMITAEAKKENIIAAAQAGASGYIVKPFTAATL 116


>gi|300694371|ref|YP_003750344.1| chemotactic response regulator, transmits chemoreceptor signals to
           flagelllar motor components [Ralstonia solanacearum
           PSI07]
 gi|299076408|emb|CBJ35724.1| chemotactic response regulator, transmits chemoreceptor signals to
           flagelllar motor components [Ralstonia solanacearum
           PSI07]
          Length = 137

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (47%), Gaps = 6/119 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKEL-LPNYLVIDE----SMEG 58
           +L+VD S  +R++        GF V EAT    A E  +++    ++LVI +    +M+G
Sbjct: 6   ILVVDDSTSIRRMIATCLRACGFAVTEATDGAAALEAVQRQTDGSHHLVITDQVMPAMDG 65

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            L  I  +R +P   D  +  L  E D         AGA  FL KPF+ + L  ++ +L
Sbjct: 66  -LTLIRALRTLPAYADTPILMLTTEADSTIRDQARAAGATGFLPKPFDPDGLTDSVMQL 123


>gi|148556090|ref|YP_001263672.1| response regulator receiver protein [Sphingomonas wittichii RW1]
 gi|148501280|gb|ABQ69534.1| response regulator receiver protein [Sphingomonas wittichii RW1]
          Length = 136

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 56/117 (47%), Gaps = 2/117 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L VD S  +RK+ R   +  GF+V EA     A E+ +    P+ ++ D +M  +  F
Sbjct: 18  TILTVDDSAFIRKLLRMALSGQGFLVAEAEDGVAALEWLDVHDRPDVMITDINMPRLDGF 77

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             +A VR       + +  L  E   +K      AGA+ +L+KPF+   L  A+  +
Sbjct: 78  GLVAAVRAQDRHDGMPILVLSTESSDDKQDRARTAGADGWLVKPFDPAQLARAIESV 134


>gi|284993345|ref|YP_003411900.1| response regulator receiver protein [Geodermatophilus obscurus DSM
           43160]
 gi|284066591|gb|ADB77529.1| response regulator receiver protein [Geodermatophilus obscurus DSM
           43160]
          Length = 127

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/109 (24%), Positives = 55/109 (50%), Gaps = 2/109 (1%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L++D S  +R++       FG+   +A    EA +  ++   P+   ID +M  +  L+F
Sbjct: 4   LVIDDSRAMRRIVSAALEGFGYETRQAGHGREALDVLQEGYAPDLCTIDWNMPVMDGLQF 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ VR  P    + +  +  E +  +++    AGA+ +++KPF  + LR
Sbjct: 64  VSAVRANPAWRALTLMMVTSESEQGQIVRALAAGAHEYVIKPFTADALR 112


>gi|325293904|ref|YP_004279768.1| chemotaxis receiver protein [Agrobacterium sp. H13-3]
 gi|325061757|gb|ADY65448.1| chemotaxis receiver protein [Agrobacterium sp. H13-3]
          Length = 122

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 7/118 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY--LVIDESMEGV-- 59
           +L VD S  +R   +      G+ + EA    + ++   K    N+  +V D +M  +  
Sbjct: 5   ILTVDDSASIRMTTKIALTGAGYQITEA---VDGQDGLAKAKAANFDLIVTDLNMPNMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           LE I  +RQ P  T + + +L  E D +       AGA  +L KPF+ E L   +R++
Sbjct: 62  LEMIEALRQSPAHTGIPIIFLTTESDADMKARAKAAGATGWLTKPFDAEHLVKIVRKV 119


>gi|91223563|ref|ZP_01258828.1| chemotaxis protein CheY [Vibrio alginolyticus 12G01]
 gi|153835420|ref|ZP_01988087.1| chemotaxis protein CheY [Vibrio harveyi HY01]
 gi|262393606|ref|YP_003285460.1| chemotaxis regulator CheY [Vibrio sp. Ex25]
 gi|91191649|gb|EAS77913.1| chemotaxis protein CheY [Vibrio alginolyticus 12G01]
 gi|148868041|gb|EDL67224.1| chemotaxis protein CheY [Vibrio harveyi HY01]
 gi|262337200|gb|ACY50995.1| chemotaxis regulator CheY [Vibrio sp. Ex25]
          Length = 126

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKHIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|54308133|ref|YP_129153.1| putative chemotaxis protein CheY [Photobacterium profundum SS9]
 gi|90411041|ref|ZP_01219055.1| putative chemotaxis protein CheY [Photobacterium profundum 3TCK]
 gi|46912559|emb|CAG19351.1| putative chemotaxis protein CheY [Photobacterium profundum SS9]
 gi|90328254|gb|EAS44565.1| putative chemotaxis protein CheY [Photobacterium profundum 3TCK]
          Length = 127

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTHEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKHIRVDEKLKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|312962253|ref|ZP_07776745.1| response regulator receiver domain protein (CheY) [Pseudomonas
           fluorescens WH6]
 gi|311283590|gb|EFQ62179.1| response regulator receiver domain protein (CheY) [Pseudomonas
           fluorescens WH6]
          Length = 128

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 12/116 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPN-----YLVIDESME 57
            +L+VD    +R++ ++L  D GF     T+  EA +      + N     +LV D +M 
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTVEADDGLTAIPILNSGSIDFLVTDWNMP 60

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G+  ++ + HVR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 61  GMTGIDLLRHVRADEKLRSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|148976431|ref|ZP_01813137.1| chemotaxis protein CheY [Vibrionales bacterium SWAT-3]
 gi|145964254|gb|EDK29510.1| chemotaxis protein CheY [Vibrionales bacterium SWAT-3]
          Length = 122

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLKHIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|152997430|ref|YP_001342265.1| response regulator receiver protein [Marinomonas sp. MWYL1]
 gi|150838354|gb|ABR72330.1| response regulator receiver protein [Marinomonas sp. MWYL1]
          Length = 126

 Score = 46.2 bits (108), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ ++L  D GF    EA     A    +   + ++LV D +M G+  +
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGFTNTVEADDGTTALPILQAGTI-DFLVTDWNMPGMTGI 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VR       + V  +  E   +++IA A+AG N +++KPF    L+
Sbjct: 62  ELLRAVRADEKLKSIPVLMVTAEAKRDQIIAAAQAGVNGYVVKPFTAVALK 112


>gi|94312626|ref|YP_585835.1| response regulator receiver domain-containing protein [Cupriavidus
           metallidurans CH34]
 gi|93356478|gb|ABF10566.1| response regulator receiver domain protein [Cupriavidus
           metallidurans CH34]
          Length = 139

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 56/114 (49%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESMEG 58
           +L+VD    +R++ R+L  + GF     T+V EA +        K+    ++V D +M  
Sbjct: 18  ILVVDDFPTMRRIIRNLLKELGF-----TNVDEAEDGAAGLEKVKDGSFQFVVSDWNMPN 72

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  L  +  +R  P      V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 73  MDGLTMLQTIRATPEIAKTPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 126


>gi|255022041|ref|ZP_05294047.1| chemotaxis protein CheY [Acidithiobacillus caldus ATCC 51756]
 gi|254968527|gb|EET26083.1| chemotaxis protein CheY [Acidithiobacillus caldus ATCC 51756]
          Length = 135

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 57/110 (51%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R+V R+L  + GF  V EA    +A +    +   N++V D +M  +  ++
Sbjct: 14  LVVDDFATMRRVVRNLLRELGFNKVEEAEDGVDALQKLRSKPF-NFVVTDWNMPNMQGID 72

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +  +R       + V  +  E   E +I  A+AG N +++KPFN +TLR
Sbjct: 73  LLRAIRADSALHAIPVLMVTAEAKRENIIEAAQAGVNGYIVKPFNADTLR 122


>gi|126658291|ref|ZP_01729441.1| Two component Transcriptional regulator, Winged helix family
           protein [Cyanothece sp. CCY0110]
 gi|126620440|gb|EAZ91159.1| Two component Transcriptional regulator, Winged helix family
           protein [Cyanothece sp. CCY0110]
          Length = 225

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 53/95 (55%), Gaps = 10/95 (10%)

Query: 43  KELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF 100
           +E  P+ +++D  + G+  LE    +RQ   G+ V +  L  + D    +AG  AGA+ +
Sbjct: 44  RESNPDLILLDWMLPGISGLEICKRLRQT--GSKVPIILLTAKDDISDRVAGLDAGADDY 101

Query: 101 LLKPFNRETLRFAMRELPQMQKSKDEN----QFLD 131
           ++KPFN E L   +R    ++++K+EN    QFLD
Sbjct: 102 IVKPFNLEELLARVR--ANLRRNKEENPDLLQFLD 134


>gi|77457791|ref|YP_347296.1| response regulator receiver domain-containing protein [Pseudomonas
           fluorescens Pf0-1]
 gi|77381794|gb|ABA73307.1| chemotaxis protein CheY [Pseudomonas fluorescens Pf0-1]
          Length = 127

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 12/116 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPN-----YLVIDESME 57
            +L+VD    +R++ ++L  D GF     T+  EA +      + N     +LV D +M 
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTVEADDGTTAIPVLNSGSIDFLVTDWNMP 60

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G+  ++ + HVR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 61  GMTGIDLLRHVRADEKLKHLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|28899005|ref|NP_798610.1| chemotaxis protein CheY [Vibrio parahaemolyticus RIMD 2210633]
 gi|153836991|ref|ZP_01989658.1| chemotaxis protein CheY [Vibrio parahaemolyticus AQ3810]
 gi|308094692|ref|ZP_05891154.2| chemotaxis protein CheY [Vibrio parahaemolyticus AN-5034]
 gi|308095294|ref|ZP_05904775.2| chemotaxis protein Chey [Vibrio parahaemolyticus Peru-466]
 gi|308125864|ref|ZP_05777806.2| chemotaxis protein CheY [Vibrio parahaemolyticus K5030]
 gi|308126173|ref|ZP_05908347.2| chemotaxis protein CheY [Vibrio parahaemolyticus AQ4037]
 gi|6952814|gb|AAF32415.1| chemotaxis protein CheY [Vibrio parahaemolyticus]
 gi|28807224|dbj|BAC60494.1| chemotaxis protein CheY [Vibrio parahaemolyticus RIMD 2210633]
 gi|149749764|gb|EDM60509.1| chemotaxis protein CheY [Vibrio parahaemolyticus AQ3810]
 gi|308088882|gb|EFO38577.1| chemotaxis protein Chey [Vibrio parahaemolyticus Peru-466]
 gi|308094275|gb|EFO43970.1| chemotaxis protein CheY [Vibrio parahaemolyticus AN-5034]
 gi|308107348|gb|EFO44888.1| chemotaxis protein CheY [Vibrio parahaemolyticus AQ4037]
 gi|308115401|gb|EFO52941.1| chemotaxis protein CheY [Vibrio parahaemolyticus K5030]
 gi|328474458|gb|EGF45263.1| chemotaxis protein CheY [Vibrio parahaemolyticus 10329]
          Length = 126

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKHIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|88858090|ref|ZP_01132732.1| chemotaxis protein cheY [Pseudoalteromonas tunicata D2]
 gi|88819707|gb|EAR29520.1| chemotaxis protein cheY [Pseudoalteromonas tunicata D2]
          Length = 123

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF  V EA     A    + +   +++V D +M G+  
Sbjct: 2   KILVVDDFSTMRRIIKNLLRDLGFTNVQEADDGSTALPMLQNQEF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 61  IDLLRAIRADDKLKHLPVLMVTAEAKKEQIIAAAQAGVNGYIVKPFTAATLK 112


>gi|294676890|ref|YP_003577505.1| chemotaxis protein CheY [Rhodobacter capsulatus SB 1003]
 gi|294475710|gb|ADE85098.1| chemotaxis protein CheY-1 [Rhodobacter capsulatus SB 1003]
          Length = 121

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L +D S  +R +     +  G+ V EA +  E     + E + + +V+D +M      
Sbjct: 4   TVLTIDDSKAIRDMVSFTLSGVGYRVVEAENGLEGLAKLKSEPV-SLVVVDLNMPVMNGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           EFI   RQ P G+ V +  L  E   E    G   GA  +L KPF+   L    R+L
Sbjct: 63  EFIRKARQEPKGSGVPILMLTTETKPEAKAEGKALGATGWLNKPFDAAMLVAVARKL 119


>gi|156975412|ref|YP_001446319.1| hypothetical protein VIBHAR_03143 [Vibrio harveyi ATCC BAA-1116]
 gi|84578778|dbj|BAE72831.1| chemotaxis protein CheY [Vibrio alginolyticus]
 gi|156527006|gb|ABU72092.1| hypothetical protein VIBHAR_03143 [Vibrio harveyi ATCC BAA-1116]
          Length = 130

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 10  KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 68

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 69  IDLLKHIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 120


>gi|261252376|ref|ZP_05944949.1| chemotaxis regulator CheY [Vibrio orientalis CIP 102891]
 gi|323499558|ref|ZP_08104528.1| hypothetical protein VISI1226_23142 [Vibrio sinaloensis DSM 21326]
 gi|260935767|gb|EEX91756.1| chemotaxis regulator CheY [Vibrio orientalis CIP 102891]
 gi|323315431|gb|EGA68472.1| hypothetical protein VISI1226_23142 [Vibrio sinaloensis DSM 21326]
          Length = 126

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKHIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|17549628|ref|NP_522968.1| putative chemotaxis response regulator transcription regulator
           protein [Ralstonia solanacearum GMI1000]
 gi|17431882|emb|CAD18560.1| putative chemotaxis response regulator transcription regulator
           protein [Ralstonia solanacearum GMI1000]
 gi|299069795|emb|CBJ41075.1| chemotactic response regulator, transmits chemoreceptor signals to
           flagelllar motor components [Ralstonia solanacearum
           CMR15]
          Length = 137

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 57/119 (47%), Gaps = 6/119 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKEL-LPNYLVIDE----SMEG 58
           +L+VD S  +R++        GF V EAT    A E  +++    ++LVI +    +M+G
Sbjct: 6   ILVVDDSTSIRRMIATCLRACGFAVTEATDGAAALEAVQRQADGSHHLVITDQVMPAMDG 65

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            L  I  +R +P   D  +  L  E D         AGA  FL KPF+ + L  ++ +L
Sbjct: 66  -LTLIRALRTLPAYADTPILMLTTEADSTIRDQARAAGATGFLPKPFDPDGLTDSVMQL 123


>gi|70729058|ref|YP_258794.1| chemotaxis protein chey [Pseudomonas fluorescens Pf-5]
 gi|68343357|gb|AAY90963.1| chemotaxis protein chey [Pseudomonas fluorescens Pf-5]
          Length = 123

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 58/116 (50%), Gaps = 12/116 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPN-----YLVIDESME 57
            +L+VD    +R++ ++L  D GF     T+  EA +      + N     +LV D +M 
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGF-----TNTVEADDGTTAIPVLNSGSIDFLVTDWNMP 56

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G+  ++ + HVR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 57  GMTGIDLLRHVRADEKLKHLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 112


>gi|309792418|ref|ZP_07686884.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Oscillochloris trichoides DG6]
 gi|308225528|gb|EFO79290.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Oscillochloris trichoides DG6]
          Length = 330

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 3   SLLLVDSSHIVRK-VGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEG 58
           S+++ D   + R+ +  +L  D G  +  AT+  E      +E+LP+ +++D    +M+G
Sbjct: 5   SIVVADDEPVARELIASYLARD-GHQIHTATNGLECLHLA-REILPDLILLDVMMPTMDG 62

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE   H+R  PL  +V V  +    D    + G  AGA+ FL KP +   LR  ++ + 
Sbjct: 63  -LEACQHIRSDPLLAEVPVLIISTLDDRTSRLNGINAGADDFLTKPIDSLELRVRVQSIT 121

Query: 119 QMQKSK 124
           ++ + +
Sbjct: 122 RLNRYR 127


>gi|225872621|ref|YP_002754078.1| chemotaxis protein CheY [Acidobacterium capsulatum ATCC 51196]
 gi|225791309|gb|ACO31399.1| chemotaxis protein CheY [Acidobacterium capsulatum ATCC 51196]
          Length = 129

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 56/113 (49%), Gaps = 6/113 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGF---MVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           +L+VD S ++RK+        G     V+EA S  EA E  + + + + +  D +M  + 
Sbjct: 6   VLIVDDSAVMRKIVERSLRSAGLALAQVWEAGSGKEALEVLQAQQV-DLIFSDINMPEMN 64

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            LEF+A V    L   V +  +  E   E ++   +AGA  ++LKPF  E ++
Sbjct: 65  GLEFLAQVSAKQLAPGVPIVMITTEGSEEHVVQAVQAGARGYILKPFTAEQIK 117


>gi|154253127|ref|YP_001413951.1| response regulator receiver protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154157077|gb|ABS64294.1| response regulator receiver protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 153

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 55/116 (47%), Gaps = 7/116 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--- 57
           M++ L+ D S   R+   HL    GF V  A+   EA         P+ ++ID  +E   
Sbjct: 1   MNTALVADLSPASRRAASHLLERLGFRVAGASGSEEALAMAAGTA-PDLIMIDGRLEMPS 59

Query: 58  -GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRF 112
            G+L  +  +R++P G D  ++++  +     +     AGA+ +L KPF+   L F
Sbjct: 60  GGLL--VEALRRLPGGQDFCLFHVTGDAAPASVRRAIEAGADDYLAKPFDEALLAF 113


>gi|323704482|ref|ZP_08116060.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323535944|gb|EGB25717.1| response regulator receiver modulated diguanylate cyclase
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 310

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 62/119 (52%), Gaps = 3/119 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+L+VD   + R + +++    G+ ++E+    EA +   + +LP+ +++D  M G+  F
Sbjct: 5   SILIVDDDKLSRTILKNILGSAGYKIYESQDGDEALKLYRR-ILPDMVILDVVMPGLSGF 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             +  +R       V V  L    ++E+ + G   GA++++ KPFN + L   ++ L Q
Sbjct: 64  DLLRILRDEEENQLVPVILLTSSDNYEEKLHGLELGADAYITKPFNEKELLAQVKNLFQ 122


>gi|323493328|ref|ZP_08098451.1| chemotaxis protein CheY [Vibrio brasiliensis LMG 20546]
 gi|323312414|gb|EGA65555.1| chemotaxis protein CheY [Vibrio brasiliensis LMG 20546]
          Length = 122

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLKHIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|332143243|ref|YP_004428981.1| transcriptional regulator NarL [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327553265|gb|AEA99983.1| transcriptional regulator NarL [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 217

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 64/118 (54%), Gaps = 7/118 (5%)

Query: 3   SLLLVDSSHIVRKVGRHL--FNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD   ++RK    L  F D   ++ EA+S  EA E    +L P+ + +D +M+G+ 
Sbjct: 8   TIMMVDDHPLLRKGLNQLIEFEDDLEVIGEASSGKEAIEMA-VQLEPDLITLDLNMQGMD 66

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
            LE + H+R    G D  +  L +  + E ++   R+GA+ +LLK  + E +   +RE
Sbjct: 67  GLETLKHLRDK--GVDSRIIMLTVSDNDEDVVEAVRSGADGYLLKDMDPEDIVDKLRE 122


>gi|110677808|ref|YP_680815.1| response regulator [Roseobacter denitrificans OCh 114]
 gi|109453924|gb|ABG30129.1| response regulator [Roseobacter denitrificans OCh 114]
          Length = 403

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 56/111 (50%), Gaps = 9/111 (8%)

Query: 6   LVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVLEF 62
           +VD S + RK+       +G+ V EA S  EA + C  +  P  ++ D     M+G+ +F
Sbjct: 1   MVDDSRLQRKILSSSLVRWGYEVIEAASGEEALDICIAQR-PELVISDWVMPMMDGI-QF 58

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
               R+  L +D + Y++L+    EK  +  G  AGA+ FL KP N   LR
Sbjct: 59  CKEFRE--LTSDSYGYFILLTSKSEKNDVAEGLDAGADDFLTKPVNGNELR 107


>gi|254491807|ref|ZP_05104986.1| hypothetical protein MDMS009_2142 [Methylophaga thiooxidans DMS010]
 gi|224463285|gb|EEF79555.1| hypothetical protein MDMS009_2142 [Methylophaga thiooxydans DMS010]
          Length = 124

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    E   + ++L+ D +M G+  
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGFNNTLEADDGITALPILEAGGI-DFLITDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  VR       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLKTVRADEKLATLPVLMVTAETKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|260909644|ref|ZP_05916341.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           sp. oral taxon 472 str. F0295]
 gi|260636255|gb|EEX54248.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           sp. oral taxon 472 str. F0295]
          Length = 935

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 64/123 (52%), Gaps = 9/123 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--ELLPNYLVIDESMEGV-- 59
           L++ D++ +   +G  L + +G +        + ++  EK  +L+P+ +V D  M G+  
Sbjct: 686 LVIDDNADVAAFIGSQLSDKYGIIYAH-----DGQDGLEKAEQLVPDVIVTDLMMPGIDG 740

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R   + + + +  +  ++     + G  AGA+++L KPFNR+ LR  + +L +
Sbjct: 741 LEVCRRIRANEVTSHIPIIVVTAKITENDRVKGLEAGADAYLSKPFNRDELRMRVEKLLE 800

Query: 120 MQK 122
            ++
Sbjct: 801 QRR 803


>gi|260776432|ref|ZP_05885327.1| chemotaxis regulator CheY [Vibrio coralliilyticus ATCC BAA-450]
 gi|260607655|gb|EEX33920.1| chemotaxis regulator CheY [Vibrio coralliilyticus ATCC BAA-450]
          Length = 126

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKHIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|134299411|ref|YP_001112907.1| response regulator receiver modulated diguanylate cyclase
           [Desulfotomaculum reducens MI-1]
 gi|134052111|gb|ABO50082.1| response regulator receiver modulated diguanylate cyclase
           [Desulfotomaculum reducens MI-1]
          Length = 419

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 57/105 (54%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM-EG-VLE 61
           L++ D + +V+ V   L  D GF V EATS  EA    +++ + + ++ID  M EG   E
Sbjct: 130 LVVDDDATLVQAVKERLTLD-GFEVLEATSAREAVSILKRKQVIDLMIIDIVMPEGNGFE 188

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
             A +R+  +  D  + ++  E   +K + G + GA+ +++KP +
Sbjct: 189 LCAKIRKEKVYEDTPIIFMTAETSLDKKLEGFKIGADDYVVKPIS 233


>gi|322418221|ref|YP_004197444.1| Fis family two component sigma54 specific transcriptional regulator
           [Geobacter sp. M18]
 gi|320124608|gb|ADW12168.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Geobacter sp. M18]
          Length = 453

 Score = 45.8 bits (107), Expect = 0.002,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 60/129 (46%), Gaps = 5/129 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L++D    +R+V  +     G+ V+ A       +  E E  P  ++ D  M G+   E
Sbjct: 5   ILIIDDDSSLRRVLEYNLQQEGYDVYTAADGAAGLQLFE-ERSPQLVITDLKMPGMTGFE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            ++ V++    T V V      +D    +   + GA  +L KPFNRE L+  + +  Q+Q
Sbjct: 64  VLSTVKERAPSTVVIVLTAFGAID--TAVEAMKLGAFHYLTKPFNREELKVTVLKGLQLQ 121

Query: 122 KSKDENQFL 130
              +EN+ L
Sbjct: 122 GLSEENRLL 130


>gi|34496471|ref|NP_900686.1| chemotaxis protein CheY [Chromobacterium violaceum ATCC 12472]
 gi|34102324|gb|AAQ58690.1| chemotaxis protein CheY [Chromobacterium violaceum ATCC 12472]
          Length = 122

 Score = 45.8 bits (107), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 60/119 (50%), Gaps = 7/119 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEG 58
           ++L+VD S  +R+V R      G+ V EA +  EA +  +   +  +L+I +     M+G
Sbjct: 4   TILIVDDSTTLRQVVRMTLAGAGYEVLEAGNGKEALDILDGRKI--HLIISDVNMPQMDG 61

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            L  + +++Q+P      V  L  E   +K   G  AGA ++++KPF    L  A+ +L
Sbjct: 62  -LALLKNIKQLPHYKFTPVIMLTTESAEDKKREGKEAGAKAWVVKPFQPPVLLTAVSKL 119


>gi|256376445|ref|YP_003100105.1| response regulator receiver protein [Actinosynnema mirum DSM 43827]
 gi|255920748|gb|ACU36259.1| response regulator receiver protein [Actinosynnema mirum DSM 43827]
          Length = 129

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 59/110 (53%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEARE-FCEKELLPNYLVIDESMEGV--L 60
           +++D S  +R + R L    GF  V EA +   A +   ++E  PN  ++D +M  +  L
Sbjct: 4   IVIDDSRAMRVILRRLLEGHGFGEVLEAENGQVALDVLAQQETAPNLALVDWNMPVMDGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +FI   R+ P   ++ +  +  E + E+++    +GA+ +++KPFN E +
Sbjct: 64  QFIMTARKTPALREMTLMMVTTESEQEQIVRALASGAHEYVIKPFNAEGI 113


>gi|116619216|ref|YP_821372.1| two component transcriptional regulator [Candidatus Solibacter
           usitatus Ellin6076]
 gi|116222378|gb|ABJ81087.1| two component transcriptional regulator, winged helix family
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 228

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 60/122 (49%), Gaps = 10/122 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    +R+V +       + V EA +  +A E    E+ PN +++D +M G+  LE
Sbjct: 6   ILVVDDDPQIRRVMKATLVGHSYEVIEARTGEDALEALPHEM-PNLVLLDMNMPGMGGLE 64

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL----RFAMREL 117
               +R    GTD+ V  L +    +  +A   AGA+ ++ KPF  E L    R A+R  
Sbjct: 65  TCRAIRS---GTDIPVIILSVRNTEKDKVAALDAGADDYVTKPFGIEELLARIRAALRRS 121

Query: 118 PQ 119
           P 
Sbjct: 122 PS 123


>gi|323691250|ref|ZP_08105525.1| hypothetical protein HMPREF9475_00387 [Clostridium symbiosum
           WAL-14673]
 gi|323504590|gb|EGB20377.1| hypothetical protein HMPREF9475_00387 [Clostridium symbiosum
           WAL-14673]
          Length = 457

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 63/134 (47%), Gaps = 5/134 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD   ++R        D G+    A ++ EA E C K+  PN +++D  +E   
Sbjct: 1   MKKILVVDDEFLIRYTLEEGLKDRGYDAKSAGTIEEAVE-CVKKFHPNVVILDNLLEHSV 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++ IA  + M    D+ V  +       + +   + GA  ++LKPF+ + + F ++   
Sbjct: 60  GMDEIATFKNMD--EDIQVILMTAYGSVSQAVEATKRGAYDYVLKPFDVDEIDFIIKRCL 117

Query: 119 QMQKSKDENQFLDA 132
           +  K +D  +FL  
Sbjct: 118 EQMKRRDSLEFLKG 131


>gi|162453846|ref|YP_001616213.1| hypothetical protein sce5570 [Sorangium cellulosum 'So ce 56']
 gi|161164428|emb|CAN95733.1| unnamed protein product [Sorangium cellulosum 'So ce 56']
          Length = 355

 Score = 45.4 bits (106), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD      ++ R   + +GF +  AT+   A +   KE+ P+ +++D  MEG+   
Sbjct: 9   TVLIVDDEPRNLRLLRDNLSGWGFEIAAATNGLRAIQLA-KEVAPDLILLDVKMEGIDGF 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEK-MIAGARAGANSFLLKPFNRETLRFAMR---E 116
           E    ++  P  +D+ V ++    +     + G   GA  FLLKPF  E L   +R   +
Sbjct: 68  ETCRRLKTDPATSDIPVIFMTASTEMSADKVKGLNLGAVDFLLKPFQSEELLARVRVQTK 127

Query: 117 LPQMQKS 123
           L Q+ KS
Sbjct: 128 LRQLMKS 134


>gi|218440881|ref|YP_002379210.1| response regulator receiver protein [Cyanothece sp. PCC 7424]
 gi|218173609|gb|ACK72342.1| response regulator receiver protein [Cyanothece sp. PCC 7424]
          Length = 125

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 61/122 (50%), Gaps = 9/122 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M ++L+VD S  +R++   L    G  V EA S  EA+E  +K++ P+ ++ D     M 
Sbjct: 1   MITVLIVDDSASLRQILLELLEKRGINVLEAASGMEAQEVIQKQI-PDLVITDLIMPQMN 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNR----ETLRFA 113
           G  E    ++  P   DV V     + +      G + GA++++ KPF+     +T++F 
Sbjct: 60  G-YELCRWIKNNPNTQDVPVLICSTKSEEFDRYWGMKQGADAYITKPFDNAEMLQTIKFL 118

Query: 114 MR 115
           ++
Sbjct: 119 LQ 120


>gi|153873132|ref|ZP_02001814.1| signal transduction histidine kinase [Beggiatoa sp. PS]
 gi|152070402|gb|EDN68186.1| signal transduction histidine kinase [Beggiatoa sp. PS]
          Length = 480

 Score = 45.4 bits (106), Expect = 0.003,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 60/123 (48%), Gaps = 3/123 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD     R+  + L     + +  A S  EA      EL+P+ +++D  M G+   E
Sbjct: 7   LLIVDDEKRGREALKILLASENYQLILAASGEEAL-LKAPELVPDLILLDVMMPGMDGFE 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
              H+R  P   +V +  L    D +  + G  AGA+ F++KPF+R  L   +R + ++ 
Sbjct: 66  VCQHIRAHPQLGEVPIIMLTAMSDRKTRLRGIEAGADDFIIKPFDRVELLARVRTIIRLN 125

Query: 122 KSK 124
           + +
Sbjct: 126 RYR 128


>gi|75908165|ref|YP_322461.1| two component transcriptional regulator [Anabaena variabilis ATCC
           29413]
 gi|75701890|gb|ABA21566.1| two component transcriptional regulator, winged helix family
           [Anabaena variabilis ATCC 29413]
          Length = 238

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 38/142 (26%), Positives = 69/142 (48%), Gaps = 14/142 (9%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV 59
           MD L++ D S I + + +H     GF    +     A R F E+   P+ +++D  + G+
Sbjct: 1   MDILIVEDESEIAQLI-QHSLEKEGFSCRTSRDGINALRMFQEQP--PDLIILDLMIPGL 57

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RET 109
             LE  A +RQ P   D ++  L  + +    + G   GA+ +++KPF+        R  
Sbjct: 58  DGLEVCARIRQKPGAKDPYILMLTAKGEEIDRVIGLSTGADDYMVKPFSPRELVARVRAL 117

Query: 110 LRFAMRELPQMQKSKDENQFLD 131
           LR ++R+  Q Q S+ ++  +D
Sbjct: 118 LRRSLRQGGQNQVSRTQHFIVD 139


>gi|331092928|ref|ZP_04587718.2| chemotaxis protein CheY [Pseudomonas syringae pv. oryzae str. 1_6]
 gi|331022112|gb|EGI02169.1| chemotaxis protein CheY [Pseudomonas syringae pv. oryzae str. 1_6]
          Length = 128

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR      ++ V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 60  PGMSGIDLLRQVRADDRLKNLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|288941366|ref|YP_003443606.1| two component transcriptional regulator PhoB, winged helix family
           [Allochromatium vinosum DSM 180]
 gi|288896738|gb|ADC62574.1| two component transcriptional regulator PhoB, winged helix family
           [Allochromatium vinosum DSM 180]
          Length = 228

 Score = 45.4 bits (106), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 51/108 (47%), Gaps = 3/108 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M ++L++D    +R+V R       F V EA    EAR+    E  P+ +++D  + G  
Sbjct: 1   MTTILVIDDEPDIREVMRFALESSDFRVMEAGHADEARKLLSNET-PDLILLDWMLPGRS 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            LE    ++Q P    + +  +    + E  + G   GA+ ++ KPF+
Sbjct: 60  GLELAQQLKQNPKTKSIPIIMISARGEEEDRVKGLDTGADDYIAKPFS 107


>gi|87119466|ref|ZP_01075363.1| Response regulator receiver domain protein (CheY) [Marinomonas sp.
           MED121]
 gi|86164942|gb|EAQ66210.1| Response regulator receiver domain protein (CheY) [Marinomonas sp.
           MED121]
          Length = 130

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ ++L  D GF    EA     A    +   + ++LV D +M G+  +
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGFTNTVEADDGTTALPILQSGTI-DFLVTDWNMPGMTGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VR       + V  +  E   +++I+ A+AG N +++KPF    L+
Sbjct: 66  ELLRSVRADEKLKTIPVLMVTAEAKRDQIISAAQAGVNGYVVKPFTAVALK 116


>gi|238796928|ref|ZP_04640432.1| hypothetical protein ymoll0001_33390 [Yersinia mollaretii ATCC
           43969]
 gi|238719188|gb|EEQ11000.1| hypothetical protein ymoll0001_33390 [Yersinia mollaretii ATCC
           43969]
          Length = 129

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 16/115 (13%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFE-------ATSVCEAREFCEKELLPNYLVIDESME 57
           L++D    +R++ R+L  D GF   +       A +   A EF       ++++ D +M 
Sbjct: 9   LVIDDFATMRRIVRNLLQDLGFKNVDEAEDGQDALAKLRASEF-------DFVISDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  L+ +  +R+      + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 62  NLDGLQLLTEIRKDEKLNKIPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|119775414|ref|YP_928154.1| response regulator receiver protein [Shewanella amazonensis SB2B]
 gi|119767914|gb|ABM00485.1| response regulator receiver protein [Shewanella amazonensis SB2B]
          Length = 127

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLKAIRADENLKHIPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|149912606|ref|ZP_01901140.1| sensor histidine kinase/response regulator hybrid [Roseobacter sp.
           AzwK-3b]
 gi|149813012|gb|EDM72838.1| sensor histidine kinase/response regulator hybrid [Roseobacter sp.
           AzwK-3b]
          Length = 130

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD   I R V R L     + V EA S  EA +  ++E   + +++D SM G+  L
Sbjct: 6   NILVVDDDEINRMVVRVLMERRNYRVVEAASGPEALDLVKEEAF-DVVLMDLSMPGMDGL 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E   H+R    G+ + V  L      ++      AG N+ L KPF+ E +
Sbjct: 65  ETTRHIRSDAAGSQLPVVALTAHTSHKEQQMCLEAGMNAVLRKPFDSEQV 114


>gi|90021808|ref|YP_527635.1| response regulator receiver domain-containing protein
           [Saccharophagus degradans 2-40]
 gi|89951408|gb|ABD81423.1| response regulator receiver [Saccharophagus degradans 2-40]
          Length = 128

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 61/118 (51%), Gaps = 18/118 (15%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGF-----TNTHEADDGSTA--LPMLKSGDFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  +E +  +R    LGT + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 60  PGMSGIELLKEIRADAKLGT-IPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|296531793|ref|ZP_06894610.1| chemotaxis response regulator CheY [Roseomonas cervicalis ATCC
           49957]
 gi|296267876|gb|EFH13686.1| chemotaxis response regulator CheY [Roseomonas cervicalis ATCC
           49957]
          Length = 140

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/115 (34%), Positives = 60/115 (52%), Gaps = 12/115 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNY-LVID----ESME 57
           +L+VD    +R++ R+L +  G+  V EA +  EA    EK  +  Y LVI     E M 
Sbjct: 23  ILVVDDYPTMRRIVRNLLDQIGYKDVEEAGNGAEA---LEKIKVSRYDLVISDWNMEPMT 79

Query: 58  GVLEFIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G LE +  VR    L    F+  +  E   E ++A  +AGA+ +++KPF  ETLR
Sbjct: 80  G-LELLKEVRGDANLAKTPFIM-VTAESKTENVVAAKQAGASQYIVKPFTAETLR 132


>gi|307152868|ref|YP_003888252.1| response regulator receiver protein [Cyanothece sp. PCC 7822]
 gi|306983096|gb|ADN14977.1| response regulator receiver protein [Cyanothece sp. PCC 7822]
          Length = 125

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 60/122 (49%), Gaps = 9/122 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M ++L+VD S  +R++   L    G  V EA S  EA+E  +KE +P+ ++ D     M 
Sbjct: 1   MITVLIVDDSPSLRQILIELLQKRGINVLEAASGMEAQEQIQKE-VPDLVITDLIMPQMN 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNR----ETLRFA 113
           G  E    ++  P   DV V     + +      G + GA++++ KPF      +T++F 
Sbjct: 60  G-YELCRWIKNNPSTQDVPVLICSTKSEEFDRYWGMKQGADAYITKPFQPAEMLQTIKFL 118

Query: 114 MR 115
           ++
Sbjct: 119 LQ 120


>gi|298374437|ref|ZP_06984395.1| two-component system sensor histidine kinase/response regulator,
           hybrid (one-component system) [Bacteroides sp. 3_1_19]
 gi|298268805|gb|EFI10460.1| two-component system sensor histidine kinase/response regulator,
           hybrid (one-component system) [Bacteroides sp. 3_1_19]
          Length = 573

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +L++D S  +R   RH+F    + V EA +  E  E    E  P++++ D  M  +  L 
Sbjct: 321 MLVIDDSDQIRWFLRHVFAS-EYHVSEAHNGQEGVEIARVER-PDFILCDVMMPVKDGLA 378

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               ++ +P    V V  L  +V+ E +IAG   GA+ ++ KPF+ E LR  +  L
Sbjct: 379 TCREIKGIPELAQVPVVLLTAKVESEDVIAGIECGADDYITKPFDVEVLRSKVNSL 434


>gi|54024684|ref|YP_118926.1| putative two-component system response regulator [Nocardia
           farcinica IFM 10152]
 gi|54016192|dbj|BAD57562.1| putative two-component system response regulator [Nocardia
           farcinica IFM 10152]
          Length = 239

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 50/103 (48%), Gaps = 1/103 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           +L++VD    +R+  R    D G+ V EA    +A  +      P+ +++ E M G ++ 
Sbjct: 7   NLMIVDDDDRIRRELREALEDEGYDVSEANEAEDALTYLRSNGAPDVMIV-ELMLGDMDG 65

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
              +R++    DV +  +    D   ++A   AGA+ F+ KPF
Sbjct: 66  FECIREIRRDHDVPIIVISSRDDTHDVVAALEAGADDFVTKPF 108


>gi|261213122|ref|ZP_05927406.1| chemotaxis regulator CheY [Vibrio sp. RC341]
 gi|260838187|gb|EEX64864.1| chemotaxis regulator CheY [Vibrio sp. RC341]
          Length = 119

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 51/112 (45%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L VD S  +R++  H   D G+ V  A+   +A    +K    + ++ D +M   G
Sbjct: 1   MARVLAVDDSISIRQMVSHTLQDAGYEVETASDGRDALVKAQKSRF-DVIISDVNMPVMG 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             EF+  VR         +  L  E   EK   G   GA  +L+KPFN ETL
Sbjct: 60  GFEFVKAVRLQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETL 111


>gi|127512315|ref|YP_001093512.1| response regulator receiver protein [Shewanella loihica PV-4]
 gi|126637610|gb|ABO23253.1| response regulator receiver protein [Shewanella loihica PV-4]
          Length = 127

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILVVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLKAIRADDNLKHIPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|262382621|ref|ZP_06075758.1| two-component system sensor histidine kinase/response regulator
           [Bacteroides sp. 2_1_33B]
 gi|262295499|gb|EEY83430.1| two-component system sensor histidine kinase/response regulator
           [Bacteroides sp. 2_1_33B]
          Length = 622

 Score = 45.1 bits (105), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +L++D S  +R   RH+F    + V EA +  E  E    E  P++++ D  M  +  L 
Sbjct: 370 MLVIDDSDQIRWFLRHVFAS-EYHVSEAHNGQEGVEIARVER-PDFILCDVMMPVKDGLA 427

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               ++ +P    V V  L  +V+ E +IAG   GA+ ++ KPF+ E LR  +  L
Sbjct: 428 TCREIKGIPELAQVPVVLLTAKVESEDVIAGIECGADDYITKPFDVEVLRSKVNSL 483


>gi|289678961|ref|ZP_06499851.1| response regulator receiver [Pseudomonas syringae pv. syringae FF5]
 gi|302185383|ref|ZP_07262056.1| response regulator receiver [Pseudomonas syringae pv. syringae 642]
          Length = 132

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 11  ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 63

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR+      + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 64  PGMSGIDLLREVRKDERLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 120


>gi|313902699|ref|ZP_07836097.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter subterraneus DSM 13965]
 gi|313466996|gb|EFR62512.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter subterraneus DSM 13965]
          Length = 235

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 59/122 (48%), Gaps = 6/122 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    +R + R      GF V EA    EA E    E  P+ +++D  + G+ +  
Sbjct: 3   ILVVDDEAPMRALLRLFLEQHGFAVSEAEDGYEALERVRTER-PDLVLLDIMLPGI-DGW 60

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL----RFAMRELPQ 119
           A  R +   +DV +  L    D    ++G  AGA+ +L+KPF  E L    R  +R  P+
Sbjct: 61  AVCRILRRESDVPLIMLTARDDVRDRVSGLEAGADDYLVKPFAEEELLARIRAVLRRTPR 120

Query: 120 MQ 121
           ++
Sbjct: 121 VE 122


>gi|150010077|ref|YP_001304820.1| two-component system sensor histidine kinase/response regulator
           [Parabacteroides distasonis ATCC 8503]
 gi|149938501|gb|ABR45198.1| two-component system sensor histidine kinase/response regulator,
           hybrid [Parabacteroides distasonis ATCC 8503]
          Length = 633

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +L++D S  +R   RH+F    + V EA +  E  E    E  P++++ D  M  +  L 
Sbjct: 381 MLVIDDSDQIRWFLRHVFAS-EYHVSEAHNGQEGVEIARVER-PDFILCDVMMPVKDGLA 438

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               ++ +P    V V  L  +V+ E +IAG   GA+ ++ KPF+ E LR  +  L
Sbjct: 439 TCREIKGIPELAQVPVVLLTAKVESEDVIAGIECGADDYITKPFDVEVLRSKVNSL 494


>gi|71282029|ref|YP_268262.1| chemotaxis protein CheY [Colwellia psychrerythraea 34H]
 gi|71147769|gb|AAZ28242.1| chemotaxis protein CheY [Colwellia psychrerythraea 34H]
          Length = 127

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 16/124 (12%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T++ EA +      LP       +++V D +
Sbjct: 6   KVLVVDDFSTMRRIVKNLLRDLGF-----TNIQEADD--GNTALPMLQGGDFDFVVTDWN 58

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFA 113
           M G+  ++ +  +R     + + V  +  E   E++I  A+AG N +++KPF   TL+  
Sbjct: 59  MPGMQGIDLLKAIRADANLSHIPVLLITAEAKKEQIIMAAQAGVNGYIVKPFTAATLKTK 118

Query: 114 MREL 117
           + ++
Sbjct: 119 LDKI 122


>gi|88704184|ref|ZP_01101898.1| two-component response regulator [Congregibacter litoralis KT71]
 gi|88701235|gb|EAQ98340.1| two-component response regulator [Congregibacter litoralis KT71]
          Length = 176

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 48/106 (45%), Gaps = 3/106 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+ D    VR + R      G +V EA    EA E   +E  P+ + +D  M G+  L
Sbjct: 13  TILVADDDMNVRLLSRQCLESEGMIVIEAADGHEALEAFVRER-PDLVFLDVEMPGMTGL 71

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           E    +R MP G  V +  +    D + +  G  AGA  +  KP N
Sbjct: 72  EVCQRIRAMPQGESVPIMIVTGSDDRQSIDDGFEAGATQYKTKPVN 117


>gi|289548281|ref|YP_003473269.1| response regulator receiver protein [Thermocrinis albus DSM 14484]
 gi|289181898|gb|ADC89142.1| response regulator receiver protein [Thermocrinis albus DSM 14484]
          Length = 129

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/114 (30%), Positives = 59/114 (51%), Gaps = 12/114 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA---REFCEKELLPNY--LVIDESMEGV 59
           L+VD    +RK+ + L N  G+     T+V EA   R+   K    +Y  +++D +M  +
Sbjct: 9   LVVDDMSTMRKIVKTLLNQLGY-----TNVDEAENGRDALAKLRSSSYDLVLLDWNMPEM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             LE +  +R       + V  +  E   E ++A  +AGAN++++KPF  ETLR
Sbjct: 64  DGLELLKAIRADDSLRHIPVIMITAEAKKENVLAAIQAGANNYIVKPFTLETLR 117


>gi|256838887|ref|ZP_05544397.1| two-component system sensor histidine kinase/response regulator
           [Parabacteroides sp. D13]
 gi|256739806|gb|EEU53130.1| two-component system sensor histidine kinase/response regulator
           [Parabacteroides sp. D13]
          Length = 622

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +L++D S  +R   RH+F    + V EA +  E  E    E  P++++ D  M  +  L 
Sbjct: 370 MLVIDDSDQIRWFLRHVFAS-EYHVSEAHNGQEGVEIARVER-PDFILCDVMMPVKDGLA 427

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               ++ +P    V V  L  +V+ E +IAG   GA+ ++ KPF+ E LR  +  L
Sbjct: 428 TCREIKGIPELAQVPVVLLTAKVESEDVIAGIECGADDYITKPFDVEVLRSKVNSL 483


>gi|66046665|ref|YP_236506.1| response regulator receiver [Pseudomonas syringae pv. syringae
           B728a]
 gi|63257372|gb|AAY38468.1| Response regulator receiver [Pseudomonas syringae pv. syringae
           B728a]
 gi|330899449|gb|EGH30868.1| response regulator receiver [Pseudomonas syringae pv. japonica str.
           M301072PT]
 gi|330940685|gb|EGH43698.1| response regulator receiver [Pseudomonas syringae pv. pisi str.
           1704B]
 gi|330953769|gb|EGH54029.1| response regulator receiver [Pseudomonas syringae Cit 7]
 gi|330972457|gb|EGH72523.1| response regulator receiver [Pseudomonas syringae pv. aceris str.
           M302273PT]
 gi|330976016|gb|EGH76082.1| response regulator receiver [Pseudomonas syringae pv. aptata str.
           DSM 50252]
          Length = 128

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR+      + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 60  PGMSGIDLLREVRKDERLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|283853372|ref|ZP_06370619.1| response regulator receiver modulated serine phosphatase
           [Desulfovibrio sp. FW1012B]
 gi|283571240|gb|EFC19253.1| response regulator receiver modulated serine phosphatase
           [Desulfovibrio sp. FW1012B]
          Length = 383

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 50/107 (46%), Gaps = 3/107 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L++D   I  +    +  + GF+   A S  + RE   +E  P+ +++D  M G   F 
Sbjct: 18  ILIIDDETINVETLAWMLKEAGFVPLRAASGQKGREIAAREQ-PDLVILDIMMPGESGFD 76

Query: 64  AHVRQM--PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRE 108
              R    P  TD+ + ++    D E  + G R GA  ++ KPF RE
Sbjct: 77  TCTRLTADPATTDIPIIFISGLDDVENKVKGLRIGAVDYVTKPFARE 123


>gi|254823447|ref|ZP_05228448.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium intracellulare ATCC 13950]
          Length = 228

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/127 (31%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA E    +  P+ LV+D  M  +  LE
Sbjct: 3   ILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALELIASDR-PDALVLDVMMPRLDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 62  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 119

Query: 122 KSKDENQ 128
           K +DE +
Sbjct: 120 KPEDEAE 126


>gi|163785262|ref|ZP_02179926.1| response regulator receiver domain protein (CheY-like)
           [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879469|gb|EDP73309.1| response regulator receiver domain protein (CheY-like)
           [Hydrogenivirga sp. 128-5-R1-1]
          Length = 131

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 58/110 (52%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ + L +  G+  + EA    +A    + +   ++++ D +M  +  LE
Sbjct: 11  LVVDDMATMRRIIKTLLDQLGYKNIDEAEDGKDALNKLKAQKY-DFVITDWNMPNMTGLE 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +  +R+ P    + V  +  E   E +IA  +AG N++++KPF  ETL+
Sbjct: 70  LVQEIRKEPDLKHLPVLMVTAEAKKENVIAAIKAGVNNYVVKPFTAETLK 119


>gi|147671709|ref|YP_001214988.1| chemotaxis protein CheY [Vibrio cholerae O395]
 gi|153816752|ref|ZP_01969419.1| chemotaxis protein CheY [Vibrio cholerae NCTC 8457]
 gi|153821179|ref|ZP_01973846.1| chemotaxis protein CheY [Vibrio cholerae B33]
 gi|229506834|ref|ZP_04396343.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae BX
           330286]
 gi|229510372|ref|ZP_04399852.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae B33]
 gi|229514501|ref|ZP_04403962.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae TMA
           21]
 gi|229517497|ref|ZP_04406942.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae RC9]
 gi|229528021|ref|ZP_04417412.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           12129(1)]
 gi|229605307|ref|YP_002876011.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           MJ-1236]
 gi|255746179|ref|ZP_05420126.1| chemotaxis regulator CheY [Vibrio cholera CIRS 101]
 gi|262158668|ref|ZP_06029782.1| chemotaxis regulator CheY [Vibrio cholerae INDRE 91/1]
 gi|262168922|ref|ZP_06036616.1| chemotaxis regulator CheY [Vibrio cholerae RC27]
 gi|262192316|ref|ZP_06050471.1| chemotaxis regulator CheY [Vibrio cholerae CT 5369-93]
 gi|126512771|gb|EAZ75365.1| chemotaxis protein CheY [Vibrio cholerae NCTC 8457]
 gi|126521238|gb|EAZ78461.1| chemotaxis protein CheY [Vibrio cholerae B33]
 gi|146314092|gb|ABQ18632.1| chemotaxis protein CheY [Vibrio cholerae O395]
 gi|229334383|gb|EEN99868.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           12129(1)]
 gi|229345533|gb|EEO10506.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae RC9]
 gi|229348481|gb|EEO13439.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae TMA
           21]
 gi|229352817|gb|EEO17757.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae B33]
 gi|229357185|gb|EEO22103.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae BX
           330286]
 gi|229371793|gb|ACQ62215.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           MJ-1236]
 gi|255735933|gb|EET91331.1| chemotaxis regulator CheY [Vibrio cholera CIRS 101]
 gi|262022621|gb|EEY41328.1| chemotaxis regulator CheY [Vibrio cholerae RC27]
 gi|262029548|gb|EEY48198.1| chemotaxis regulator CheY [Vibrio cholerae INDRE 91/1]
 gi|262031809|gb|EEY50392.1| chemotaxis regulator CheY [Vibrio cholerae CT 5369-93]
 gi|327486053|gb|AEA80459.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           LMA3894-4]
          Length = 119

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 48/115 (41%), Gaps = 9/115 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES----- 55
           M  +L VD S  +R++  H   D G+   E  +  + RE   K     + VI        
Sbjct: 1   MAKVLAVDDSISIRQMVSHTLQDAGY---EVETAADGREALAKAQKARFDVIISDVNMPV 57

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           M G  EF+  VR         +  L  E   EK   G   GA  +L+KPFN ETL
Sbjct: 58  MTG-FEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETL 111


>gi|332983474|ref|YP_004464915.1| AraC family two component transcriptional regulator [Mahella
           australiensis 50-1 BON]
 gi|332701152|gb|AEE98093.1| two component transcriptional regulator, AraC family [Mahella
           australiensis 50-1 BON]
          Length = 234

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 8/121 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGF---MVFEATSVCEAREFCEKELLPNYLVIDESME 57
           M ++L+ D   +VR   R+   +      +V EA +  EA EF  + LLP+ +++D  M 
Sbjct: 1   MLTILIADDEPLVRSSIRYTLQEISIKTSVVGEAENGEEALEFYRR-LLPDVIIVDIKMP 59

Query: 58  --GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
               LEFI  VR++   T   V     E  FE      R+G NS++LKP     L  A++
Sbjct: 60  LMSGLEFIEEVRKIDHVTQFIVVSGYAE--FEYARQAMRSGVNSYVLKPVKSSELEEALK 117

Query: 116 E 116
           +
Sbjct: 118 K 118


>gi|332669229|ref|YP_004452237.1| response regulator receiver protein [Cellulomonas fimi ATCC 484]
 gi|332338267|gb|AEE44850.1| response regulator receiver protein [Cellulomonas fimi ATCC 484]
          Length = 127

 Score = 45.1 bits (105), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 28/110 (25%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGVLE 61
           L+VD S  +R++  ++    GF    A    +A +   ++   + + +D +M   +G LE
Sbjct: 4   LVVDDSRTMRRIVSNVLEGLGFETTHAEHGQQALDVLAQDGAVDLVTVDWNMPVMDG-LE 62

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            + HVR+      V +  +  E +  +++    AGA+ +L+KPF  E +R
Sbjct: 63  LVTHVRKNRDWRSVTLMMVTTEAEQSQIVRALAAGAHEYLIKPFTAEEIR 112


>gi|229526361|ref|ZP_04415765.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae bv.
           albensis VL426]
 gi|229336519|gb|EEO01537.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae bv.
           albensis VL426]
          Length = 119

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 48/115 (41%), Gaps = 9/115 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES----- 55
           M  +L VD S  +R++  H   D G+   E  +  + RE   K     + VI        
Sbjct: 1   MAKVLAVDDSISIRQMVSHTLKDAGY---EVETAADGREALAKAQKARFDVIISDVNMPV 57

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           M G  EF+  VR         +  L  E   EK   G   GA  +L+KPFN ETL
Sbjct: 58  MTG-FEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETL 111


>gi|22298806|ref|NP_682053.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22294987|dbj|BAC08815.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 226

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 61/129 (47%), Gaps = 6/129 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           LLLVD    VR+       D GF V    +   A E+ E  + P+ ++ D     M+G  
Sbjct: 5   LLLVDDEPGVREAVSAYLEDSGFEVTAVANAQAALEYLETHV-PDVIITDIMMPQMDG-Y 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F+  VRQ P  + + V +L         I G  AG +++L KPF+ + L   ++ L + 
Sbjct: 63  AFLETVRQQPHLSHIPVIFLTARGMTRDRIQGYDAGCDAYLAKPFDPDELVAIIKNLLRR 122

Query: 121 Q-KSKDENQ 128
           Q  ++DE +
Sbjct: 123 QAAARDEAE 131


>gi|217972634|ref|YP_002357385.1| response regulator receiver protein [Shewanella baltica OS223]
 gi|304409941|ref|ZP_07391560.1| response regulator receiver protein [Shewanella baltica OS183]
 gi|307302346|ref|ZP_07582104.1| response regulator receiver protein [Shewanella baltica BA175]
 gi|217497769|gb|ACK45962.1| response regulator receiver protein [Shewanella baltica OS223]
 gi|304351350|gb|EFM15749.1| response regulator receiver protein [Shewanella baltica OS183]
 gi|306914384|gb|EFN44805.1| response regulator receiver protein [Shewanella baltica BA175]
 gi|315268355|gb|ADT95208.1| response regulator receiver protein [Shewanella baltica OS678]
          Length = 123

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 61  IDLLKAIRADDSLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 112


>gi|149916058|ref|ZP_01904581.1| sensor histidine kinase/response regulator [Roseobacter sp.
           AzwK-3b]
 gi|149810132|gb|EDM69980.1| sensor histidine kinase/response regulator [Roseobacter sp.
           AzwK-3b]
          Length = 130

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD   I R V R L     + V EA S  EA +  + E   + +++D SM G+  L
Sbjct: 6   NILVVDDDEINRMVVRVLMERRNYRVVEAASGPEALDLVKDEAF-DVVLMDLSMPGMDGL 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E   H+R    G+ + V  L      ++      AG N+ L KPF+ E +
Sbjct: 65  ETTRHIRSDAAGSQLPVVALTAHTSHKEQQMCLEAGMNAVLRKPFDSEQV 114


>gi|301308109|ref|ZP_07214063.1| two-component system sensor histidine kinase/response regulator,
           hybrid (one-component system) [Bacteroides sp. 20_3]
 gi|300833579|gb|EFK64195.1| two-component system sensor histidine kinase/response regulator,
           hybrid (one-component system) [Bacteroides sp. 20_3]
          Length = 633

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +L++D S  +R   RH+F    + V EA +  E  E    E  P++++ D  M  +  L 
Sbjct: 381 MLVIDDSDQIRWFLRHVFAS-EYHVSEAHNGQEGVEIARVER-PDFILCDVMMPVKDGLA 438

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               ++ +P    V V  L  +V+ E +IAG   GA+ ++ KPF+ E LR  +  L
Sbjct: 439 TCREIKGIPELAQVPVVLLTAKVESEDVIAGIECGADDYITKPFDVEVLRSKVNSL 494


>gi|152997303|ref|YP_001342138.1| response regulator receiver protein [Marinomonas sp. MWYL1]
 gi|150838227|gb|ABR72203.1| response regulator receiver protein [Marinomonas sp. MWYL1]
          Length = 121

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD S  VR++        G+ V  A+    A   C+ E+  ++++ D++M  +  + 
Sbjct: 5   LLIVDDSPSVRQMVEMTLKGAGYAVKTASDGQAALNLCKTEMF-DFVLTDQNMPNMDGIT 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            I  +R MP    V +  L  E        G  AGA  +++KPF+ + L
Sbjct: 64  LIKSLRAMPSYARVPLIVLTTEAGETMKQKGKAAGATGWMVKPFDPKKL 112


>gi|312882105|ref|ZP_07741855.1| hypothetical protein VIBC2010_13894 [Vibrio caribbenthicus ATCC
           BAA-2122]
 gi|309370241|gb|EFP97743.1| hypothetical protein VIBC2010_13894 [Vibrio caribbenthicus ATCC
           BAA-2122]
          Length = 122

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K     ++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-EFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLKHIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|255012649|ref|ZP_05284775.1| two-component system sensor histidine kinase/response regulator,
           hybrid [Bacteroides sp. 2_1_7]
          Length = 645

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 58/116 (50%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +L++D S  +R   RH+F    + V EA +  E  E    E  P++++ D  M  +  L 
Sbjct: 393 MLVIDDSDQIRWFLRHVFAS-EYHVSEAHNGQEGVEIARVER-PDFILCDVMMPVKDGLA 450

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               ++ +P    V V  L  +V+ E +IAG   GA+ ++ KPF+ E LR  +  L
Sbjct: 451 TCREIKGIPELAQVPVVLLTAKVESEDVIAGIECGADDYITKPFDVEVLRSKVNSL 506


>gi|239908185|ref|YP_002954926.1| response regulator receiver protein [Desulfovibrio magneticus RS-1]
 gi|239798051|dbj|BAH77040.1| response regulator receiver protein [Desulfovibrio magneticus RS-1]
          Length = 376

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 57/125 (45%), Gaps = 4/125 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L +D   I  +V   L  + G       S  EA+   +  +  + +++D  M     F 
Sbjct: 23  ILAIDDERINLRVIGGLLRNLGHEPILTESFAEAQPLLDASI--DLVLLDVMMPETDGFT 80

Query: 64  A--HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
              H+R+MP  +DV +  +      +  +    AGAN F+ KP +   LR  M  L +M+
Sbjct: 81  VARHIREMPGVSDVPIIMVTALTSKQDRLKAVEAGANDFISKPIDLTELRVRMGSLLKMK 140

Query: 122 KSKDE 126
           +S+DE
Sbjct: 141 ESQDE 145


>gi|24374721|ref|NP_718764.1| chemotaxis protein CheY [Shewanella oneidensis MR-1]
 gi|113969643|ref|YP_733436.1| response regulator receiver protein [Shewanella sp. MR-4]
 gi|114046873|ref|YP_737423.1| response regulator receiver protein [Shewanella sp. MR-7]
 gi|117919808|ref|YP_869000.1| response regulator receiver protein [Shewanella sp. ANA-3]
 gi|126175110|ref|YP_001051259.1| response regulator receiver protein [Shewanella baltica OS155]
 gi|153001434|ref|YP_001367115.1| response regulator receiver protein [Shewanella baltica OS185]
 gi|160876159|ref|YP_001555475.1| response regulator receiver protein [Shewanella baltica OS195]
 gi|24349379|gb|AAN56208.1|AE015758_12 chemotaxis protein CheY [Shewanella oneidensis MR-1]
 gi|113884327|gb|ABI38379.1| response regulator receiver protein [Shewanella sp. MR-4]
 gi|113888315|gb|ABI42366.1| response regulator receiver protein [Shewanella sp. MR-7]
 gi|117612140|gb|ABK47594.1| response regulator receiver protein [Shewanella sp. ANA-3]
 gi|125998315|gb|ABN62390.1| response regulator receiver protein [Shewanella baltica OS155]
 gi|151366052|gb|ABS09052.1| response regulator receiver protein [Shewanella baltica OS185]
 gi|160861681|gb|ABX50215.1| response regulator receiver protein [Shewanella baltica OS195]
          Length = 127

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLKAIRADDSLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|307718084|ref|YP_003873616.1| response regulator receiver protein [Spirochaeta thermophila DSM
           6192]
 gi|306531809|gb|ADN01343.1| response regulator receiver protein [Spirochaeta thermophila DSM
           6192]
 gi|315185921|gb|EFU19686.1| response regulator receiver protein [Spirochaeta thermophila DSM
           6578]
          Length = 119

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/124 (29%), Positives = 60/124 (48%), Gaps = 15/124 (12%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG---- 58
           ++L+VD + + RK+ R +    G+ V EA    EA    E +  P+ L++D  M G    
Sbjct: 4   TVLVVDDALLARKIARKILEKEGYQVEEAEGGQEAISMLEAQ-RPDVLLLDLLMPGMDGI 62

Query: 59  -VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAG--ARAGANSFLLKPFNRETLRFAMR 115
            VLE +A  R       V V  +++  D ++       + GA  FL KP   E L+ A++
Sbjct: 63  QVLEELAKRR-------VSVPTIVVSADTQESTKQRCIQLGAKVFLNKPLTEEELKKALQ 115

Query: 116 ELPQ 119
           E+ Q
Sbjct: 116 EVSQ 119


>gi|323483254|ref|ZP_08088644.1| nitrogen regulation protein NtrX [Clostridium symbiosum WAL-14163]
 gi|323403352|gb|EGA95660.1| nitrogen regulation protein NtrX [Clostridium symbiosum WAL-14163]
          Length = 457

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 63/134 (47%), Gaps = 5/134 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD   ++R        D G+    A ++ EA E C K+  PN +++D  +E   
Sbjct: 1   MKKILVVDDEFLIRYTLEEGLKDRGYDAKSAGTIEEAVE-CVKKFHPNVVILDNLLEHSV 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++ IA  + M    D+ V  +       + +   + GA  ++LKPF+ + + F ++   
Sbjct: 60  GMDEIATFKNMD--EDIQVILMTAYGSVSQAVEAIKRGAYDYVLKPFDVDEIDFIIKRCL 117

Query: 119 QMQKSKDENQFLDA 132
           +  K +D  +FL  
Sbjct: 118 EQMKRRDSLEFLKG 131


>gi|262173236|ref|ZP_06040913.1| chemotaxis regulator CheY [Vibrio mimicus MB-451]
 gi|261890594|gb|EEY36581.1| chemotaxis regulator CheY [Vibrio mimicus MB-451]
          Length = 119

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 50/112 (44%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L VD S  +R++  H   D G+ V  AT   +A    +K    + ++ D +M    
Sbjct: 1   MARVLAVDDSISIRQMVSHTLQDAGYEVETATDGRDALTKAQKSRF-DVIISDVNMPVMS 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             EF+  VR         +  L  E   EK   G   GA  +L+KPFN ETL
Sbjct: 60  GFEFVKAVRLQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETL 111


>gi|321261033|ref|XP_003195236.1| histidine kinase [Cryptococcus gattii WM276]
 gi|317461709|gb|ADV23449.1| Histidine kinase, putative [Cryptococcus gattii WM276]
          Length = 1792

 Score = 44.7 bits (104), Expect = 0.004,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 62/133 (46%), Gaps = 6/133 (4%)

Query: 2    DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            D ++LV+ S   R+  + +F+ +   V EA    EA E C+K + P+ ++ D  M  +  
Sbjct: 1070 DVIMLVEDSADTRRYMKSIFSQY-CQVVEARDGQEALELCQKRM-PDLIISDVMMPRLNG 1127

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             E +A +++      V V  L      E  ++G  AGA  +L KPFN   +    R   Q
Sbjct: 1128 FELLAALKKSKDLNMVPVIMLTARGADESKVSGIMAGAEDYLAKPFNAREI--VARAHMQ 1185

Query: 120  MQKSKDENQFLDA 132
            +Q  K    F +A
Sbjct: 1186 LQLGKKRRHFEEA 1198


>gi|15601845|ref|NP_233476.1| chemotaxis protein CheY [Vibrio cholerae O1 biovar eltor str.
           N16961]
 gi|121585901|ref|ZP_01675694.1| chemotaxis protein CheY [Vibrio cholerae 2740-80]
 gi|121728512|ref|ZP_01681536.1| chemotaxis protein CheY [Vibrio cholerae V52]
 gi|153215675|ref|ZP_01950071.1| chemotaxis protein CheY [Vibrio cholerae 1587]
 gi|153801274|ref|ZP_01955860.1| chemotaxis protein CheY [Vibrio cholerae MZO-3]
 gi|153827833|ref|ZP_01980500.1| chemotaxis protein CheY [Vibrio cholerae 623-39]
 gi|227812659|ref|YP_002812669.1| chemotaxis protein CheY [Vibrio cholerae M66-2]
 gi|254284716|ref|ZP_04959683.1| chemotaxis protein CheY [Vibrio cholerae AM-19226]
 gi|254850253|ref|ZP_05239603.1| chemotaxis protein CheY [Vibrio cholerae MO10]
 gi|297579867|ref|ZP_06941794.1| chemotaxis protein CheY [Vibrio cholerae RC385]
 gi|298499856|ref|ZP_07009662.1| chemotaxis protein CheY [Vibrio cholerae MAK 757]
 gi|9658542|gb|AAF96988.1| chemotaxis protein CheY [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|50872121|dbj|BAD34539.1| cheY homolog [Vibrio cholerae]
 gi|121549837|gb|EAX59857.1| chemotaxis protein CheY [Vibrio cholerae 2740-80]
 gi|121629230|gb|EAX61668.1| chemotaxis protein CheY [Vibrio cholerae V52]
 gi|124114658|gb|EAY33478.1| chemotaxis protein CheY [Vibrio cholerae 1587]
 gi|124123189|gb|EAY41932.1| chemotaxis protein CheY [Vibrio cholerae MZO-3]
 gi|148876678|gb|EDL74813.1| chemotaxis protein CheY [Vibrio cholerae 623-39]
 gi|150425501|gb|EDN17277.1| chemotaxis protein CheY [Vibrio cholerae AM-19226]
 gi|227011801|gb|ACP08012.1| chemotaxis protein CheY [Vibrio cholerae M66-2]
 gi|227015738|gb|ACP11947.1| chemotaxis protein CheY [Vibrio cholerae O395]
 gi|254845958|gb|EET24372.1| chemotaxis protein CheY [Vibrio cholerae MO10]
 gi|297535513|gb|EFH74347.1| chemotaxis protein CheY [Vibrio cholerae RC385]
 gi|297541837|gb|EFH77888.1| chemotaxis protein CheY [Vibrio cholerae MAK 757]
          Length = 125

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 48/115 (41%), Gaps = 9/115 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES----- 55
           M  +L VD S  +R++  H   D G+   E  +  + RE   K     + VI        
Sbjct: 7   MAKVLAVDDSISIRQMVSHTLQDAGY---EVETAADGREALAKAQKARFDVIISDVNMPV 63

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           M G  EF+  VR         +  L  E   EK   G   GA  +L+KPFN ETL
Sbjct: 64  MTG-FEFVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETL 117


>gi|57168004|ref|ZP_00367143.1| chemotaxis regulatory protein Cj1118c [Campylobacter coli RM2228]
 gi|305431845|ref|ZP_07401012.1| chemotaxis response regulator CheY [Campylobacter coli JV20]
 gi|57020378|gb|EAL57047.1| chemotaxis regulatory protein Cj1118c [Campylobacter coli RM2228]
 gi|304444929|gb|EFM37575.1| chemotaxis response regulator CheY [Campylobacter coli JV20]
          Length = 130

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G   V EA    EA +  EK      L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLTRLGHNDVLEAEHGVEAWDLLEKNEDIKILITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           LE +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+  + ++
Sbjct: 62  LELVKKVRAEKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEDV 119


>gi|148253072|ref|YP_001237657.1| putative chemotaxis protein CheY [Bradyrhizobium sp. BTAi1]
 gi|146405245|gb|ABQ33751.1| Putative Chemotaxis protein cheY [Bradyrhizobium sp. BTAi1]
          Length = 121

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 53/108 (49%), Gaps = 3/108 (2%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           ++VD S + RK+ R +  +  F + EA    +A E   K  LP+ +++D   +     E 
Sbjct: 1   MVVDDSSVGRKIARRILEELEFRIIEAKDGEKAVE-ARKSDLPDVVLLDWDTQVTDGCEL 59

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             ++ ++  G    V     E + + +     AG++ +++KPFNR+ +
Sbjct: 60  FGNLLRLSGGDQPIVVICTTESNIDHISDALHAGSDEYVVKPFNRDAV 107


>gi|239906955|ref|YP_002953696.1| response regulator receiver protein [Desulfovibrio magneticus RS-1]
 gi|239796821|dbj|BAH75810.1| response regulator receiver protein [Desulfovibrio magneticus RS-1]
          Length = 616

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 56/119 (47%), Gaps = 5/119 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEG 58
           + +L+VD S ++R++ RH F   G  V  A +  +A E    E  P+ +V D     M+G
Sbjct: 290 NKILVVDDSKLIREMLRHNFVKNGHCVLTAENGAKALELALAE-QPDVVVTDIEMPEMDG 348

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             E   H+R+ P   +  V  +        +  G R G + + +KPF+ E +   + +L
Sbjct: 349 -YELCEHIRKQPELRNTLVVIMSARGHASDIKRGERLGVSRYFVKPFDVEKMHLVVEQL 406


>gi|254506880|ref|ZP_05119019.1| chemotaxis protein CheY [Vibrio parahaemolyticus 16]
 gi|219550165|gb|EED27151.1| chemotaxis protein CheY [Vibrio parahaemolyticus 16]
          Length = 139

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K     ++V D +M G+  
Sbjct: 19  KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-EFVVTDWNMPGMQG 77

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + H+R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 78  IDLLKHIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 129


>gi|315634749|ref|ZP_07890032.1| aerobic respiration control protein ArcA [Aggregatibacter segnis
           ATCC 33393]
 gi|315476507|gb|EFU67256.1| aerobic respiration control protein ArcA [Aggregatibacter segnis
           ATCC 33393]
          Length = 239

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 59/126 (46%), Gaps = 4/126 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+   I R   + +F   G+ VFEA    +     E E + N +++D ++ G    
Sbjct: 10  QILIVEDETITRNTLKSIFEAEGYDVFEAADGSQMHRILETEDI-NLVIMDINLPGKNGL 68

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
           +   R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L  +Q+
Sbjct: 69  ML-ARELRENADIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL--LQR 125

Query: 123 SKDENQ 128
           +  ENQ
Sbjct: 126 TMQENQ 131


>gi|256830415|ref|YP_003159143.1| response regulator receiver protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256579591|gb|ACU90727.1| response regulator receiver protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 120

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 6/117 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-DESMEGV--L 60
           ++ VD S  +R++      D G+ V EA   C+ R+   K   P  L++ D +M G+  +
Sbjct: 5   IMTVDDSASIRQMVSLTLKDAGYAVIEA---CDGRDALSKLSGPVSLILTDLNMPGMNGI 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E I  VR  P      +  L  E        G  AGA  +++KPF  + L    ++L
Sbjct: 62  ELIRAVRATPQYKFTPIVMLTTESQASSKEEGKAAGATGWIVKPFKPDQLLAVAKKL 118


>gi|149908439|ref|ZP_01897102.1| chemotaxis protein CheY [Moritella sp. PE36]
 gi|149808602|gb|EDM68537.1| chemotaxis protein CheY [Moritella sp. PE36]
          Length = 127

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF   FEA     A     K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFSNTFEADDGNTALPML-KNGDYDFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R+      + V  +  E   E++I  A++G N +++KPF   TL+
Sbjct: 65  IDLLKEIRKDQALCHIPVLMVTAEAKREQIIEAAQSGVNGYIIKPFTAATLK 116


>gi|260904234|ref|ZP_05912556.1| putative two-component system response regulator [Brevibacterium
           linens BL2]
          Length = 281

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 63/124 (50%), Gaps = 4/124 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           LLLV+    V +V R+   + GF+V E     +A E    EL+P+ +++D  + G+ +  
Sbjct: 56  LLLVEDDPTVAEVARNYLRNAGFLVDEVADGFQALESV-AELVPDLVILDRKLPGI-DGT 113

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
              R++   T V V  L      E  I G  +GA+ +L KPF+   L   ++ +  ++++
Sbjct: 114 EVCRRLRSFTAVPVLMLTALSATEDRIDGLESGADDYLTKPFSPRELVLRVQSI--LKRT 171

Query: 124 KDEN 127
            DE+
Sbjct: 172 VDES 175


>gi|254785465|ref|YP_003072894.1| response regulator receiver domain-containing protein
           [Teredinibacter turnerae T7901]
 gi|237685667|gb|ACR12931.1| response regulator receiver domain protein [Teredinibacter turnerae
           T7901]
          Length = 120

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 52/113 (46%), Gaps = 4/113 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M  +L VD S  +R++        G  V EA+   EA    + E   + ++ D    +M+
Sbjct: 1   MAKILAVDDSASMRQMVSFTLKGAGHQVCEASDGVEALSLAKAESGVDLVISDINMPNMD 60

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           G+   I  +RQ+P      +  L  E   +K   G  AGA  +++KPFN + L
Sbjct: 61  GI-SLIKELRQLPEYKFTPILMLTTESGVDKKSEGKAAGATGWIVKPFNPDQL 112


>gi|116749733|ref|YP_846420.1| response regulator receiver protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698797|gb|ABK17985.1| response regulator receiver protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 227

 Score = 44.7 bits (104), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 4/128 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE--FCEKELLPNYLVIDESMEGVLE 61
           L++ D S  ++ +G  L  D G+ +  ATS  +A +  F +   L    V+   M+G  E
Sbjct: 12  LIVDDISKNIQVLGNILRRD-GYSLSFATSGTQALDMVFADDYDLILLDVMMPEMDG-FE 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R++P G  + + +L  + D E ++ G +AG   ++ KPFN E L   +    +++
Sbjct: 70  VCRKIRELPDGQAIPIIFLTAKTDEEDIVKGFQAGGTDYVTKPFNSEELLARVHAHLELK 129

Query: 122 KSKDENQF 129
           +++DE Q 
Sbjct: 130 RARDEIQL 137


>gi|224371741|ref|YP_002605905.1| response regulator [Desulfobacterium autotrophicum HRM2]
 gi|223694458|gb|ACN17741.1| response regulator [Desulfobacterium autotrophicum HRM2]
          Length = 450

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/132 (27%), Positives = 59/132 (44%), Gaps = 5/132 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD   IVR+   H F   G+    A S   A    EK+   + L +D  M G+  L
Sbjct: 6   SVLIVDDELIVRESLFHWFKKEGYTADTAPSGEAALGMLEKQSF-DVLFVDMKMPGMDGL 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E +   R+    + V +      +D    +   + GA  +LLKPF  + L   M ++   
Sbjct: 65  ELVRQTRERYPDSSVVIITAYGSID--TAVTAMKKGAADYLLKPFKPDQLALVMEKILHQ 122

Query: 121 QKSKDENQFLDA 132
           ++  +E +FL  
Sbjct: 123 KRMDNECRFLKG 134


>gi|146329477|ref|YP_001209765.1| two-component response regulator [Dichelobacter nodosus VCS1703A]
 gi|146232947|gb|ABQ13925.1| two-component response regulator [Dichelobacter nodosus VCS1703A]
          Length = 122

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 39/117 (33%), Positives = 57/117 (48%), Gaps = 6/117 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           L++VD S I+R     L ND  F +V +A +  EA   C K L P+ + +D +M  +  L
Sbjct: 4   LMIVDDSMIIRNKIARLPNDAPFKIVGKAKNGAEAISLC-KSLHPDVVTMDLTMPEMDGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E I  + ++     + V   L   D    I     GAN FL KPF+ E L  A+ E+
Sbjct: 63  ECIKSLIEINPKIQILVVSAL--SDKATGIKALELGANGFLTKPFSDEQLVDALTEM 117


>gi|313672897|ref|YP_004051008.1| response regulator receiver protein [Calditerrivibrio nitroreducens
           DSM 19672]
 gi|312939653|gb|ADR18845.1| response regulator receiver protein [Calditerrivibrio nitroreducens
           DSM 19672]
          Length = 125

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 57/111 (51%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++ VD S  +R++ ++     GF  + EA +  E  +   K  + + ++ D +M  +  L
Sbjct: 7   IITVDDSSTMRRIIKNTLQKLGFSNILEAGNGIEGLDVLAKNKV-DLVITDWNMPEMDGL 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            F+  +R  P   ++ +  +  E   E ++   R+G N++++KPF  ETL+
Sbjct: 66  TFVKAIRAKPEYKELPILMVTTEAAKEDILTALRSGVNNYIVKPFTPETLQ 116


>gi|317474377|ref|ZP_07933651.1| hsp90-like protein [Bacteroides eggerthii 1_2_48FAA]
 gi|316909058|gb|EFV30738.1| hsp90-like protein [Bacteroides eggerthii 1_2_48FAA]
          Length = 1306

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 61/126 (48%), Gaps = 6/126 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
            LL+ D+  I++ +   L   F   +  AT   EA +  + E LP  ++ D  M G+  L 
Sbjct: 1057 LLVEDNEQILKYLTDKLTEYFN--IVTATHGEEALKLVD-EYLPEIVISDIMMPGMDGLT 1113

Query: 62   FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL-RFAMRELPQM 120
               H+++  L  D+FV  L  +   E  + G + GA+ ++ KPF+ E L    M  L   
Sbjct: 1114 LCRHIKENSLYADIFVILLTAKTSSEDELRGYKEGADIYIKKPFDTEALINQIMNILNTR 1173

Query: 121  QKSKDE 126
            QK K++
Sbjct: 1174 QKRKEQ 1179


>gi|224535197|ref|ZP_03675736.1| hypothetical protein BACCELL_00058 [Bacteroides cellulosilyticus DSM
            14838]
 gi|224523188|gb|EEF92293.1| hypothetical protein BACCELL_00058 [Bacteroides cellulosilyticus DSM
            14838]
          Length = 1310

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 37/126 (29%), Positives = 60/126 (47%), Gaps = 6/126 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
            LL+ D+  I++ +   L   F   +  AT   EA +    E LP  ++ D  M G+  L 
Sbjct: 1061 LLVEDNEQILKYLAGKLAEHFN--IVTATHGEEALKLV-GEYLPEIVISDIMMPGMDGLT 1117

Query: 62   FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL-RFAMRELPQM 120
               H+++  L  D+FV  L  +   E  + G + GA+ ++ KPF+ E L    M  L   
Sbjct: 1118 LCRHIKENSLYADIFVILLTAKTSSEDELRGYKEGADIYIKKPFDTEALINQIMNILNTR 1177

Query: 121  QKSKDE 126
            QK K++
Sbjct: 1178 QKRKEQ 1183


>gi|330876039|gb|EGH10188.1| chemotaxis protein CheY [Pseudomonas syringae pv. morsprunorum str.
           M302280PT]
 gi|330964674|gb|EGH64934.1| chemotaxis protein CheY [Pseudomonas syringae pv. actinidiae str.
           M302091]
          Length = 128

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 60  PGMTGIDLLRQVRADDRLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|302851080|ref|XP_002957065.1| hypothetical protein VOLCADRAFT_98081 [Volvox carteri f. nagariensis]
 gi|300257621|gb|EFJ41867.1| hypothetical protein VOLCADRAFT_98081 [Volvox carteri f. nagariensis]
          Length = 2041

 Score = 44.7 bits (104), Expect = 0.005,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 3/110 (2%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREF-CEKELLPNYLVIDESMEGVL-- 60
            +L VD   + + V   +    G+         EA ++ C  E +P+ +++D  M  +   
Sbjct: 925  ILSVDDEEVNQIVLEEILTSTGYHFARCMDGLEALDWLCASETMPDLILLDCMMPNMSGH 984

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            EF A +R++  G  + V  +  + D + ++ G R+G+N F+ KP+ RE L
Sbjct: 985  EFCATLRKVIPGNVLPVIMVSAKSDEDNIVEGLRSGSNDFVRKPYRREEL 1034


>gi|78223656|ref|YP_385403.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Geobacter metallireducens GS-15]
 gi|78194911|gb|ABB32678.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Geobacter metallireducens GS-15]
          Length = 461

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/126 (30%), Positives = 58/126 (46%), Gaps = 5/126 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    +R+V  +   + G+ V  A S  E     E +  P  +V D  M G+   +
Sbjct: 11  VLIVDDDVSLRRVLEYNLQEEGYEVLTAGSGEEGLRLFE-DGAPTLVVTDLKMPGMGGFQ 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +  V++    T V V      V  E  +   +AGA  F+ KPFNRE L+  +R+   MQ
Sbjct: 70  LLREVKERFPDTVVIVITAFGAV--EAAVEAMKAGAYDFITKPFNREALKLTVRKALDMQ 127

Query: 122 KSKDEN 127
               EN
Sbjct: 128 GLSREN 133


>gi|296169791|ref|ZP_06851406.1| DNA-binding response regulator [Mycobacterium parascrofulaceum ATCC
           BAA-614]
 gi|295895585|gb|EFG75284.1| DNA-binding response regulator [Mycobacterium parascrofulaceum ATCC
           BAA-614]
          Length = 229

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/126 (31%), Positives = 58/126 (46%), Gaps = 5/126 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA E    +  P+ LV+D  M  +  LE
Sbjct: 3   ILVVDDDRAVRESLRRSLSFNGYSVELAHDGLEALEMIASDR-PDALVLDVMMPRLDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 62  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 119

Query: 122 KSKDEN 127
           K  DE+
Sbjct: 120 KPDDED 125


>gi|158335372|ref|YP_001516544.1| two component LuxR family transcriptional regulator [Acaryochloris
           marina MBIC11017]
 gi|158305613|gb|ABW27230.1| two component transcriptional regulator, LuxR family [Acaryochloris
           marina MBIC11017]
          Length = 227

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 63/130 (48%), Gaps = 3/130 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    +R+  +    D GF V  A++     E  ++ + P+ ++ D  M  V   +
Sbjct: 5   LLLVDDEPGLREAVQAYLEDSGFTVDVASNAKAGWELLQQRI-PDLVISDIMMPEVDGYQ 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F+A +R+ P    + + +L      +  I G  AG +++L KPF+ + L   +  L   +
Sbjct: 64  FLAQLREDPRFMRLPIVFLTARGMTKDRIEGYNAGVDAYLSKPFDPDELVAIVTNLLTRK 123

Query: 122 KSKDENQFLD 131
           ++KD N   D
Sbjct: 124 EAKDANATTD 133


>gi|86605502|ref|YP_474265.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86554044|gb|ABC99002.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 245

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +LLVD    +R+  +    D GF V  A +  +A +       P  ++ D  M G+   +
Sbjct: 18  ILLVDDEPGLREAVQAYLEDSGFEVIPAANAQQALQLLSTTQ-PQLIISDIMMPGMDGYQ 76

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+A VR++   + + V +L  +      I G RAG +++L KPF+ E L
Sbjct: 77  FLAQVRKLDPYSHLPVVFLTAKGMTADRIQGYRAGVDAYLPKPFDPEEL 125


>gi|326796448|ref|YP_004314268.1| response regulator receiver protein [Marinomonas mediterranea
           MMB-1]
 gi|326547212|gb|ADZ92432.1| response regulator receiver protein [Marinomonas mediterranea
           MMB-1]
          Length = 126

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ ++L  D GF    EA     A    +   + ++LV D +M G+  +
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGFTNTVEADDGTTALPILQTGTI-DFLVTDWNMPGMTGI 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VR       + V  +  E   +++I  A+AG N +++KPF    L+
Sbjct: 62  ELLRAVRADDKLKTIPVLMVTAEAKRDQIITAAQAGVNGYVVKPFTAVALK 112


>gi|288942617|ref|YP_003444857.1| response regulator receiver protein [Allochromatium vinosum DSM
           180]
 gi|288897989|gb|ADC63825.1| response regulator receiver protein [Allochromatium vinosum DSM
           180]
          Length = 126

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 60/118 (50%), Gaps = 18/118 (15%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVID--- 53
           +L+VD    +R++ ++L  + GF     ++  EA +      LP       ++L+ D   
Sbjct: 3   ILIVDDFSTMRRIIKNLLRELGF-----SNTSEADDGSTA--LPMLKSGGFDFLITDWNM 55

Query: 54  ESMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +MEG+   +  VR  P+   + V  +  E   ++++  A+AG N +++KPF  ETL+
Sbjct: 56  PNMEGI-ALLKAVRADPMLKSLPVLMVTAEAKRDQIVEAAQAGVNGYIVKPFTAETLK 112


>gi|149925417|ref|ZP_01913681.1| chemotaxis two-component response regulator protein [Limnobacter
           sp. MED105]
 gi|149825534|gb|EDM84742.1| chemotaxis two-component response regulator protein [Limnobacter
           sp. MED105]
          Length = 121

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 52/113 (46%), Gaps = 6/113 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV 59
           M ++LL+D ++ +RKV  H+    G +V  A S  E  R+  E    P+ ++ D  M G+
Sbjct: 1   MANILLIDDANTIRKVCAHILTQAGHVVRTAASAEEGIRDIVESG-APDLIITDIDMPGM 59

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             LE    +R+   G  V +  +    D E +      G   +LLKP   E L
Sbjct: 60  DGLELCNRIRKT--GATVPIVVITSYSDKEMIQRAKTLGLAGWLLKPVTPEAL 110


>gi|182414754|ref|YP_001819820.1| response regulator receiver protein [Opitutus terrae PB90-1]
 gi|177841968|gb|ACB76220.1| response regulator receiver protein [Opitutus terrae PB90-1]
          Length = 125

 Score = 44.7 bits (104), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 56/110 (50%), Gaps = 9/110 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE--FCEKELLPNYLVIDESMEGV-- 59
           +L+VD S + R+  R +  + G  V EA+   +A E  +      P+ +++D  M G+  
Sbjct: 5   VLIVDDSALARRTLRQMLEELGHTVEEASDGAQALERFYLSP---PDLVILDMVMAGMYG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRET 109
           L+ ++ +R+M     + V    ++V   +M    +AGA + L KP NR +
Sbjct: 62  LDVLSKMREMKPDAKIIVATADIQVSTAEM--ARKAGAKAVLNKPINRPS 109


>gi|301382876|ref|ZP_07231294.1| chemotaxis protein CheY [Pseudomonas syringae pv. tomato Max13]
 gi|302062798|ref|ZP_07254339.1| chemotaxis protein CheY [Pseudomonas syringae pv. tomato K40]
 gi|302131297|ref|ZP_07257287.1| chemotaxis protein CheY [Pseudomonas syringae pv. tomato NCPPB
           1108]
 gi|331016984|gb|EGH97040.1| chemotaxis protein CheY [Pseudomonas syringae pv. lachrymans str.
           M302278PT]
          Length = 132

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 11  ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 63

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 64  PGMTGIDLLRQVRADDRLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 120


>gi|220933273|ref|YP_002512172.1| two component transcriptional regulator, AraC family
           [Thioalkalivibrio sp. HL-EbGR7]
 gi|219994583|gb|ACL71185.1| two component transcriptional regulator, AraC family
           [Thioalkalivibrio sp. HL-EbGR7]
          Length = 399

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-KELLPNYLVIDESMEGV--L 60
           L++VD     R++ R L  D G  V             + +E LP+ +V D  M G+   
Sbjct: 56  LVIVDDQSTGRRILRELLQDVGQGVEIVDYAAPQDALLDVRENLPDLIVTDYRMPGMNGT 115

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           + I  VR +P G DV +  + +  D         AGA  FL +P +    R   R L Q+
Sbjct: 116 QLIRAVRALPGGADVPIVVVTVLEDRNVRYEALEAGATDFLSRPLDPVECRVRCRNLLQL 175

Query: 121 QK 122
           ++
Sbjct: 176 RR 177


>gi|193216154|ref|YP_001997353.1| response regulator receiver protein [Chloroherpeton thalassium ATCC
           35110]
 gi|193089631|gb|ACF14906.1| response regulator receiver protein [Chloroherpeton thalassium ATCC
           35110]
          Length = 120

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EG 58
           M  +L++D S + RK+   +    G+ + EA    E  E   K   P+ +V+D  M  + 
Sbjct: 1   MPRVLIIDDSAVERKIIAKVMTTLGYSILEANDGEEGEEKA-KSAKPDIIVLDVVMPKKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
             +   ++++MP   ++ V  +  +        G + GA ++++KPFN + L  A+ +
Sbjct: 60  GYQVCRNLKKMPETANIPVIMITSKNQESDKFWGLKQGAIAYIVKPFNEQDLVAAVTQ 117


>gi|154491974|ref|ZP_02031600.1| hypothetical protein PARMER_01604 [Parabacteroides merdae ATCC
           43184]
 gi|154088215|gb|EDN87260.1| hypothetical protein PARMER_01604 [Parabacteroides merdae ATCC
           43184]
          Length = 688

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 62/128 (48%), Gaps = 6/128 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           LL++D S  +R   +H+FN   + + EA +  +      KE  P+ ++ D  M  +   E
Sbjct: 443 LLVIDDSDQIRWFLKHVFNK-EYQILEARNGQDGINVALKEE-PDLILCDVMMPVKDGYE 500

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++  P      V  L  +V+ E +I G  AGA+ ++ KPF+ E LR  +  L  M+
Sbjct: 501 TCREIKNDPKMAQTPVVMLTAKVESEDVITGIEAGADDYITKPFDVEILRSKINSL--MK 558

Query: 122 KSKDENQF 129
           K  D  ++
Sbjct: 559 KRDDMKRY 566


>gi|298487812|ref|ZP_07005853.1| two-component system signal transduction response regulator
           receiver [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|298157904|gb|EFH98983.1| two-component system signal transduction response regulator
           receiver [Pseudomonas savastanoi pv. savastanoi NCPPB
           3335]
 gi|330866466|gb|EGH01175.1| chemotaxis protein CheY [Pseudomonas syringae pv. aesculi str.
           0893_23]
 gi|330880596|gb|EGH14745.1| chemotaxis protein CheY [Pseudomonas syringae pv. glycinea str.
           race 4]
 gi|330889038|gb|EGH21699.1| chemotaxis protein CheY [Pseudomonas syringae pv. mori str. 301020]
 gi|330986510|gb|EGH84613.1| chemotaxis protein CheY [Pseudomonas syringae pv. lachrymans str.
           M301315]
 gi|331011086|gb|EGH91142.1| chemotaxis protein CheY [Pseudomonas syringae pv. tabaci ATCC
           11528]
          Length = 128

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 60  PGMTGIDLLRQVRADERLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|126724600|ref|ZP_01740443.1| response regulator [Rhodobacterales bacterium HTCC2150]
 gi|126705764|gb|EBA04854.1| response regulator [Rhodobacterales bacterium HTCC2150]
          Length = 430

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 43/136 (31%), Positives = 66/136 (48%), Gaps = 11/136 (8%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD S   R++        G+ V EA S  EA   C+++   N ++ D  M G+  L
Sbjct: 19  SVLVVDDSKGQRRILSASLKRAGYDVTEAASGEEAVLACQEKQF-NLVLSDWIMPGMNGL 77

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLRFAMR--- 115
           +F    R+M    D + Y++L+    EK  +  G   GA+ FL KP N   L   M+   
Sbjct: 78  DFCKAFREME--RDTYGYFILLTSKAEKNAVTLGLDVGADDFLTKPVNGAELLARMKAGE 135

Query: 116 ELPQMQKSKD-ENQFL 130
            +  M+  KD +NQ L
Sbjct: 136 RILSMEHEKDMQNQML 151


>gi|257484895|ref|ZP_05638936.1| chemotaxis protein CheY [Pseudomonas syringae pv. tabaci ATCC
           11528]
 gi|289629012|ref|ZP_06461966.1| chemotaxis protein CheY [Pseudomonas syringae pv. aesculi str.
           NCPPB3681]
 gi|289647089|ref|ZP_06478432.1| chemotaxis protein CheY [Pseudomonas syringae pv. aesculi str.
           2250]
 gi|320325135|gb|EFW81204.1| chemotaxis protein CheY [Pseudomonas syringae pv. glycinea str.
           B076]
 gi|320329394|gb|EFW85387.1| chemotaxis protein CheY [Pseudomonas syringae pv. glycinea str.
           race 4]
          Length = 132

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 11  ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 63

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 64  PGMTGIDLLRQVRADERLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 120


>gi|254485790|ref|ZP_05098995.1| response regulator [Roseobacter sp. GAI101]
 gi|214042659|gb|EEB83297.1| response regulator [Roseobacter sp. GAI101]
          Length = 408

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/115 (33%), Positives = 56/115 (48%), Gaps = 7/115 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD S + R++       +GF V EA S  EA E C    LP+ ++ D  M G+ 
Sbjct: 1   MQLVLVVDDSKLQRRILSASLTRWGFEVVEAASGDEALEQCRIR-LPDLVISDWVMPGMN 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
            L+F    R   L    + Y++L+    EK  +  G   GA+ FL KP +   LR
Sbjct: 60  GLQFCRAFRD--LSNFQYGYFILLTSKSEKAEVAKGLDNGADDFLSKPVDVHELR 112


>gi|206890914|ref|YP_002249855.1| chemotaxis protein CheY [Thermodesulfovibrio yellowstonii DSM
           11347]
 gi|206742852|gb|ACI21909.1| chemotaxis protein CheY [Thermodesulfovibrio yellowstonii DSM
           11347]
          Length = 134

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 66/126 (52%), Gaps = 8/126 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEA-REFCEKELLPNYLVIDESM---E 57
            +L+VD    +R++ ++L    GF  + EA +  +A R+    E     +V D +M   E
Sbjct: 7   KVLVVDDFPTMRRIVKNLLKQLGFENIDEAENGEDALRKLRNTEY--GLVVSDWNMPVME 64

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+ E + ++R  P   D+    +  E + EK+I   +AG +++++KPF  E L+  + ++
Sbjct: 65  GI-ELLKNIRNDPALKDIPFLMVTAEAEKEKVIEAIKAGVDNYIVKPFTGEVLKEKLEKI 123

Query: 118 PQMQKS 123
            Q + S
Sbjct: 124 AQKRPS 129


>gi|330961241|gb|EGH61501.1| response regulator receiver [Pseudomonas syringae pv. maculicola
           str. ES4326]
          Length = 128

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 60  PGMSGIDLLRQVRADERLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|86748306|ref|YP_484802.1| response regulator receiver domain-containing protein
           [Rhodopseudomonas palustris HaA2]
 gi|86571334|gb|ABD05891.1| response regulator receiver domain protein [Rhodopseudomonas
           palustris HaA2]
          Length = 131

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 6/113 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY-LVI-DESMEGVL 60
           S+L+VD    + ++ R+L    GF   +  S  +     EK  +  Y LVI D +ME + 
Sbjct: 8   SVLVVDDYSTMIRIIRNLLKQLGFEHIDDAS--DGSAALEKMRVKKYGLVISDWNMEPMT 65

Query: 61  --EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             + +  VR  P  +      +  E   E +IA  RAG N++++KPFN  TL+
Sbjct: 66  GYDLLKEVRADPNLSQTPFIMITAESKTENVIAAKRAGVNNYIVKPFNAATLK 118


>gi|237653881|ref|YP_002890195.1| response regulator receiver protein [Thauera sp. MZ1T]
 gi|237625128|gb|ACR01818.1| response regulator receiver protein [Thauera sp. MZ1T]
          Length = 132

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA     A +  +     +++V D +M  +  L 
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFANVDEAEDGAVALQKLKSSPY-DFVVTDWNMPNMDGLT 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R+ P    + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLQSIRRTPELKHLPVLMITAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|238782818|ref|ZP_04626847.1| hypothetical protein yberc0001_34470 [Yersinia bercovieri ATCC
           43970]
 gi|238716241|gb|EEQ08224.1| hypothetical protein yberc0001_34470 [Yersinia bercovieri ATCC
           43970]
          Length = 129

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 57/115 (49%), Gaps = 16/115 (13%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMV-------FEATSVCEAREFCEKELLPNYLVIDESME 57
           L++D    +R++ R+L  D GF          +A +   A +F       ++++ D +M 
Sbjct: 9   LVIDDFATMRRIVRNLLQDLGFKNIDEAEDGLDALTKLRASKF-------DFVISDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  L+ ++ +R+      + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 62  NLDGLQLLSEIRKDENLNKIPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|71735827|ref|YP_275520.1| chemotaxis protein CheY [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|71556380|gb|AAZ35591.1| chemotaxis protein CheY [Pseudomonas syringae pv. phaseolicola
           1448A]
 gi|283133055|dbj|BAI63822.1| chemotaxis protein CheY [Pseudomonas syringae pv. tabaci]
          Length = 124

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 55

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 56  PGMTGIDLLRQVRADERLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 112


>gi|218778183|ref|YP_002429501.1| response regulator receiver modulated serine phosphatase
           [Desulfatibacillum alkenivorans AK-01]
 gi|218759567|gb|ACL02033.1| response regulator receiver modulated serine phosphatase
           [Desulfatibacillum alkenivorans AK-01]
          Length = 445

 Score = 44.3 bits (103), Expect = 0.005,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 2/110 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+ D    V+   + L + +G+ V  A    +A E  +    P   VID  M G+    
Sbjct: 46  ILVADDDRTVQIALKTLLSKWGYEVVTAQDGAQAWEILQDPKAPRLAVIDWMMPGMEGPA 105

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
               +RQ  L +  ++  L  +    +++ G  AGA+ F+ KPFN   L+
Sbjct: 106 LCKKIRQSSLSSYTYLILLTAKTSKSELMEGLEAGADDFISKPFNAGELK 155


>gi|146293654|ref|YP_001184078.1| response regulator receiver protein [Shewanella putrefaciens CN-32]
 gi|145565344|gb|ABP76279.1| response regulator receiver protein [Shewanella putrefaciens CN-32]
          Length = 127

 Score = 44.3 bits (103), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLRAIRADDSLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|319787082|ref|YP_004146557.1| response regulator receiver protein [Pseudoxanthomonas suwonensis
           11-1]
 gi|317465594|gb|ADV27326.1| response regulator receiver protein [Pseudoxanthomonas suwonensis
           11-1]
          Length = 126

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 59/114 (51%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE----FCEKELLP-NYLVIDESMEG 58
           +L+VD    +R++ ++L ND G+     ++  EA +           P +++V D +M G
Sbjct: 3   ILIVDDFSTMRRIVKNLLNDLGY-----SNTAEADDGHTALAALRAQPFDFVVTDWNMPG 57

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +E + ++R       + V  +  E   E+++  A+AG N +++KPF  +TL
Sbjct: 58  MTGIELLRNIRADARLKTLPVLMVTAEAKREQILEAAQAGVNGYIIKPFTAQTL 111


>gi|323526853|ref|YP_004229006.1| Fis family two component sigma-54 specific transcriptional
           regulator [Burkholderia sp. CCGE1001]
 gi|323383855|gb|ADX55946.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. CCGE1001]
          Length = 460

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  AT++ EAR    +  +P+ +++D ++     L+ + H+   P G  + V  +  
Sbjct: 25  GFSVDTATTIAEARAALTR-FIPDVVLVDLNLPDGSGLDLLQHLPAHPPGGALPVIVMTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQTLRA 133


>gi|254000415|ref|YP_003052478.1| response regulator receiver protein [Methylovorus sp. SIP3-4]
 gi|313202374|ref|YP_004041032.1| response regulator receiver protein [Methylovorus sp. MP688]
 gi|253987094|gb|ACT51951.1| response regulator receiver protein [Methylovorus sp. SIP3-4]
 gi|312441690|gb|ADQ85796.1| response regulator receiver protein [Methylovorus sp. MP688]
          Length = 122

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 58/119 (48%), Gaps = 7/119 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEG 58
           ++++VD S  +R+V R      G+ V E     +A      + +  +L++ +    +M+G
Sbjct: 4   TVMIVDDSTTLRQVVRLALEGAGYSVLEGADGKDALSKLTGQKV--HLIVSDVNMPNMDG 61

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +  F+  V+Q+P      V  L  E    K + G  AGA ++++KPF    L  A+ +L
Sbjct: 62  I-TFVKAVKQLPAYKFTPVIMLTTEAGESKKLEGQAAGAKAWVVKPFQPAQLLMAVSKL 119


>gi|28869184|ref|NP_791803.1| chemotaxis protein CheY [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213967539|ref|ZP_03395687.1| chemotaxis protein CheY [Pseudomonas syringae pv. tomato T1]
 gi|28852424|gb|AAO55498.1| chemotaxis protein CheY [Pseudomonas syringae pv. tomato str.
           DC3000]
 gi|213927840|gb|EEB61387.1| chemotaxis protein CheY [Pseudomonas syringae pv. tomato T1]
          Length = 124

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGF-----TNTSEADDGLTA--LPMLQSGAFDFLVTDWNM 55

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 56  PGMTGIDLLRQVRADDRLKSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 112


>gi|152964293|ref|YP_001360077.1| response regulator receiver protein [Kineococcus radiotolerans
           SRS30216]
 gi|151358810|gb|ABS01813.1| response regulator receiver protein [Kineococcus radiotolerans
           SRS30216]
          Length = 127

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 52/109 (47%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIA 64
           L+VD S  +RK+        G+   EA    EA +  E   LP+   +D +M  V++ + 
Sbjct: 4   LVVDDSRAMRKIIAGALRKLGYETVEAADGAEALKVLEAGPLPDLATVDWNMP-VMDGLT 62

Query: 65  HVRQMPLGTDVFVYYLLM---EVDFEKMIAGARAGANSFLLKPFNRETL 110
            V Q+    +     L+M   E +  +++    AGA+ +L+KPF  + L
Sbjct: 63  FVTQVRANREYRALTLMMVTTEAEHGQIVRALAAGAHEYLIKPFTVDAL 111


>gi|163757991|ref|ZP_02165079.1| putative CheY response regulator transcriptional regulatory protein
           [Hoeflea phototrophica DFL-43]
 gi|162284280|gb|EDQ34563.1| putative CheY response regulator transcriptional regulatory protein
           [Hoeflea phototrophica DFL-43]
          Length = 121

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 51/113 (45%), Gaps = 3/113 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R +     N+ GF   +A    E  E  E E  P+ +V D +M  +    
Sbjct: 5   VLTVDDSRTIRNMLLMTLNNAGFETVQAEDGVEGLEVLE-ESEPDVIVTDINMPRLDGFG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
           FI  VRQ      + +  L  E D EK      AGA  +++KPF+   L  A+
Sbjct: 64  FIEGVRQNERYRAIPILVLTTESDQEKKNRAREAGATGWIVKPFDPSKLIAAI 116


>gi|283779436|ref|YP_003370191.1| response regulator receiver modulated diguanylate cyclase
           [Pirellula staleyi DSM 6068]
 gi|283437889|gb|ADB16331.1| response regulator receiver modulated diguanylate cyclase
           [Pirellula staleyi DSM 6068]
          Length = 569

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 55/114 (48%), Gaps = 4/114 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL  D S ++R + + L    G+ V  A    +A    E++  P  LV D  M  +  LE
Sbjct: 9   LLADDDSAMLRLLSKWL-ESAGYNVQRAVDGAQAAAMIEQDC-PQVLVTDWEMPHMDGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +  VR   L   V++ +L +    + MI G  AGA+ F+ KP +++ L   +R
Sbjct: 67  LVRWVRAQNLPNYVYIIFLTVRSGLDDMIRGLDAGADDFVKKPVDKDELLARLR 120


>gi|158334336|ref|YP_001515508.1| two-component response regulator [Acaryochloris marina MBIC11017]
 gi|158304577|gb|ABW26194.1| two-component response regulator, putative [Acaryochloris marina
           MBIC11017]
          Length = 375

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 55/122 (45%), Gaps = 13/122 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEAT----SVCEAREFCEKELLPNYLVIDESM 56
           M  +L++D   I + + R      G+ V  A+     + +A++ C        L+I + M
Sbjct: 1   MVKILIIDDDPITQLLLRRTLEKQGYQVTVASDGQEGLSKAQQLCPA------LIICDWM 54

Query: 57  EGVLEFIAHVRQM---PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFA 113
             VL+ I   +Q+   P  +  F   L    D E  IAG  AGA+ FL KP +   LR  
Sbjct: 55  MPVLDGIGVCQQLKSNPQLSATFFILLTSRSDLEDRIAGLNAGADEFLTKPIDMSELRAR 114

Query: 114 MR 115
           +R
Sbjct: 115 VR 116


>gi|187924869|ref|YP_001896511.1| Fis family transcriptional regulator [Burkholderia phytofirmans
           PsJN]
 gi|187716063|gb|ACD17287.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia phytofirmans PsJN]
          Length = 460

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  AT++ EAR    +  +P+ +++D ++     L+ + H+   P G  + V  +  
Sbjct: 25  GFSVDTATTIAEARAALTR-FIPDVVLVDLNLPDGSGLDLLQHLPAHPPGGALPVIVMTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQTLRA 133


>gi|114562378|ref|YP_749891.1| response regulator receiver protein [Shewanella frigidimarina NCIMB
           400]
 gi|120598268|ref|YP_962842.1| response regulator receiver protein [Shewanella sp. W3-18-1]
 gi|114333671|gb|ABI71053.1| response regulator receiver protein [Shewanella frigidimarina NCIMB
           400]
 gi|120558361|gb|ABM24288.1| response regulator receiver protein [Shewanella sp. W3-18-1]
          Length = 123

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 61  IDLLRAIRADDSLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 112


>gi|327404313|ref|YP_004345151.1| winged helix family two component transcriptional regulator
           [Fluviicola taffensis DSM 16823]
 gi|327319821|gb|AEA44313.1| two component transcriptional regulator, winged helix family
           [Fluviicola taffensis DSM 16823]
          Length = 223

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 52/112 (46%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           MD +L+VD    +R++  +     GF VF A +       C KE  P+ +++D  M G+ 
Sbjct: 1   MDKILIVDDEEDIREILGYNLKKEGFKVFLAENGQTGISIC-KEEKPDLVILDVMMPGMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +E    +R      +V + +L    +    IAG  AGA+ ++ KP     L
Sbjct: 60  GIEVCDQIRNTKGLENVLICFLTARNEDYSQIAGLDAGADDYISKPIKPRVL 111


>gi|99082727|ref|YP_614881.1| response regulator receiver modulated serine phosphatase [Ruegeria
           sp. TM1040]
 gi|99039007|gb|ABF65619.1| Phosphoserine phosphatase rsbU [Ruegeria sp. TM1040]
          Length = 423

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (50%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA S  +A + C  +  P+ ++ D  M G+  +E
Sbjct: 21  VLVVDDSRLQRRILVASLKKWGFDVVEAESGEDAMDICRAD-PPDLILSDWMMPGMNGIE 79

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R      + + Y++L+    EK  +  G  AGA+ FL KP + + LR
Sbjct: 80  FCRAFRAD--SHETYSYFILLTSKSEKNEVAEGLDAGADDFLTKPVSSDELR 129


>gi|119383247|ref|YP_914303.1| response regulator receiver protein [Paracoccus denitrificans
           PD1222]
 gi|119373014|gb|ABL68607.1| response regulator receiver protein [Paracoccus denitrificans
           PD1222]
          Length = 423

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 37/105 (35%), Positives = 52/105 (49%), Gaps = 7/105 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +LLVD S   R+         G+ V EA S  EA   C  E  P+ ++ D  M G   LE
Sbjct: 19  VLLVDDSRAQRRTLAVQLIRAGYHVVEAASGDEAMRIC-LERRPDIVISDWMMPGQSGLE 77

Query: 62  FIAHVRQMPLGTDVFVYYLLMEV--DFEKMIAGARAGANSFLLKP 104
           F    R+M   +D + Y++L+    D + +  G RAGA+ FL KP
Sbjct: 78  FCRRFREMQ--SDRYGYFILLTSRNDKKDIAEGLRAGADEFLTKP 120


>gi|109899334|ref|YP_662589.1| response regulator receiver protein [Pseudoalteromonas atlantica
           T6c]
 gi|109701615|gb|ABG41535.1| response regulator receiver protein [Pseudoalteromonas atlantica
           T6c]
          Length = 127

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T++ EA +      LP       +++V D +
Sbjct: 6   KILVVDDFSTMRRIIKNLLKDLGF-----TNIQEADDGSTA--LPMLQQGDFDFVVTDWN 58

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  +R         V  +  E   E+++A A+AG N +++KPF   TL+
Sbjct: 59  MPGMQGIDLLRAIRADENLKHTPVLMVTAEAKKEQIVAAAQAGVNGYVIKPFTAATLK 116


>gi|146298307|ref|YP_001192898.1| two component transcriptional regulator [Flavobacterium johnsoniae
           UW101]
 gi|146152725|gb|ABQ03579.1| two component transcriptional regulator, winged helix family
           [Flavobacterium johnsoniae UW101]
          Length = 227

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 69/133 (51%), Gaps = 8/133 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           LL+ D   I+  VG +L  + G+ +  A++  +A    +KEL P  +++D     M+G +
Sbjct: 9   LLVDDEPDILEIVGYNLAQE-GYQIVTASNGKDAIAKAQKEL-PELIIMDVMMAEMDG-M 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E   H+R++P   +V + +L    +    +AG  AGA+ ++ KP   + L   ++ L  +
Sbjct: 66  EACEHIRKIPELNNVIITFLTARSEDYSQVAGFDAGADDYITKPIKPKLLVSKVKAL--L 123

Query: 121 QKSKDENQFLDAI 133
           ++ K++    D I
Sbjct: 124 RRLKEQEVVTDTI 136


>gi|260576146|ref|ZP_05844139.1| response regulator receiver modulated serine phosphatase
           [Rhodobacter sp. SW2]
 gi|259021626|gb|EEW24929.1| response regulator receiver modulated serine phosphatase
           [Rhodobacter sp. SW2]
          Length = 422

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 36/116 (31%), Positives = 59/116 (50%), Gaps = 7/116 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S   RK+   L   +G+ V EA S  EA   C++    + ++ D  M G+  +E
Sbjct: 23  VLVVDDSKAQRKILSMLLLRWGYRVTEAGSGEEALALCQETSF-DIILSDWMMPGMTGVE 81

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLRFAMR 115
           F    R +P   + + Y++L+    EK  +  G   GA+ FL KP + + LR  +R
Sbjct: 82  FCRSFRGLP--REGYGYFILLTSKSEKTEVADGLDGGADDFLTKPVSADELRARLR 135


>gi|254486264|ref|ZP_05099469.1| chemotaxis response regulator, CheY4 [Roseobacter sp. GAI101]
 gi|214043133|gb|EEB83771.1| chemotaxis response regulator, CheY4 [Roseobacter sp. GAI101]
          Length = 122

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 54/110 (49%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L +D S  VR + +   +  G+ V EA    +  E   +   P+ ++ D++M  +  +
Sbjct: 4   TILAIDDSASVRLMVKMTLSGAGYTVVEAADGEQGLEIA-RSCRPDAVLTDQNMPRLDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            FI   RQM     V V ++  E D   +     AGA  +++KPF++E L
Sbjct: 63  GFIRKFRQMQESEGVPVVFISTESDSGVVQQARSAGATGWIVKPFDQEKL 112


>gi|167623397|ref|YP_001673691.1| response regulator receiver protein [Shewanella halifaxensis
           HAW-EB4]
 gi|167353419|gb|ABZ76032.1| response regulator receiver protein [Shewanella halifaxensis
           HAW-EB4]
          Length = 127

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILVVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLKAIRADDNLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|119471376|ref|ZP_01613848.1| chemotaxis response regulator [Alteromonadales bacterium TW-7]
 gi|119445652|gb|EAW26936.1| chemotaxis response regulator [Alteromonadales bacterium TW-7]
          Length = 120

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L VD S  +R++        GF V EA    EA    +++   + ++ D +M  ++
Sbjct: 1   MKKILAVDDSASMRQMVSFTLKTAGFDVTEAKDGSEALAIAKQQGF-DAVISDVNMP-IM 58

Query: 61  EFIAHVRQMPLGTDVFVYYLLM---EVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           + I  +R++    D     LLM   E   EK + G  AGA  +++KPFN E L   ++++
Sbjct: 59  DGITLIRELRTLPDYKFTPLLMLTTESGLEKKVEGKAAGATGWIVKPFNPEQLLAVIKKV 118


>gi|83942047|ref|ZP_00954509.1| response regulator [Sulfitobacter sp. EE-36]
 gi|83847867|gb|EAP85742.1| response regulator [Sulfitobacter sp. EE-36]
          Length = 461

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           + + ++VD S + R++     + +GF V EA S  EA   CE+ L P+ ++ D  M G+ 
Sbjct: 21  IKTAMVVDDSALQRRILMATLSRWGFDVQEAASAEEALAVCEQNL-PDLIISDWIMPGMS 79

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            L+F    R++  G+  +   L  + D  +++ G  +GA+ F+ KP N + LR
Sbjct: 80  GLQFCEAFRKLSKGSYGYFILLTAKSDKSEVVKGLDSGADDFVSKPVNVDELR 132


>gi|238792332|ref|ZP_04635966.1| hypothetical protein yinte0001_12580 [Yersinia intermedia ATCC
           29909]
 gi|238728258|gb|EEQ19778.1| hypothetical protein yinte0001_12580 [Yersinia intermedia ATCC
           29909]
          Length = 428

 Score = 44.3 bits (103), Expect = 0.006,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 59/113 (52%), Gaps = 7/113 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD S   R +  +L  ++ F VFEA +  +A    +   + N ++ D  M  +  L
Sbjct: 12  SILVVDDSASYRFLLVNLLKNWQFTVFEAENGQDALAILDGNAI-NMVISDWEMPVMDGL 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEV--DFEKMIAGARAGANSFLLKPFNRETLR 111
           +    +R+     D ++Y +L+ V    E +IAG  AGA+ FL KP N+  LR
Sbjct: 71  KLCTTIRKHYF--DRYIYLVLITVRQSVEDLIAGLDAGADDFLSKPINQSELR 121


>gi|167761520|ref|ZP_02433647.1| hypothetical protein CLOSCI_03931 [Clostridium scindens ATCC 35704]
 gi|167661186|gb|EDS05316.1| hypothetical protein CLOSCI_03931 [Clostridium scindens ATCC 35704]
          Length = 241

 Score = 44.3 bits (103), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 38/106 (35%), Positives = 57/106 (53%), Gaps = 9/106 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLPNYLVIDESME--GVL 60
           LLL D   + R +   L  + G+ V  AT V EA+E F E E+  + ++ D SME    L
Sbjct: 16  LLLEDDESLNRGISLKLKKE-GYEVLSATGVAEAKEMFRENEV--DLIISDISMEDGNGL 72

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           EF   VR++     +F+  L  EVD   ++ G  AGA+ ++ KPF+
Sbjct: 73  EFGQSVRKVSDVYLIFLTALDQEVD---IVNGYDAGADDYITKPFS 115


>gi|262276377|ref|ZP_06054186.1| chemotaxis regulator CheY [Grimontia hollisae CIP 101886]
 gi|262220185|gb|EEY71501.1| chemotaxis regulator CheY [Grimontia hollisae CIP 101886]
          Length = 122

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K  + +++V D +M G+  
Sbjct: 2   KILVVDDFSTMRRIVKNLLRDLGFNNTVEADDGLTALPILKKGGI-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E+++  A+AG N +++KPF   TL+
Sbjct: 61  IDLLKNIRADDDLKHLPVLMITAEAKREQIVEAAQAGVNGYIVKPFTAATLK 112


>gi|332305677|ref|YP_004433528.1| response regulator receiver protein [Glaciecola agarilytica
           4H-3-7+YE-5]
 gi|332173006|gb|AEE22260.1| response regulator receiver protein [Glaciecola agarilytica
           4H-3-7+YE-5]
          Length = 123

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T++ EA +      LP       +++V D +
Sbjct: 2   KILVVDDFSTMRRIIKNLLKDLGF-----TNIQEADDGSTA--LPMLQQGDFDFVVTDWN 54

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  +R         V  +  E   E+++A A+AG N +++KPF   TL+
Sbjct: 55  MPGMQGIDLLRAIRADENLKHTPVLMVTAEAKKEQIVAAAQAGVNGYVIKPFTAATLK 112


>gi|83953096|ref|ZP_00961818.1| response regulator [Sulfitobacter sp. NAS-14.1]
 gi|83842064|gb|EAP81232.1| response regulator [Sulfitobacter sp. NAS-14.1]
          Length = 461

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 34/113 (30%), Positives = 61/113 (53%), Gaps = 3/113 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           + + ++VD S + R++     + +GF V EA S  EA   CE+ L P+ ++ D  M G+ 
Sbjct: 21  IKTAMVVDDSALQRRILMATLSRWGFDVQEAASAEEALAVCEQNL-PDLIISDWIMPGMS 79

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            L+F    R++  G+  +   L  + D  +++ G  +GA+ F+ KP N + LR
Sbjct: 80  GLQFCEAFRKLSKGSYGYFILLTAKSDKSEVVKGLDSGADDFVSKPVNVDELR 132


>gi|312889015|ref|ZP_07748575.1| histidine kinase [Mucilaginibacter paludis DSM 18603]
 gi|311298533|gb|EFQ75642.1| histidine kinase [Mucilaginibacter paludis DSM 18603]
          Length = 1377

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 30/113 (26%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 1    MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
            + +LL++D +  +R+  R +F    + ++EA +  E  E   KE LP+ ++ D  M G+ 
Sbjct: 1110 LKTLLVIDDNQDIREYIRQVFK-LDYNIYEANNGEEGYELI-KEHLPDIVISDVMMPGMS 1167

Query: 60   -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             +E  + V++    + + V  L      E  + G   GA+ ++ KPF++E L+
Sbjct: 1168 GIELCSLVKEDMAISHIPVILLTASSSPEIKLKGIEGGADDYISKPFDKEILK 1220


>gi|332185368|ref|ZP_08387116.1| response regulator [Sphingomonas sp. S17]
 gi|332014346|gb|EGI56403.1| response regulator [Sphingomonas sp. S17]
          Length = 122

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 56/120 (46%), Gaps = 8/120 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           S+L VD S  +R   R      G+ V EA+   E           + +V D    +M+G 
Sbjct: 4   SILTVDDSASLRMAIRIALTGAGYAVTEASDGAEGLAKATATRF-DLIVTDLNMPNMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETL-RFAMREL 117
           L  I  +RQ P    V + +L  E D + M A A+A GA  +L+KPF  E L R A + L
Sbjct: 62  LSMIRALRQQPAQAGVPIIFLTTESD-DAMKAQAKAAGATGWLVKPFQPEQLIRVAQKVL 120


>gi|294636584|ref|ZP_06714945.1| putative diguanylate cyclase/response regulator [Edwardsiella tarda
           ATCC 23685]
 gi|291090171|gb|EFE22732.1| putative diguanylate cyclase/response regulator [Edwardsiella tarda
           ATCC 23685]
          Length = 318

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 53/110 (48%), Gaps = 4/110 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD   +  ++   LF D    VF AT+  +A   C  +  P+ +++D  M  +  LE
Sbjct: 21  LLIVDDEPLNIQLLYQLFAD-DHTVFMATNGQQALNICMNQH-PDLVLLDIEMPDMNGLE 78

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
               ++  P   D+ V ++   +D     AG RAGA  F+ KP N   +R
Sbjct: 79  VCQRLKAAPQTQDIPVIFITAHIDENSETAGLRAGAVDFISKPINHNIVR 128


>gi|157376180|ref|YP_001474780.1| response regulator receiver protein [Shewanella sediminis HAW-EB3]
 gi|157318554|gb|ABV37652.1| response regulator receiver protein [Shewanella sediminis HAW-EB3]
          Length = 127

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILVVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLKAIRADDELKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|330808236|ref|YP_004352698.1| Chemotaxis protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327376344|gb|AEA67694.1| Chemotaxis protein [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
          Length = 127

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTAEADDGTTA--LPMLHSGNFDFLVTDWN 58

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 59  MPGMTGIDLLRQVRADEKLKHLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|197118049|ref|YP_002138476.1| response receiver histidine kinase [Geobacter bemidjiensis Bem]
 gi|197087409|gb|ACH38680.1| response receiver histidine kinase [Geobacter bemidjiensis Bem]
          Length = 396

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 7/110 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L+VD   ++  +   +  + G+ VF A S  E  E  EKE  P  +++D    +M+G+ 
Sbjct: 12  VLIVDDEKVILDLTAIILKNRGYQVFTALSALEGLEVIEKE-RPELVLLDYMMPNMDGLT 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
                 R  P   D +V     +   E  +   +AGA+ ++LKPFN + L
Sbjct: 71  ALKEIRRSYP---DTYVIMFTGKGSEEIAVELMKAGASDYILKPFNNQDL 117


>gi|238756854|ref|ZP_04618042.1| hypothetical protein yaldo0001_15020 [Yersinia aldovae ATCC 35236]
 gi|238704684|gb|EEP97213.1| hypothetical protein yaldo0001_15020 [Yersinia aldovae ATCC 35236]
          Length = 428

 Score = 43.9 bits (102), Expect = 0.007,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 59/113 (52%), Gaps = 7/113 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD S   R +  +L   + F VFEA +  +A    +   + N ++ D  M  +  L
Sbjct: 12  SILVVDDSASYRFLLVNLLKKWQFSVFEAENGQDALAILDDNAI-NMVISDWEMPVMDGL 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEV--DFEKMIAGARAGANSFLLKPFNRETLR 111
           +    +R+    +D ++Y +L+ V    E +IAG  AGA+ FL KP N+  LR
Sbjct: 71  KLCTTIRKHY--SDRYIYLVLITVRQSVEDLIAGLDAGADDFLSKPINQSELR 121


>gi|229591831|ref|YP_002873950.1| chemotaxis protein CheY [Pseudomonas fluorescens SBW25]
 gi|229363697|emb|CAY51074.1| chemotaxis protein CheY [Pseudomonas fluorescens SBW25]
          Length = 124

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPN-----YLVIDESMEG 58
           +L+VD    +R++ ++L  D GF     T+  EA +      + N     +LV D +M G
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGF-----TNTVEADDGITAIPILNSGSIDFLVTDWNMPG 57

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           +  ++ + HVR       + V  +  E   E++I  A+AG N +++KPF    L+
Sbjct: 58  MTGIDLLRHVRADEKLRSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTALALK 112


>gi|300311026|ref|YP_003775118.1| chemotaxis response regulator receiver domain-containing protein
           [Herbaspirillum seropedicae SmR1]
 gi|300073811|gb|ADJ63210.1| chemotaxis response regulator receiver domain protein
           [Herbaspirillum seropedicae SmR1]
          Length = 134

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/123 (25%), Positives = 61/123 (49%), Gaps = 4/123 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLP-NYLVIDESMEGV--L 60
           L+VD    +R++   L  +  ++ V +A     A +  E   LP ++++ D +M G+  L
Sbjct: 8   LVVDDFSTMRRIIIGLLKELEYLKVTDADDGTSAWKILESGALPISFVITDWNMPGMDGL 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+ P    + V  +  E   E ++  A  GA+ +++KPFN  TL   + ++ Q 
Sbjct: 68  GLLKKIRETPRLKRLPVLMVSAEAKKENIVLAAETGADGYIVKPFNAATLDDKISKILQR 127

Query: 121 QKS 123
           + S
Sbjct: 128 RSS 130


>gi|83647838|ref|YP_436273.1| CheY-like receiver protein [Hahella chejuensis KCTC 2396]
 gi|83635881|gb|ABC31848.1| FOG: CheY-like receiver [Hahella chejuensis KCTC 2396]
          Length = 128

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 59/117 (50%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILVVDDFSTMRRIIKNLLRDLGF-----TNTDEADDGSTA--LPMLKTGKFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  +E +  VR      ++ V  +  E   ++++A A+AG N +++KPF    L+
Sbjct: 60  PGMTGIELLQAVRADESLKNLPVLMVTAEAKRDQIVAAAQAGVNGYVVKPFTAAVLK 116


>gi|312880015|ref|ZP_07739815.1| response regulator receiver protein [Aminomonas paucivorans DSM
           12260]
 gi|310783306|gb|EFQ23704.1| response regulator receiver protein [Aminomonas paucivorans DSM
           12260]
          Length = 286

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 52/114 (45%), Gaps = 3/114 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+ D + ++R   +H+  +    V EA +  EA         P  L+ D  M G+  F 
Sbjct: 162 ILIADDAPVIRVGLKHILKEMDLPVLEADNGNEAYRLS-LATPPRLLLTDLVMPGMDGFS 220

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            I+  R  P      +  +    D  +++   R+GAN F++KPF  E ++  +R
Sbjct: 221 LISRFRGTPSNAKTPIIVISSYGDRARLVKALRSGANDFIVKPFRPEVVKEKIR 274


>gi|170751195|ref|YP_001757455.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170657717|gb|ACB26772.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 121

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 50/112 (44%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M ++L VD S  +R++ + +    G  V EA    E       E + N ++ D +M    
Sbjct: 1   MATVLAVDDSPSIRQMIKVVLGPAGHTVIEAGDGAEGLAKARSESV-NLVITDLNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            LE I  +R +P  T V + +L  E D         AGA  ++ KPF  E L
Sbjct: 60  GLEMIKQLRTLPSFTGVPILFLSTESDEGIKQQAKAAGATGWITKPFKPEQL 111


>gi|218781037|ref|YP_002432355.1| response regulator receiver modulated serine phosphatase
           [Desulfatibacillum alkenivorans AK-01]
 gi|218762421|gb|ACL04887.1| response regulator receiver modulated serine phosphatase
           [Desulfatibacillum alkenivorans AK-01]
          Length = 406

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 52/106 (49%), Gaps = 7/106 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEGV 59
           +L+VD    VR + +   + + + V EA    EA E  ++   P  LVI +     M+GV
Sbjct: 6   ILIVDDDPGVRHLLKEGLSAWDYQVVEAQDGLEAWEILKET--PVTLVISDWMMPGMDGV 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
            E    +R  P  + V+V  L  +   + ++ G  AGA+ F+ KPF
Sbjct: 64  -ELCRRIRSHPFPSYVYVVLLTAKSQKDDLLQGMEAGADDFMGKPF 108


>gi|88798985|ref|ZP_01114566.1| CheY-like receiver protein [Reinekea sp. MED297]
 gi|88778212|gb|EAR09406.1| CheY-like receiver protein [Reinekea sp. MED297]
          Length = 124

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ ++L  D GF    EA     A    +     +++V D +M G+  +
Sbjct: 3   ILVVDDFSTMRRIVKNLLRDLGFTNTHEADDGTSAWPMLQSGDF-DFVVTDWNMPGMTGI 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  +R       V V  +  E   ++++A A+AG N +++KPF    L+
Sbjct: 62  ELLQKIRADERLKSVPVLMVTAEAKRDQIVAAAQAGVNGYVVKPFTAAALK 112


>gi|158336238|ref|YP_001517412.1| two component LuxR family transcriptional regulator [Acaryochloris
           marina MBIC11017]
 gi|158306479|gb|ABW28096.1| two component transcriptional regulator, LuxR family [Acaryochloris
           marina MBIC11017]
          Length = 220

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 5/118 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L+VD    +R          G+ V  A +  +A +  + +  P+ LV D     M+G 
Sbjct: 4   TVLIVDDEPGIRLAVTDYLEAVGYTVISAATGKQAWQLVQ-QYRPHLLVTDIRMPQMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            E +  VRQ P    + V YL      ++ I G + G +++L KPFN E L   +R L
Sbjct: 62  YELVKLVRQQPAFRLLPVIYLTECSQTQERIRGYKLGCDAYLAKPFNLEELAAVIRNL 119


>gi|320162524|ref|YP_004175749.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
 gi|319996378|dbj|BAJ65149.1| response regulator receiver protein [Anaerolinea thermophila UNI-1]
          Length = 117

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 57/115 (49%), Gaps = 11/115 (9%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE---FCEKELLPNYLVIDESME 57
           M  +L+VD S   R + +      G +V EA+S  +A E    C+    PN + +D  M 
Sbjct: 1   MAKILIVDDSSYARTLLKRALEKAGHVVCEASSGMDALEQLPTCQ----PNLVTMDLLMP 56

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           G+  LE I H++ M     V V    ++ +  K +   +AGA++FL KP + + L
Sbjct: 57  GMEGLELIGHLKAMQPSLKVIVITANIQDETRKELI--QAGADAFLNKPVSPDVL 109


>gi|195952573|ref|YP_002120863.1| response regulator receiver protein [Hydrogenobaculum sp. Y04AAS1]
 gi|195932185|gb|ACG56885.1| response regulator receiver protein [Hydrogenobaculum sp. Y04AAS1]
          Length = 127

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 54/112 (48%), Gaps = 6/112 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY--LVIDESMEGV-- 59
           +L+VD    +R+V + + N  G+   E       ++   K    NY  ++ D +M  +  
Sbjct: 10  ILVVDDMSTMRRVIKSILNQLGYSNIEEAE--NGKDALSKLSSSNYDFVLTDWNMPEMDG 67

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE +  +RQ P   D+ +  +  E   E ++   + G N++++KPF  E L+
Sbjct: 68  LELVKTIRQDPNLKDLPILMVTAEAKKENVLEALKTGVNNYIVKPFTAEILK 119


>gi|51245653|ref|YP_065537.1| Pho family two-component response regulator [Desulfotalea
           psychrophila LSv54]
 gi|50876690|emb|CAG36530.1| probable two-component system response regulator (Pho family)
           [Desulfotalea psychrophila LSv54]
          Length = 208

 Score = 43.9 bits (102), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 57/125 (45%), Gaps = 2/125 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+ +   + R + +    ++G+ V EA    EA E   +   P   +ID  M  V  L
Sbjct: 17  KVLVAEDELVTRLMVQVSLENWGYDVLEAKDGKEAMELFGRGEAPRIAIIDWEMPEVDGL 76

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+       ++  L        ++ G  AGA+ ++ KPFN + LR  +R   ++
Sbjct: 77  EVCKRLREQESENPPYIILLTAHGSKNDILLGFDAGADDYITKPFNSDELRARVRVADRL 136

Query: 121 QKSKD 125
            +S+D
Sbjct: 137 VRSQD 141


>gi|254473579|ref|ZP_05086975.1| two-component response regulator [Pseudovibrio sp. JE062]
 gi|211957291|gb|EEA92495.1| two-component response regulator [Pseudovibrio sp. JE062]
          Length = 127

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           +L+VD    + ++ R+L    GF  + +A    EA E   K+     ++ D +ME +   
Sbjct: 9   ILVVDDYKTMIRIIRNLLKQLGFTDIDDAADGTEAYEKM-KQRRYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VRQ           +  E   E +IA  +AG N++++KPFN +TL+
Sbjct: 68  ELLKQVRQDAALCKTPFIMVTAESKTENVIAAKKAGVNNYIVKPFNAQTLK 118


>gi|212634385|ref|YP_002310910.1| response regulator receiver [Shewanella piezotolerans WP3]
 gi|212555869|gb|ACJ28323.1| Response regulator receiver [Shewanella piezotolerans WP3]
          Length = 123

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILVVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 61  IDLLKAIRADDELKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 112


>gi|75908456|ref|YP_322752.1| adenylate/guanylate cyclase [Anabaena variabilis ATCC 29413]
 gi|75702181|gb|ABA21857.1| adenylate/guanylate cyclase [Anabaena variabilis ATCC 29413]
          Length = 1156

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 59/124 (47%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD +  +R     +    G+ V+ A +  E     + EL+PN +V D  M  V  L
Sbjct: 799 SILVVDDNPDLRTYVSDILRRSGYQVYTARNGYEGFSKVQ-ELVPNLIVTDLMMPLVTGL 857

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E I  +R         +  L  +VD E  I     GA+++L KPFN   L   +R L  +
Sbjct: 858 EMIRMIRNDEKVKGTPIILLTAKVDEETRIESTEHGADAYLAKPFNDRELLAEVRNLLAL 917

Query: 121 QKSK 124
           ++++
Sbjct: 918 KENE 921


>gi|307944203|ref|ZP_07659544.1| protein PetR [Roseibium sp. TrichSKD4]
 gi|307772549|gb|EFO31769.1| protein PetR [Roseibium sp. TrichSKD4]
          Length = 232

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 35/109 (32%), Positives = 51/109 (46%), Gaps = 6/109 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           LLLVD    +R +   L  + G+ V  A +  EAR  C   L  + L++D  M G   L+
Sbjct: 13  LLLVDDDQRIRDLLGRLLAENGYRVTTAANAQEART-CLSGLSFDLLILDVMMPGETGLD 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             + +R     +DV +  L    D    IAG   GA+ +L KPF  + L
Sbjct: 72  LASWLRDH---SDVPILMLTARSDASDRIAGLEVGADDYLAKPFEPKEL 117


>gi|22596850|gb|AAN03368.1|AF481091_5 CheY [Pseudomonas fluorescens]
          Length = 124

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPN-----YLVIDESMEG 58
           +L+VD    +R++ ++L  D GF     T+  EA +      + N     +LV D +M G
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGF-----TNTVEADDGLTAIPILNSGSIDFLVTDWNMPG 57

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           +  ++ + HVR       + V  +  E   E++I  A+AG N +++KPF    L+
Sbjct: 58  MTGIDLLRHVRADEKLRSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTALALK 112


>gi|323357907|ref|YP_004224303.1| response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Microbacterium
           testaceum StLB037]
 gi|323274278|dbj|BAJ74423.1| response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Microbacterium
           testaceum StLB037]
          Length = 244

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 55/114 (48%), Gaps = 5/114 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    +  + R    + G+    A +  EA     +E  P+ LV+D  M G+  +E
Sbjct: 22  VLVVDDEANLSDLLRMALQNEGWDARTAANGQEALNVI-REFGPDLLVLDIMMPGLDGME 80

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +  +R    G D  V +L  +   E  IAG  AGA+ ++ KPFN E +   +R
Sbjct: 81  LLTRIRAA--GNDAPVLFLTAKDAVEDRIAGISAGADDYVTKPFNLEEVVVRLR 132


>gi|268680382|ref|YP_003304813.1| response regulator receiver [Sulfurospirillum deleyianum DSM 6946]
 gi|268618413|gb|ACZ12778.1| response regulator receiver [Sulfurospirillum deleyianum DSM 6946]
          Length = 121

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 56/112 (50%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G+  V EA    EA +  E+    N L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLQRLGYDDVLEAEHGVEAWQIMERTPDINVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L+ +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LDLVRKVRAEKKYENMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|260910355|ref|ZP_05917028.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           sp. oral taxon 472 str. F0295]
 gi|260635538|gb|EEX53555.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           sp. oral taxon 472 str. F0295]
          Length = 673

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 48/87 (55%), Gaps = 3/87 (3%)

Query: 26  FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLME 83
           + V+ AT+  EA      EL+P+ ++ D  M G+  LE    VRQ  +   + +  +  +
Sbjct: 445 YAVYYATNGTEALSKA-MELVPDIMITDRMMPGIDGLEVCRKVRQSDVLNHIPIVVVTGK 503

Query: 84  VDFEKMIAGARAGANSFLLKPFNRETL 110
           +  ++ + G +AGA++++ KPFN E L
Sbjct: 504 ITEQERLEGIKAGADAYINKPFNSEEL 530


>gi|256829200|ref|YP_003157928.1| response regulator receiver protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256578376|gb|ACU89512.1| response regulator receiver protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 120

 Score = 43.9 bits (102), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 54/119 (45%), Gaps = 8/119 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEG 58
           +++ VD S  VR++      D G+ V EA   C+ ++   K   P  +++ +    +M G
Sbjct: 4   TIMTVDDSASVRQMVSLTLKDAGYAVIEA---CDGKDALAKLSGPVDMIVTDLNMPNMNG 60

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           + E I  VR  P    V +  L  E        G  AGA  +++KPF  + L    ++L
Sbjct: 61  I-ELIRAVRATPQYKFVPIIMLTTESQASTKEEGKAAGATGWIVKPFKPDQLLAVAKKL 118


>gi|148265760|ref|YP_001232466.1| two component, sigma-54 specific, Fis family transcriptional
           regulator [Geobacter uraniireducens Rf4]
 gi|146399260|gb|ABQ27893.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Geobacter uraniireducens Rf4]
          Length = 454

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 5/129 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L++D    +R+V  +   + G+ V  A    EA      E  P  +V D  M G+  F 
Sbjct: 5   ILIIDDDTSLRRVLEYNLQEEGYEVVTAAD-GEAGLALFAECSPALVVTDLKMPGISGFQ 63

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +A +++    T V V      +D    I   + GA  ++ KPFNR+ L+  +++  ++Q
Sbjct: 64  VLATIKERSPATLVIVITAFGAID--TAIEAMKLGAYDYITKPFNRDQLKLVVKKALELQ 121

Query: 122 KSKDENQFL 130
              +EN+ L
Sbjct: 122 GLSEENRLL 130


>gi|332666853|ref|YP_004449641.1| histidine kinase [Haliscomenobacter hydrossis DSM 1100]
 gi|332335667|gb|AEE52768.1| histidine kinase [Haliscomenobacter hydrossis DSM 1100]
          Length = 1368

 Score = 43.9 bits (102), Expect = 0.008,   Method: Composition-based stats.
 Identities = 26/91 (28%), Positives = 48/91 (52%), Gaps = 3/91 (3%)

Query: 44   ELLPNYLVIDESMEGVLEFI--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFL 101
            EL+P+ ++ D  M  +  F    H+R     + + +  L  + DFE  + G   GA+++L
Sbjct: 1152 ELIPDLIISDVMMPRMDGFTLCQHLRNDERSSHIPIILLTAKADFESKLTGLDRGADAYL 1211

Query: 102  LKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
             KPF  E LR  +++L ++ + K +  +L A
Sbjct: 1212 EKPFQPEELRLRIKKLLEL-REKLKQHYLQA 1241


>gi|23011764|ref|ZP_00052029.1| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 84

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 38/67 (56%), Gaps = 2/67 (2%)

Query: 46  LPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLK 103
           +P+ +++D +M  +   E + H+RQ P G    V +   E D   +    RAGA+ +++K
Sbjct: 1   MPSVILLDWNMPNMDGYEVLRHLRQSPSGDRPKVLFCTTENDIGAIARALRAGADEYIMK 60

Query: 104 PFNRETL 110
           PF+RE +
Sbjct: 61  PFDREIM 67


>gi|319427053|gb|ADV55127.1| chemotaxis response regulator receiver, CheY [Shewanella
           putrefaciens 200]
          Length = 123

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 57/111 (51%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  +
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGFNNSQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQGI 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 62  DLLRAIRADDSLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 112


>gi|266625348|ref|ZP_06118283.1| DNA-binding response regulator [Clostridium hathewayi DSM 13479]
 gi|288862753|gb|EFC95051.1| DNA-binding response regulator [Clostridium hathewayi DSM 13479]
          Length = 335

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 61/116 (52%), Gaps = 6/116 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++LLVD S  + ++   +    G+ +F A ++ EAR   + +  P+ +V+D  +     L
Sbjct: 208 TVLLVDDSPELLRLNERVLRPEGYSLFCAGTLGEARAVLD-QTAPDAIVLDIDLPDGNGL 266

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +F    R++    ++ V +L    D + +  GA +G+ +FL KP+  E L+ A+ E
Sbjct: 267 DF---CRELRAAANIPVVFLTAHSDAQTVQKGAESGSCAFLTKPYQMEELQKAVAE 319


>gi|222150004|ref|YP_002550961.1| chemotaxis receiver protein [Agrobacterium vitis S4]
 gi|221736986|gb|ACM37949.1| chemotaxis receiver protein [Agrobacterium vitis S4]
          Length = 121

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 33/106 (31%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L VD S  +R +     N+ GF   +A    E  E  E E  P+ +V D +M  +   
Sbjct: 4   KVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEVLE-ECNPDVIVTDINMPRLDGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            FI  VR+      V +  L  E D EK     +AGA  +++KPF+
Sbjct: 63  GFIEGVRRNEKYRAVPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|307730521|ref|YP_003907745.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. CCGE1003]
 gi|307585056|gb|ADN58454.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. CCGE1003]
          Length = 460

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  AT++ EAR    +  +P+ +++D ++     L+ + H+   P G  + V  +  
Sbjct: 25  GFSVDTATTLAEARAALTR-FIPDVVLVDLNLPDGSGLDLLQHLPAHPPGGALPVIVMTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQTLRA 133


>gi|91792702|ref|YP_562353.1| response regulator receiver [Shewanella denitrificans OS217]
 gi|91714704|gb|ABE54630.1| response regulator receiver protein [Shewanella denitrificans
           OS217]
          Length = 127

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    ++    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQRGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++IA A+AG N +++KPF   TL+
Sbjct: 65  IDLLKAIRADDSLKHLPVLMVTAEAKREQIIAAAQAGVNGYVVKPFTAATLK 116


>gi|238755029|ref|ZP_04616377.1| hypothetical protein yruck0001_21080 [Yersinia ruckeri ATCC 29473]
 gi|238706733|gb|EEP99102.1| hypothetical protein yruck0001_21080 [Yersinia ruckeri ATCC 29473]
          Length = 428

 Score = 43.5 bits (101), Expect = 0.009,   Method: Composition-based stats.
 Identities = 36/113 (31%), Positives = 59/113 (52%), Gaps = 7/113 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD S   R +  +L  ++ F VFEA +  +A    +   + N ++ D  M  +  L
Sbjct: 12  SILVVDDSASYRFLLVNLLKNWQFTVFEAENGQDALMILDNNSI-NMVISDWEMPVMDGL 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEV--DFEKMIAGARAGANSFLLKPFNRETLR 111
           +    +R+     D ++Y +L+ V    E +IAG  AGA+ FL KP N+  LR
Sbjct: 71  KLCTTIRKHY--ADRYIYLVLITVRQSVEDLIAGLDAGADDFLSKPINQSELR 121


>gi|315638818|ref|ZP_07893990.1| chemotaxis response regulator CheY [Campylobacter upsaliensis JV21]
 gi|315481036|gb|EFU71668.1| chemotaxis response regulator CheY [Campylobacter upsaliensis JV21]
          Length = 129

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G   V EA    EA +  EK      L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLTRLGHNDVLEAEHGVEAWDLLEKNDDVKVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           L+ +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+  + ++
Sbjct: 62  LDLVKKVRAEKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEDV 119


>gi|86135169|ref|ZP_01053751.1| two-component system response regulator [Polaribacter sp. MED152]
 gi|85822032|gb|EAQ43179.1| two-component system response regulator [Polaribacter sp. MED152]
          Length = 229

 Score = 43.5 bits (101), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 68/128 (53%), Gaps = 6/128 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           LL+ D   I+  VG +L N+ G+ VF A +  EA +  +K   P+ +++D     M+G+ 
Sbjct: 9   LLVDDEPDILEIVGYNLRNE-GYQVFTAENGQEAIKSAKKNT-PHLILLDIMMPEMDGI- 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R++    +V + +L    +    +AG  AGA+ ++ KP   + L   ++ L + 
Sbjct: 66  EACEKIRKIKNLDNVIIAFLTARGEDYSQVAGFEAGADDYITKPIKPKVLVSKIKSLLRR 125

Query: 121 QKSKDENQ 128
            KS++E++
Sbjct: 126 LKSEEESE 133


>gi|147676478|ref|YP_001210693.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146272575|dbj|BAF58324.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 233

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 52/102 (50%), Gaps = 2/102 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD   +VR++ RH     GF V        A +   + L P+ +++D  + G L+ I
Sbjct: 6   ILVVDDEEVVRELVRHCLVREGFKVITTADAYGAFDLIAR-LKPDLIILDILLPG-LDGI 63

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
              R++ +  +V V +L  + D   +I G   G + +++KPF
Sbjct: 64  EFCRKLRMKNEVPVIFLSAKGDSSDIILGLGVGGDDYIVKPF 105


>gi|1754642|dbj|BAA14000.1| adenylate cyclase [Anabaena sp.]
          Length = 1155

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD +  +R     +    G+ V+ A +  E     + EL PN +V D  M  V  L
Sbjct: 798 SILVVDDNPDLRTYVSDILRRSGYQVYTARNGYEGFSKVQ-ELTPNLIVTDLMMPLVTGL 856

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E I  VR         +  L  +VD E  I     GA+++L KPFN   L   +R L  +
Sbjct: 857 EMIRMVRNDEKVKGTPIILLTAKVDEETRIESTEHGADAYLAKPFNDRELLAEVRNLLAL 916

Query: 121 QKSK 124
           ++++
Sbjct: 917 KENE 920


>gi|254284229|ref|ZP_04959197.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase [gamma proteobacterium
           NOR51-B]
 gi|219680432|gb|EED36781.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase [gamma proteobacterium
           NOR51-B]
          Length = 606

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 57/125 (45%), Gaps = 3/125 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+ D   +VR + R      G  V +A    +A E  + EL P+ + +D  M G   LE
Sbjct: 13  ILVCDDDLMVRVLARECLEAAGMDVIDAEDGIQALEAFQSEL-PDLVFLDVEMPGKTGLE 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
             A +R +P G +V V       D + +  G  AGA  +  KP N   L   +R + +  
Sbjct: 72  VCAEIRALPQGMNVPVLIATGAEDADSIDRGFNAGATQYKTKPINWSLLSRDIRYMLRAA 131

Query: 122 KSKDE 126
           ++ +E
Sbjct: 132 EAFNE 136


>gi|17232455|ref|NP_489003.1| adenylate cyclase [Nostoc sp. PCC 7120]
 gi|17134101|dbj|BAB76662.1| adenylate cyclase carring two-component hybrid sensor and regulator
           domains [Nostoc sp. PCC 7120]
          Length = 1155

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 37/124 (29%), Positives = 58/124 (46%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD +  +R     +    G+ V+ A +  E     + EL PN +V D  M  V  L
Sbjct: 798 SILVVDDNPDLRTYVSDILRRSGYQVYTARNGYEGFSKVQ-ELTPNLIVTDLMMPLVTGL 856

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E I  VR         +  L  +VD E  I     GA+++L KPFN   L   +R L  +
Sbjct: 857 EMIRMVRNDEKVKGTPIILLTAKVDEETRIESTEHGADAYLAKPFNDRELLAEVRNLLAL 916

Query: 121 QKSK 124
           ++++
Sbjct: 917 KENE 920


>gi|329934250|ref|ZP_08284329.1| PAS/PAC sensor hybrid histidine kinase precursor [Streptomyces
           griseoaurantiacus M045]
 gi|329305846|gb|EGG49701.1| PAS/PAC sensor hybrid histidine kinase precursor [Streptomyces
           griseoaurantiacus M045]
          Length = 1389

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 35/126 (27%), Positives = 57/126 (45%), Gaps = 3/126 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+ D +  +R+    L    G+ V E T   EA     +   P+ +V D  M  +  LE
Sbjct: 642 VLVADDNADMREYLARLLTAAGYQVTEVTDGVEALAAARRRT-PDLVVSDVMMPRLDGLE 700

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            ++ +R  P    V V  L      E  I G RAGA+ +L+KPF    L   +R   ++ 
Sbjct: 701 LVSRLRADPRTASVPVVLLSARAGQEASIEGLRAGADDYLVKPFAAAELLARVRANVELA 760

Query: 122 KSKDEN 127
           + +D +
Sbjct: 761 RLRDHH 766


>gi|296103644|ref|YP_003613790.1| Chemotaxis protein CheY [Enterobacter cloacae subsp. cloacae ATCC
           13047]
 gi|295058103|gb|ADF62841.1| Chemotaxis protein CheY [Enterobacter cloacae subsp. cloacae ATCC
           13047]
          Length = 128

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  D G+  + EA    +A          +++V D +M  +  LE
Sbjct: 9   LVVDDFATMRRIVRNLLQDLGYKHIDEAEDGQDALNKLRAGGF-DFVVSDWNMPNIDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R       + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 68  LLKTIRSDATMAKLPVLMVTAEAKKENIIAAAQAGANGYIVKPFTAATL 116


>gi|209517216|ref|ZP_03266061.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. H160]
 gi|209502352|gb|EEA02363.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. H160]
          Length = 460

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  AT++ EAR    +  +P+ +++D ++     L+ + H+   P G  + V  +  
Sbjct: 25  GFSVDTATTLAEARAALTR-FIPDVVLVDLNLPDGSGLDLLQHLPAHPPGGALPVIVMTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQALRA 133


>gi|85712288|ref|ZP_01043339.1| Chemotaxis protein CheY [Idiomarina baltica OS145]
 gi|85693915|gb|EAQ31862.1| Chemotaxis protein CheY [Idiomarina baltica OS145]
          Length = 127

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 60/118 (50%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T++ EA +      LP       +++V D +
Sbjct: 6   KILVVDDFSTMRRIIKNLLRDLGF-----TNIQEADD--GNTALPMLQQGDFDFVVTDWN 58

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  +R+      + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 59  MPGMQGIDLLKEIRKDDDLAHLPVLMVTAEAKREQIIQAAQAGVNGYIVKPFTAVTLK 116


>gi|116623704|ref|YP_825860.1| response regulator receiver modulated diguanylate cyclase
           [Candidatus Solibacter usitatus Ellin6076]
 gi|116226866|gb|ABJ85575.1| response regulator receiver modulated diguanylate cyclase
           [Candidatus Solibacter usitatus Ellin6076]
          Length = 325

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 26/100 (26%), Positives = 44/100 (44%), Gaps = 2/100 (2%)

Query: 18  RHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDV 75
           + +   +G+    A    EA    E +  P   ++D  M G+  +E    +R       V
Sbjct: 37  KTMLTRWGYEAVIARDGTEAWNILEGDGAPRLAILDWMMPGMDGVEICRRIRSANREPYV 96

Query: 76  FVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           ++  L    + + +I G  AGA+ +L KPFN   LR  +R
Sbjct: 97  YILLLTARTESQDLIEGMDAGADDYLTKPFNAHELRVRIR 136


>gi|183984499|ref|YP_001852790.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium marinum M]
 gi|183177825|gb|ACC42935.1| mycobacterial persistence regulator MprA [Mycobacterium marinum M]
          Length = 232

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 5/125 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA E    +  P+ LV+D  M  +  LE
Sbjct: 5   ILVVDDDRAVRESLRRSLSFNGYTVELAHDGVEALEMIASDR-PDALVLDVMMPRLDGLE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 64  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 121

Query: 122 KSKDE 126
           K +D+
Sbjct: 122 KPEDD 126


>gi|95929326|ref|ZP_01312069.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Desulfuromonas acetoxidans DSM 684]
 gi|95134442|gb|EAT16098.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Desulfuromonas acetoxidans DSM 684]
          Length = 449

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 1/132 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           +S+LLVD    +R+V      + G+ V  A S  EA     +   P  +V D  MEG+  
Sbjct: 3   ESVLLVDDDASMRRVIEFTLQEAGYQVLTAASGEEALPLF-RHHQPALVVTDVRMEGMSG 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           +    + +       V  +      E+ +   ++GA  +L KPF+ E LR A+    + +
Sbjct: 62  YQVLEKVLAESPATLVIIITAYSTVEQAVGAMKSGAYDYLTKPFSGEQLRLAVARAFEYR 121

Query: 122 KSKDENQFLDAI 133
             + EN  L  +
Sbjct: 122 ALRRENTQLHEV 133


>gi|238790324|ref|ZP_04634097.1| hypothetical protein yfred0001_230 [Yersinia frederiksenii ATCC
           33641]
 gi|238721588|gb|EEQ13255.1| hypothetical protein yfred0001_230 [Yersinia frederiksenii ATCC
           33641]
          Length = 384

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 59/113 (52%), Gaps = 7/113 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD S   R +  +L  ++ F VFEA +  +A    +   + N ++ D  M  +  L
Sbjct: 12  SILVVDDSASYRFLLVNLLKNWQFTVFEAENGQDALVILDNNAI-NMVISDWEMPVMDGL 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEV--DFEKMIAGARAGANSFLLKPFNRETLR 111
           +    +R+    +D ++Y +L+ V    E +I G  AGA+ FL KP N+  LR
Sbjct: 71  KLCTTIRKHY--SDRYIYLVLITVRQSVEDLITGLDAGADDFLSKPINQSELR 121


>gi|332140600|ref|YP_004426338.1| chemotaxis protein CheY [Alteromonas macleodii str. 'Deep ecotype']
 gi|327550622|gb|AEA97340.1| chemotaxis protein CheY [Alteromonas macleodii str. 'Deep ecotype']
          Length = 127

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF  + EA     A    ++    +++V D +M G+  
Sbjct: 6   KILVVDDFSTMRRIIKNLLKDLGFSNIQEADDGSTALPMLQQGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E+++A A+AG N +++KPF   TL+
Sbjct: 65  IDLLRAIRADDKLKHLPVLMVTAEAKKEQIVAAAQAGVNGYVVKPFTAATLK 116


>gi|75676724|ref|YP_319145.1| response regulator receiver [Nitrobacter winogradskyi Nb-255]
 gi|74421594|gb|ABA05793.1| response regulator receiver [Nitrobacter winogradskyi Nb-255]
          Length = 131

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           S+L+VD  + + ++ R+L    GF   +  S   A     +      ++ D +ME +   
Sbjct: 8   SILVVDDYNTMIRIIRNLLKQLGFENIDDASDGSAALNKMRTKKYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR  P L T  F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 68  DLLREVRADPNLATTPFIM-VTAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|217977626|ref|YP_002361773.1| response regulator receiver protein [Methylocella silvestris BL2]
 gi|217503002|gb|ACK50411.1| response regulator receiver protein [Methylocella silvestris BL2]
          Length = 121

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 53/117 (45%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L VD S  +R +     +D GF V +A       E    E  P+ +V D +M  +   
Sbjct: 4   TILTVDDSRTMRDMLMLALSDAGFRVVQAEDGMHGLEVLAGEQ-PDVIVTDINMPRLDGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            FI  VR       V +  L  E D EK     RAGA  +++KPF+   L  A+R +
Sbjct: 63  GFIEGVRSDSRHRAVPILVLTTESDAEKKERARRAGATGWIVKPFDPVKLVAAVRRV 119


>gi|307634951|gb|ADI84765.2| response receiver sensor diguanylate cyclase/phosphodiesterase, PAS
           domain-containing [Geobacter sulfurreducens KN400]
          Length = 708

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 60/126 (47%), Gaps = 3/126 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           +++++D   +VR + R      GF V EA     A E   + L+P+ +++D  M G+  F
Sbjct: 12  TVMIIDDDELVRVLARRAVEQGGFAVIEAGDGVTAIEMFSR-LVPDIILLDVVMPGMGGF 70

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R++P G  V +  +    D   +     AGA+ FL KP +   L   +R L + 
Sbjct: 71  DVCRRIRRLPGGDRVQILVMTSLDDTGAIDEAYEAGASDFLAKPIDWVLLPRRIRYLLRA 130

Query: 121 QKSKDE 126
           + + DE
Sbjct: 131 KLAFDE 136


>gi|94971681|ref|YP_593729.1| response regulator receiver protein [Candidatus Koribacter
           versatilis Ellin345]
 gi|94553731|gb|ABF43655.1| response regulator receiver protein [Candidatus Koribacter
           versatilis Ellin345]
          Length = 125

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 57/123 (46%), Gaps = 5/123 (4%)

Query: 7   VDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIA 64
           +D +HI     R +  D G+ V EA S  EA EF +KE  P+ +++D +M G+   E   
Sbjct: 1   MDDNHIHAYSMRKMLEDQGYRVLEAHSGEEALEFTDKE-TPDLVLLDVNMPGIDGFEVCR 59

Query: 65  HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSK 124
            VR+        V++     +          GA +FL  P +R+ L   +  L  + ++K
Sbjct: 60  RVREQHKFLPAIVFHTATSANEASHRRAMEMGATAFLTYPVSRDQLLLVI--LTSIARAK 117

Query: 125 DEN 127
           + N
Sbjct: 118 NAN 120


>gi|320155682|ref|YP_004188061.1| chemotaxis regulator [Vibrio vulnificus MO6-24/O]
 gi|326423910|ref|NP_760826.2| chemotaxis regulator [Vibrio vulnificus CMCP6]
 gi|319930994|gb|ADV85858.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio vulnificus
           MO6-24/O]
 gi|319999287|gb|AAO10353.2| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio vulnificus
           CMCP6]
          Length = 126

 Score = 43.5 bits (101), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKNIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|148656813|ref|YP_001277018.1| putative PAS/PAC sensor protein [Roseiflexus sp. RS-1]
 gi|148568923|gb|ABQ91068.1| putative PAS/PAC sensor protein [Roseiflexus sp. RS-1]
          Length = 969

 Score = 43.5 bits (101), Expect = 0.010,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 66/123 (53%), Gaps = 3/123 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR++ + L ++ G+ V  AT+  EA  + E  + P+ +++D ++ GV   +
Sbjct: 7   ILVVDDDASVRRMLQILLSNAGYRVSLATTGEEALAYLEL-VTPDLVLLDVALPGVSGRQ 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +  ++  P    + V  +    D E  +A   AGA+ FL+KP +   L   +R + ++Q
Sbjct: 66  VMERIKSDPDRPFIPVILVTGHSDPEAKVAALDAGADDFLVKPVDLAELLARVRAMLRLQ 125

Query: 122 KSK 124
           +S+
Sbjct: 126 RSQ 128


>gi|209886343|ref|YP_002290200.1| two-component response regulator [Oligotropha carboxidovorans OM5]
 gi|209874539|gb|ACI94335.1| two-component response regulator [Oligotropha carboxidovorans OM5]
          Length = 128

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+VD  + + ++ R+L    GF   +  S   A     +      ++ D +ME +   E
Sbjct: 7   VLVVDDYNTMIRIIRNLLKQLGFENIDDASDGSAALAKMRGKKYGLVISDWNMEPMTGYE 66

Query: 62  FIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +  VR  P L T  F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 67  LLKEVRSDPNLATTPFIM-ITAESKTENVIAAKKAGVNNYIVKPFNAATLK 116


>gi|113476325|ref|YP_722386.1| adenylate/guanylate cyclase [Trichodesmium erythraeum IMS101]
 gi|110167373|gb|ABG51913.1| adenylate/guanylate cyclase [Trichodesmium erythraeum IMS101]
          Length = 1119

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 29/110 (26%), Positives = 58/110 (52%), Gaps = 2/110 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD   +  +V R+      + + EA +  EA E  EK L+P+ +++D  M  +   
Sbjct: 717 TVLIVDDEPVNLQVIRNNLALQNYAITEANNGIEALEMIEKGLMPDLILLDVMMPHMTGY 776

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E    +R+  L  ++ +  L  +     ++ G  +GAN +L+KPF+++ L
Sbjct: 777 EVAKKLREKYLHIELPIIMLTAKPLVSDLVEGFVSGANDYLIKPFSKQEL 826


>gi|170695428|ref|ZP_02886573.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia graminis C4D1M]
 gi|170139619|gb|EDT07802.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia graminis C4D1M]
          Length = 460

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 31/108 (28%), Positives = 52/108 (48%), Gaps = 3/108 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  AT++ EAR    +  +P+ +++D ++     L+ + H+   P G  + V  +  
Sbjct: 25  GFSVDTATTIAEARAALTR-FIPDVVLVDLNLPDGSGLDLLQHLPAHPPGGALPVIVMTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL 130
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQTL 131


>gi|283783193|ref|YP_003373947.1| response regulator receiver domain protein [Gardnerella vaginalis
           409-05]
 gi|298253961|ref|ZP_06977548.1| response regulator (CheY receiver/winged-helix DNA-binding)
           [Gardnerella vaginalis 5-1]
 gi|283441704|gb|ADB14170.1| response regulator receiver domain protein [Gardnerella vaginalis
           409-05]
 gi|297532104|gb|EFH71079.1| response regulator (CheY receiver/winged-helix DNA-binding)
           [Gardnerella vaginalis 5-1]
          Length = 246

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 1/128 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+++VD    +R++     +  GF V  A S  EA E  E+ + PN +V+D  +  +  F
Sbjct: 8   SIVVVDDEPSIRELLVASLHFAGFEVETAASGSEAVEVIER-VNPNLIVMDVMLPDIDGF 66

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V +L    D +  I G   G + ++ KPF+ E +   +R + +  +
Sbjct: 67  TVTRRIRQNGIKVPVLFLTARDDTQDKIMGLTVGGDDYVTKPFSLEEVVARIRAILRRTQ 126

Query: 123 SKDENQFL 130
             DE   +
Sbjct: 127 EPDEETHI 134


>gi|295677170|ref|YP_003605694.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. CCGE1002]
 gi|295437013|gb|ADG16183.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. CCGE1002]
          Length = 481

 Score = 43.5 bits (101), Expect = 0.011,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  AT++ EAR    +  +P+ +++D ++     L+ + H+   P G  + V  +  
Sbjct: 46  GFSVDTATTLAEARGALTR-FIPDVVLVDLNLPDGSGLDLLQHLPAHPPGGALPVIVMTG 104

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 105 NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQALRA 154


>gi|116253775|ref|YP_769613.1| chemotaxis two-component response regulator [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|115258423|emb|CAK09526.1| CheY3-response regulator of secondary chemotaxis operon [Rhizobium
           leguminosarum bv. viciae 3841]
          Length = 122

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 51/111 (45%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R   +    + G+ V EA +  E     +     + +V D     M+G 
Sbjct: 4   NILTVDDSASIRLTTKVTLTNAGYSVTEAVNGAEGLATAKGSSF-DLIVTDLNMPVMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R++P    V + +L  E D +       AGA  +L KPF+ E+L
Sbjct: 62  LTMIEELRKLPAQAGVPIIFLTTESDADLKARAKAAGATGWLTKPFDPESL 112


>gi|108805465|ref|YP_645402.1| response regulator receiver modulated serine phosphatase
           [Rubrobacter xylanophilus DSM 9941]
 gi|108766708|gb|ABG05590.1| response regulator receiver modulated serine phosphatase
           [Rubrobacter xylanophilus DSM 9941]
          Length = 389

 Score = 43.5 bits (101), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 35/108 (32%), Positives = 52/108 (48%), Gaps = 9/108 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD   +  ++ +      G+ VF A    EA E    +L P+ L++D SM GV  L+
Sbjct: 18  LLVVDDDPVSNRLMQRRLERLGYEVFSAADGREALESL-PDLRPDVLLLDVSMPGVGGLD 76

Query: 62  FIAHVRQMPLGTDVF--VYYLLMEVDFEKMIAGARAGANSFLLKPFNR 107
            + HVR+  L   V     Y   EV  E +    R GA+ +L KP  +
Sbjct: 77  VLEHVRESGLDAAVIMMTAYGTEEVAVESL----RRGADDYLRKPLQQ 120


>gi|119717819|ref|YP_924784.1| response regulator receiver [Nocardioides sp. JS614]
 gi|119538480|gb|ABL83097.1| response regulator receiver [Nocardioides sp. JS614]
          Length = 131

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 6/111 (5%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREF--CEKELLPNYLVIDESM---EGV 59
           L+VD S  +R++   +  D GF V EA    EA +    +   LP    +D +M   +G 
Sbjct: 4   LIVDDSRAMRRIVGRILVDAGFEVLEAGDGQEALDVLAAQDGNLPVLACVDWNMPVMDG- 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L FI  VR+      + +  +  E + ++++    AGA+ +L+KPF  + L
Sbjct: 63  LTFITEVRKQVEWRAITLMMVTTESEQDRIVRALAAGAHEYLIKPFTGDAL 113


>gi|309778963|ref|ZP_07673733.1| chemotaxis protein CheY [Ralstonia sp. 5_7_47FAA]
 gi|308922310|gb|EFP67937.1| chemotaxis protein CheY [Ralstonia sp. 5_7_47FAA]
          Length = 133

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L+VD    +R++ R+L  + GF   +      A     KE   ++++ D +M  +  L+ 
Sbjct: 9   LVVDDFPTMRRIVRNLLKELGFSNVDEAEDGAAGLAKVKEGRFDFVISDWNMPNMDGLQM 68

Query: 63  IAHVR--QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R    P+ + + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 69  LQSIRGDANPVISKMPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 118


>gi|304313291|ref|YP_003812889.1| Type IV pilus response regulator, CheY analog, possibly involved in
           chemotaxis [gamma proteobacterium HdN1]
 gi|301799024|emb|CBL47267.1| Type IV pilus response regulator, CheY analog, possibly involved in
           chemotaxis [gamma proteobacterium HdN1]
          Length = 126

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 36/125 (28%), Positives = 56/125 (44%), Gaps = 11/125 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD S         +    GF V +A +  +    C KE  P+ +++D  M G+ 
Sbjct: 1   MPRVLIVDDSPTETYKFEEILKKNGFGVLKADNGADGVALCRKEK-PDLVLMDVVMPGLN 59

Query: 61  EFIAHVRQMPLGTD------VFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            F A  RQ+  G D      V V     E D    + G R GA+++L KP + + L   +
Sbjct: 60  GFQA-TRQLAKGEDTKHIPVVIVTTKDQETD---KVWGQRQGASAYLTKPIDEKVLMDTI 115

Query: 115 RELPQ 119
           R+  Q
Sbjct: 116 RQTLQ 120


>gi|301059536|ref|ZP_07200448.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
 gi|300446301|gb|EFK10154.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
          Length = 346

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 32/114 (28%), Positives = 52/114 (45%), Gaps = 3/114 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   + RK    L    G     A    E  E  +KE     ++ D  M G+  LE
Sbjct: 3   ILIVDDELVSRKKMDLLVRSLGHETVVAEDGLEGWEAWKKERT-RMVITDWMMPGMSGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
             A +R+      +++  +  + D E ++ G  AGA+ F+ KPF +E L   +R
Sbjct: 62  LCAKIREAEGSQYIYLIMVTSKEDVEDLVRGMDAGADDFITKPFIKEELAVRIR 115


>gi|253998531|ref|YP_003050594.1| response regulator receiver protein [Methylovorus sp. SIP3-4]
 gi|313200609|ref|YP_004039267.1| response regulator receiver protein [Methylovorus sp. MP688]
 gi|253985210|gb|ACT50067.1| response regulator receiver protein [Methylovorus sp. SIP3-4]
 gi|312439925|gb|ADQ84031.1| response regulator receiver protein [Methylovorus sp. MP688]
          Length = 132

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 57/113 (50%), Gaps = 12/113 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFC---EKELLPNY--LVIDESMEGV 59
           L+VD    +R++ R+L  + G+     T+V EA +      K    N+  +V D +M  +
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGY-----TNVDEAEDGVMALSKLRGGNFEFVVSDWNMPNM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             L  +  +R  P  + + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 64  DGLTMLKEIRADPTLSSLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|254492400|ref|ZP_05105572.1| response regulator receiver domain protein [Methylophaga
           thiooxidans DMS010]
 gi|224462292|gb|EEF78569.1| response regulator receiver domain protein [Methylophaga
           thiooxydans DMS010]
          Length = 327

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 27/107 (25%), Positives = 50/107 (46%), Gaps = 4/107 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L+VD + I   + + +    G+     +S  EARE   ++  P+ +++D     M+G+ 
Sbjct: 3   VLIVDDAEIDTLLCQKIVESLGYTPITVSSAVEARELLNQDGAPDIIILDWMMPEMDGI- 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNR 107
           +    +R+  L  + FV  +    D         AGA+ F+ KP NR
Sbjct: 62  DLCKIIRRSRLIIEPFVLIMTANSDRHAEAEALNAGADDFISKPVNR 108


>gi|297243563|ref|ZP_06927494.1| response regulator (CheY receiver/winged-helix DNA-binding)
           [Gardnerella vaginalis AMD]
 gi|296888314|gb|EFH27055.1| response regulator (CheY receiver/winged-helix DNA-binding)
           [Gardnerella vaginalis AMD]
          Length = 246

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 59/128 (46%), Gaps = 1/128 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+++VD    +R++     +  GF V  A S  EA E  E+ + PN +V+D  +  +  F
Sbjct: 8   SIVVVDDEPSIRELLVASLHFAGFEVETAASGSEAVEVIER-VNPNLIVMDVMLPDIDGF 66

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V +L    D +  I G   G + ++ KPF+ E +   +R + +  +
Sbjct: 67  TVTRRIRQNGIKVPVLFLTARDDTQDKIMGLTVGGDDYVTKPFSLEEVVARIRAILRRTQ 126

Query: 123 SKDENQFL 130
             DE   +
Sbjct: 127 EPDEETHI 134


>gi|255323420|ref|ZP_05364551.1| Chemotaxis protein CheY homolog [Campylobacter showae RM3277]
 gi|255299457|gb|EET78743.1| Chemotaxis protein CheY homolog [Campylobacter showae RM3277]
          Length = 121

 Score = 43.1 bits (100), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD S  +R++ ++     G   + EA    EA +   +    N L+ D +M  +  
Sbjct: 2   KILVVDDSSTMRRIIKNTLQRLGHQEILEAEHGAEAWQILGQHSDINVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LELVKKVRAEAKYVDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|134114043|ref|XP_774269.1| hypothetical protein CNBG2500 [Cryptococcus neoformans var.
            neoformans B-3501A]
 gi|50256904|gb|EAL19622.1| hypothetical protein CNBG2500 [Cryptococcus neoformans var.
            neoformans B-3501A]
          Length = 1821

 Score = 43.1 bits (100), Expect = 0.011,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 5/126 (3%)

Query: 2    DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            D ++LV+ S   R+  + +F+ +   V EA    EA E C K + PN ++ D  M  +  
Sbjct: 1068 DVIMLVEDSSDTRRYMKSIFSQY-CQVVEARDGQEALELCHKSI-PNLIISDVMMPRLNG 1125

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRELP 118
             EF+A +++      V V  L      E  + G  AGA  +L KPF+ RE +  A  +L 
Sbjct: 1126 FEFLAALKESKDLKMVPVIMLTARGADESKVDGIMAGAEDYLAKPFSAREIVARAHMQLQ 1185

Query: 119  QMQKSK 124
              +K +
Sbjct: 1186 LGKKRR 1191


>gi|307730147|ref|YP_003907371.1| response regulator receiver protein [Burkholderia sp. CCGE1003]
 gi|307584682|gb|ADN58080.1| response regulator receiver protein [Burkholderia sp. CCGE1003]
          Length = 122

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 9/120 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPNYLVIDE----SME 57
           ++++VD S  VR+V        G+ V E    C+ ++   K +    +L+I +    +M+
Sbjct: 4   TIMIVDDSASVRQVVGIALRGAGYQVIEG---CDGKDALAKLQGQKVHLMISDLNMPNMD 60

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+  FI  V+QMP      +  L  E    K   G +AGA ++++KPF    L  A+ +L
Sbjct: 61  GI-AFIKAVKQMPAYRFTPIVMLTTESQDAKKREGQQAGAKAWVVKPFQPPQLLAAVEKL 119


>gi|262404418|ref|ZP_06080973.1| chemotaxis regulator CheY [Vibrio sp. RC586]
 gi|262349450|gb|EEY98588.1| chemotaxis regulator CheY [Vibrio sp. RC586]
          Length = 126

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKNIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|37680647|ref|NP_935256.1| chemotaxis protein CheY [Vibrio vulnificus YJ016]
 gi|37199395|dbj|BAC95227.1| chemotaxis protein CheY [Vibrio vulnificus YJ016]
          Length = 130

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 10  KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 68

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 69  IDLLKNIRADAELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 120


>gi|125987882|dbj|BAF47080.1| CnHHK4 [Cryptococcus neoformans var. neoformans]
          Length = 1838

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 5/126 (3%)

Query: 2    DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            D ++LV+ S   R+  + +F+ +   V EA    EA E C K + PN ++ D  M  +  
Sbjct: 1082 DVIMLVEDSSDTRRYMKSIFSQY-CQVVEARDGQEALELCHKSI-PNLIISDVMMPRLNG 1139

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRELP 118
             EF+A +++      V V  L      E  + G  AGA  +L KPF+ RE +  A  +L 
Sbjct: 1140 FEFLAALKESKDLKMVPVIMLTARGADESKVDGIMAGAEDYLAKPFSAREIVARAHMQLQ 1199

Query: 119  QMQKSK 124
              +K +
Sbjct: 1200 LGKKRR 1205


>gi|239995146|ref|ZP_04715670.1| chemotaxis protein CheY [Alteromonas macleodii ATCC 27126]
          Length = 123

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF  + EA     A    ++    +++V D +M G+  
Sbjct: 2   KILVVDDFSTMRRIIKNLLKDLGFSNIQEADDGSTALPMLQQGDF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E+++A A+AG N +++KPF   TL+
Sbjct: 61  IDLLRAIRADDKLKHLPVLMVTAEAKKEQIVAAAQAGVNGYVVKPFTAATLK 112


>gi|258404995|ref|YP_003197737.1| multi-sensor signal transduction histidine kinase [Desulfohalobium
           retbaense DSM 5692]
 gi|257797222|gb|ACV68159.1| multi-sensor signal transduction histidine kinase [Desulfohalobium
           retbaense DSM 5692]
          Length = 650

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 54/115 (46%), Gaps = 5/115 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           ++LLLVD    +RKV      D G+ V  A +  EA E   +E  P  ++ D  M G+  
Sbjct: 3   NALLLVDDEEGIRKVLGITLADSGYTVHTAANGNEALEVW-REHRPGIVLTDIKMPGMDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
           LE +  ++     T+V +  +    D +  I   R  A  F+ KP N E L F++
Sbjct: 62  LELLQALKAEDPETEVIM--ITGHGDMDSAIESLRNDAADFITKPINDEVLEFSL 114


>gi|58269590|ref|XP_571951.1| protein-histidine kinase [Cryptococcus neoformans var. neoformans
            JEC21]
 gi|57228187|gb|AAW44644.1| protein-histidine kinase, putative [Cryptococcus neoformans var.
            neoformans JEC21]
          Length = 1816

 Score = 43.1 bits (100), Expect = 0.012,   Method: Composition-based stats.
 Identities = 38/126 (30%), Positives = 61/126 (48%), Gaps = 5/126 (3%)

Query: 2    DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            D ++LV+ S   R+  + +F+ +   V EA    EA E C K + PN ++ D  M  +  
Sbjct: 1071 DVIMLVEDSSDTRRYMKSIFSQY-CQVVEARDGQEALELCHKSI-PNLIISDVMMPRLNG 1128

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRELP 118
             EF+A +++      V V  L      E  + G  AGA  +L KPF+ RE +  A  +L 
Sbjct: 1129 FEFLAALKESKDLKMVPVIMLTARGADESKVDGIMAGAEDYLAKPFSAREIVARAHMQLQ 1188

Query: 119  QMQKSK 124
              +K +
Sbjct: 1189 LGKKRR 1194


>gi|241206253|ref|YP_002977349.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|240860143|gb|ACS57810.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 122

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 50/110 (45%), Gaps = 5/110 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L VD S  +R   +    + G+ V EA +  E     +     + +V D     M+G L
Sbjct: 5   ILTVDDSASIRLTTKVTLTNAGYSVTEAVNGAEGLATAKGSSF-DLIVTDLNMPVMDG-L 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             I  +R++P    V + +L  E D +       AGA  +L KPF+ E+L
Sbjct: 63  TMIEELRKLPAQAGVPIIFLTTESDADLKARAKAAGATGWLTKPFDPESL 112


>gi|119897794|ref|YP_933007.1| putative two-component response regulator [Azoarcus sp. BH72]
 gi|119670207|emb|CAL94120.1| putative two-component response regulator [Azoarcus sp. BH72]
          Length = 211

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 37/121 (30%), Positives = 58/121 (47%), Gaps = 7/121 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVF--EATSVCEAREFCEKELLPNYLVIDESME- 57
           M  LLLVD   +VR+  R L    G +V   EA +  +  +   +EL P+  V+D ++  
Sbjct: 1   MIRLLLVDDHAVVRQGYRRLLEQQGNLVVAGEAATGADGLQLW-RELQPDLAVLDLALPD 59

Query: 58  -GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
            G LE +A +RQ      +  +   M  D    +   RAGA  ++ K    E L+ A+RE
Sbjct: 60  IGGLELLARIRQRDPQARLLAFS--MHRDVLWAVQAVRAGALGYVTKSSPPEVLQQAVRE 117

Query: 117 L 117
           +
Sbjct: 118 V 118


>gi|120610912|ref|YP_970590.1| response regulator receiver protein [Acidovorax citrulli AAC00-1]
 gi|120589376|gb|ABM32816.1| response regulator receiver protein [Acidovorax citrulli AAC00-1]
          Length = 140

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 55/120 (45%), Gaps = 4/120 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+VD    +R++ R    D G  + EA S  EA     +   P+ +++D  M G L
Sbjct: 13  MKTVLIVDDHAEIRRLLRMTLEDQGVALHEAAS-GEAALAMARAQRPDLVLLDLMMPGSL 71

Query: 61  ---EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              E    +R  P  +   V  L      +   AG +AGA+ F+ KPF+   L   +R L
Sbjct: 72  DGMEVCRRIRNDPDLSHTRVIILSARDGLQDRAAGMQAGASGFISKPFSPAYLAETVRRL 131


>gi|222084842|ref|YP_002543371.1| chemotaxis two-component response regulator protein [Agrobacterium
           radiobacter K84]
 gi|221722290|gb|ACM25446.1| chemotaxis two-component response regulator protein [Agrobacterium
           radiobacter K84]
          Length = 121

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L VD S  +R +     N+ GF   +A    E  E  E E  P+ +V D +M  +   
Sbjct: 4   KVLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLE-EANPDVIVTDINMPRLDGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            FI  VR+      + +  L  E D EK     +AGA  +++KPF+
Sbjct: 63  GFIEGVRRNDKYRAIPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|312623427|ref|YP_004025040.1| response regulator receiver protein [Caldicellulosiruptor
           kronotskyensis 2002]
 gi|312203894|gb|ADQ47221.1| response regulator receiver protein [Caldicellulosiruptor
           kronotskyensis 2002]
          Length = 128

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 61/125 (48%), Gaps = 6/125 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           + +VD +  +R++ + +F   G  V  E +S  +  E  E +L P+ + +D +M  +   
Sbjct: 3   VCIVDDAQFIRQILKEIFTSLGHHVIAEFSSASQLIEEIE-DLKPDIITLDITMPDIDGL 61

Query: 63  IAH--VRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            A   ++ +   T + +   + + D EK     R GA  F+ KPF++  +   + ++ Q 
Sbjct: 62  TATRIIKNILPNTYIIIISAISQPDIEK--EAKRCGAFEFIKKPFSKLAIEHVLSQIKQE 119

Query: 121 QKSKD 125
           Q SK+
Sbjct: 120 QSSKN 124


>gi|229176012|ref|ZP_04303507.1| Sporulation initiation phosphotransferase F [Bacillus cereus MM3]
 gi|228607444|gb|EEK64771.1| Sporulation initiation phosphotransferase F [Bacillus cereus MM3]
          Length = 122

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 62/117 (52%), Gaps = 7/117 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +  +A +  +K+  P+ +V+D  + G+  +
Sbjct: 4   KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKD-NPDLVVLDMKIPGMDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETLRFAMRE 116
           E + HV+++     V +     E+D   MI  A+  GA     KPF+ + +R A+RE
Sbjct: 63  EILKHVKEIDESIKVILMTAYGELD---MIQEAKDLGALMHFAKPFDIDEIRQAVRE 116


>gi|90406801|ref|ZP_01214993.1| chemotaxis protein CheY [Psychromonas sp. CNPT3]
 gi|90312038|gb|EAS40131.1| chemotaxis protein CheY [Psychromonas sp. CNPT3]
          Length = 123

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 58/113 (51%), Gaps = 6/113 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESM---EG 58
            +L+VD    +R++ ++L  D GF   FEA     A     K+    ++V D +M   +G
Sbjct: 2   KVLIVDDFSTMRRIIKNLLRDLGFTNTFEADDGHTALPML-KDGDFEFVVTDWNMPIMQG 60

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + + +  +R+ P    + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  I-DLLKEIRKDPKLKHLPVLMVTAEAKREQIIEAAQAGVNGYIVKPFTAGTLK 112


>gi|86608817|ref|YP_477579.1| DNA-binding response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557359|gb|ABD02316.1| DNA-binding response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 247

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +LLVD    +R+  +    D GF V  A +  +A +       P  ++ D  M G+   +
Sbjct: 20  ILLVDDEPGLREAVQAYLEDSGFEVIPAANAQQALQLLSTAQ-PQLIISDIMMPGMDGYQ 78

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+A +R++   + + V +L  +      I G RAG +++L KPF+ E L
Sbjct: 79  FLAQLRKLEPYSHLPVVFLTAKGMTADRIQGYRAGVDAYLPKPFDPEEL 127


>gi|115526665|ref|YP_783576.1| response regulator receiver protein [Rhodopseudomonas palustris
           BisA53]
 gi|115520612|gb|ABJ08596.1| response regulator receiver protein [Rhodopseudomonas palustris
           BisA53]
          Length = 121

 Score = 43.1 bits (100), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 57/122 (46%), Gaps = 9/122 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE---FCEKELLPNYLVIDESME 57
           M ++L VD S  +R++ + +    G  V EA    +  E    C+    PN ++ D +M 
Sbjct: 1   MATILTVDDSPSIRQMIKVVLAPLGHTVLEAGDGAQGLEKATACK----PNLVITDLNMP 56

Query: 58  --GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
               L+ I  +R  P  T + + +L  E +        +AGA  ++ KPF+++ L   + 
Sbjct: 57  VMNGLDLIRALRATPALTGLPIVFLTTESNDAVKQEAKKAGATGWITKPFSQDQLLAVVN 116

Query: 116 EL 117
           +L
Sbjct: 117 KL 118


>gi|253700984|ref|YP_003022173.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Geobacter sp. M21]
 gi|251775834|gb|ACT18415.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Geobacter sp. M21]
          Length = 538

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 40/135 (29%), Positives = 64/135 (47%), Gaps = 9/135 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI--DESMEGVL- 60
           LL+ D  +I+R +GR L  +    V  ATS  E  E  ++   P+  VI  D+ M G+L 
Sbjct: 19  LLVDDEENILRAIGRLLLEEDDLEVLTATSGTEGLEVLKQH--PDVAVILSDQRMPGMLG 76

Query: 61  -EFIAHVRQMPLGTDVFVYYLLMEVDF-EKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +F+   R   +  D     L    D    M A  + GA+ ++ KP++   LR A+ E  
Sbjct: 77  ADFLHQARG--IAPDAVRMVLTGYADMAATMDAINKGGASRYITKPWDERMLRLAIMEGV 134

Query: 119 QMQKSKDENQFLDAI 133
           +  +   EN+ L A+
Sbjct: 135 EQYRLLQENRRLTAL 149


>gi|110597377|ref|ZP_01385664.1| Response regulator receiver:Sigma-54 factor, interaction
           region:Helix-turn-helix, Fis-type [Chlorobium
           ferrooxidans DSM 13031]
 gi|110340921|gb|EAT59392.1| Response regulator receiver:Sigma-54 factor, interaction
           region:Helix-turn-helix, Fis-type [Chlorobium
           ferrooxidans DSM 13031]
          Length = 451

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 64/133 (48%), Gaps = 7/133 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELL-PNYLVIDESMEGV--L 60
           +L++D    +R+V  +   + G+ V  A S  E       +L  P+ ++ D  M G+  +
Sbjct: 5   ILVIDDDTSLRRVLEYNLQEEGYEVETAASGEEG--LMRLDLFGPDLVITDMKMTGMDGM 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           + +  VR+    T V +      VD    +   +AGA  ++ KPFNR++LR  +++  Q 
Sbjct: 63  KVLKSVRERSPETLVIIITAFGSVD--AAVEAMKAGAYDYITKPFNRDSLRLTVKKALQF 120

Query: 121 QKSKDENQFLDAI 133
               +EN+ L  +
Sbjct: 121 SGLSEENRRLKRV 133


>gi|158422244|ref|YP_001523536.1| CheY-like response regulator [Azorhizobium caulinodans ORS 571]
 gi|158329133|dbj|BAF86618.1| CheY-like response regulator [Azorhizobium caulinodans ORS 571]
          Length = 127

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 57/111 (51%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           +L+VD    + ++ R+L    GF  V EA+   EA     KE     ++ D +ME +   
Sbjct: 9   VLVVDDYKTMVRIIRNLLKQIGFEDVDEASDGTEALAKL-KERKYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VR     +D+    +  E   E +IA  +AG +++++KPFN +TL+
Sbjct: 68  ELLKRVRDDADLSDIPFIMVTAEAKSENVIAAKKAGVSNYIVKPFNAQTLK 118


>gi|302530364|ref|ZP_07282706.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. AA4]
 gi|302439259|gb|EFL11075.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. AA4]
          Length = 233

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 55/115 (47%), Gaps = 10/115 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMV-FEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    VR V R      GF V           +F E+  +P+ +V+D  M G+  L
Sbjct: 8   VLVVDDDETVRDVVRRYLETAGFTVDLAGDGTAALAQFAER--VPDLVVLDVMMPGLNGL 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRE--TLRFA 113
           E    +RQ    + V +  L    + E  IAG + GA+ ++ KPF+ +  TLR A
Sbjct: 66  EVCRRLRQT---SQVPIVMLTALGEEENRIAGLQLGADDYVTKPFSPKELTLRVA 117


>gi|288802116|ref|ZP_06407557.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           melaninogenica D18]
 gi|288335551|gb|EFC73985.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           melaninogenica D18]
          Length = 956

 Score = 43.1 bits (100), Expect = 0.013,   Method: Composition-based stats.
 Identities = 36/123 (29%), Positives = 63/123 (51%), Gaps = 6/123 (4%)

Query: 3   SLLLV-DSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           SLL++ D+  +   +G     D+   VF A +  E  E  + E++PN ++ D  M     
Sbjct: 700 SLLIIEDNRDVASYIGSLFTKDYS--VFYAENGKEGLEKAQ-EIVPNLIITDLMMPETDG 756

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    VR   + + + +  L  +V  E+ I G  AGA++++ KPFN + LR  + +L +
Sbjct: 757 LEVCRQVRSNTIISHIPIIILTAKVTEEERIKGIEAGADAYICKPFNSDELRTRVEKLLE 816

Query: 120 MQK 122
            +K
Sbjct: 817 GRK 819


>gi|255745189|ref|ZP_05419138.1| chemotaxis regulator CheY [Vibrio cholera CIRS 101]
 gi|262155952|ref|ZP_06029073.1| chemotaxis regulator CheY [Vibrio cholerae INDRE 91/1]
 gi|262167686|ref|ZP_06035389.1| chemotaxis regulator CheY [Vibrio cholerae RC27]
 gi|262190808|ref|ZP_06049033.1| chemotaxis regulator CheY [Vibrio cholerae CT 5369-93]
 gi|255737019|gb|EET92415.1| chemotaxis regulator CheY [Vibrio cholera CIRS 101]
 gi|262023891|gb|EEY42589.1| chemotaxis regulator CheY [Vibrio cholerae RC27]
 gi|262030263|gb|EEY48906.1| chemotaxis regulator CheY [Vibrio cholerae INDRE 91/1]
 gi|262033329|gb|EEY51842.1| chemotaxis regulator CheY [Vibrio cholerae CT 5369-93]
 gi|327484599|gb|AEA79006.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           LMA3894-4]
          Length = 126

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|269839221|ref|YP_003323913.1| response regulator receiver protein [Thermobaculum terrenum ATCC
           BAA-798]
 gi|269790951|gb|ACZ43091.1| response regulator receiver protein [Thermobaculum terrenum ATCC
           BAA-798]
          Length = 139

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   + R++     +  G+ V EA+   EA E      LP  +++D+SM  +  LE
Sbjct: 7   VLVVDDDRVTRRIVSVKLSGLGYTVDEASDGQEALEMIASGELPTLVIVDQSMPRLTGLE 66

Query: 62  FIAHVR--QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +  +R  Q      + +  L      E ++ G  AG + +++KPF+   L   +R
Sbjct: 67  LVRAIRSHQDERVAALPIIMLTSHQSEEAIVRGLEAGVDDYVIKPFSPNELAARVR 122


>gi|88799154|ref|ZP_01114734.1| phosphate regulon transcriptional regulatory protein PhoB [Reinekea
           sp. MED297]
 gi|88778137|gb|EAR09332.1| phosphate regulon transcriptional regulatory protein PhoB [Reinekea
           sp. MED297]
          Length = 240

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 54/106 (50%), Gaps = 3/106 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD    +R+V        G+   EA++  +A      +  P+ +++D  M  V  +
Sbjct: 10  SILIVDDEAPIREVIAAALEMAGYRTLEASNAQDAHSIVVDQK-PDLILLDWMMPQVSGV 68

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           EF   +++ PL  ++ +  L  + + +  I G  AGA+ ++ KPF+
Sbjct: 69  EFARRLKRDPLTAEIPIIMLTAKGEEDHKITGLEAGADDYITKPFS 114


>gi|119897735|ref|YP_932948.1| response regulator [Azoarcus sp. BH72]
 gi|119670148|emb|CAL94061.1| probable response regulator [Azoarcus sp. BH72]
          Length = 656

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 56/117 (47%), Gaps = 9/117 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKEL--LPNYLVID---ESMEG 58
           +L+VD    +RK+   +  + G  VFEA +    R   E+ L   P+ +V+D     MEG
Sbjct: 337 VLVVDDEASIRKLMCAVLEEAGHTVFEAEN---GRIGLERALDIQPHMMVLDWVMPEMEG 393

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            LE +  +R   +G  +++  L    D E++I     GA+ F+ KP     L   MR
Sbjct: 394 -LELVRALRATKIGRSIYILLLTNVEDDERLIEAFEVGADDFVTKPVKPRVLAARMR 449


>gi|83858318|ref|ZP_00951840.1| response regulator receiver (CheY-like protein) [Oceanicaulis
           alexandrii HTCC2633]
 gi|83853141|gb|EAP90993.1| response regulator receiver (CheY-like protein) [Oceanicaulis
           alexandrii HTCC2633]
          Length = 244

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 4/123 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L V+    VR + R L  D G       S  +      +   P  L+ D  M+ V  L 
Sbjct: 120 ILFVEDDISVRNLVRELLTDIGVGEVRMASSGQEALALMRTYTPTMLLSDWYMQPVDGLS 179

Query: 62  FIAHVR--QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            +  VR  Q  L +   + +L  E + EK+ +  R G +  L+KPFNR  +  A+  + Q
Sbjct: 180 LLRQVRSGQTRLPSQTPIIFLTSENNAEKIHSVIRNGVDHVLIKPFNRAVVMRAISRIAQ 239

Query: 120 MQK 122
            Q+
Sbjct: 240 QQR 242


>gi|223940597|ref|ZP_03632442.1| response regulator receiver protein [bacterium Ellin514]
 gi|223890750|gb|EEF57266.1| response regulator receiver protein [bacterium Ellin514]
          Length = 196

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L++D S  VR V       FGF   EA       +   ++  P+ ++ D  M G+ 
Sbjct: 1   MQTVLVIDDSDDVRGVIVKTLAHFGFSTCEAKDGASGIQTAVRDQ-PDLIICDIRMPGMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            F  ++ +R+ P    +   +L   +D   M  G  +GA+ +L KPF    L
Sbjct: 60  GFHTLSAIREHPAIATIPFIFLSAAIDKSDMRRGMASGADDYLTKPFTPHEL 111


>gi|197119775|ref|YP_002140202.1| sigma-54-dependent transcriptional response regulator [Geobacter
           bemidjiensis Bem]
 gi|197089135|gb|ACH40406.1| sigma-54-dependent transcriptional response regulator [Geobacter
           bemidjiensis Bem]
          Length = 453

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLPNYLVIDESMEGV--L 60
           +L++D    +R+V  +     G+ V+ A       + F E+  LP  ++ D  M G    
Sbjct: 5   ILVIDDDSSLRRVLEYNLQQEGYDVYTAADGDAGLQLFAER--LPAVVITDLKMPGKSGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E ++ +++    T V V      +D    +   + GA  +L KPFNRE L+  + +  Q+
Sbjct: 63  EVLSAIKESSPATVVIVLTAFGAID--TAVEAMKLGAFHYLTKPFNREELKVTVLKALQL 120

Query: 121 QKSKDENQFL 130
           Q   +EN+ L
Sbjct: 121 QGLSEENRLL 130


>gi|262273763|ref|ZP_06051576.1| chemotaxis regulator CheY [Grimontia hollisae CIP 101886]
 gi|262222178|gb|EEY73490.1| chemotaxis regulator CheY [Grimontia hollisae CIP 101886]
          Length = 104

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 44/97 (45%), Gaps = 9/97 (9%)

Query: 19  HLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE-----SMEGVLEFIAHVRQMPLGT 73
           H   + G+ V  A    EA    +K     Y VI       +M+G LEF+  VR +P   
Sbjct: 4   HTLKEAGYQVETANDGAEA---LKKAKSGQYDVIISDVNMPNMDG-LEFVRQVRAVPQYK 59

Query: 74  DVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
              +  L  E   EK   G  AGA  +++KPFN +TL
Sbjct: 60  FTPILMLTTETSAEKKSMGKSAGATGWIVKPFNPDTL 96


>gi|253990159|ref|YP_003041515.1| chemotaxis regulatory protein CheY [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|211639004|emb|CAR67618.1| chemotaxis protein chey [Photorhabdus asymbiotica subsp.
           asymbiotica ATCC 43949]
 gi|253781609|emb|CAQ84772.1| chemotaxis protein chey [Photorhabdus asymbiotica]
          Length = 129

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    EA          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAQDGSEALTKIRSSQF-DFIISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R+      + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKIIREDAQLAKIPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|90426148|ref|YP_534518.1| response regulator receiver domain-containing protein
           [Rhodopseudomonas palustris BisB18]
 gi|90108162|gb|ABD90199.1| response regulator receiver domain protein (CheY-like)
           [Rhodopseudomonas palustris BisB18]
          Length = 121

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 56/119 (47%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M ++L VD S  +R++ +      G  V EA    +  E   K   P+ ++ D +M    
Sbjct: 1   MATILTVDDSPSIRQMIKVALAPLGHNVIEAGDGAQGLEKA-KASRPHLVITDLNMPVMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            +E I  +R  P  T + + +L  E +        +AGA  ++ KPF+++ L+  + +L
Sbjct: 60  GMELIKALRATPALTGLPIVFLTTESNDAVKQEAKKAGATGWITKPFSQDQLQAVVNKL 118


>gi|91975765|ref|YP_568424.1| response regulator receiver [Rhodopseudomonas palustris BisB5]
 gi|91682221|gb|ABE38523.1| response regulator receiver [Rhodopseudomonas palustris BisB5]
          Length = 131

 Score = 43.1 bits (100), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 56/113 (49%), Gaps = 6/113 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY-LVI-DESMEGVL 60
           S+L+VD    + ++ R+L    GF   +  S  +     EK  +  Y LVI D +ME + 
Sbjct: 8   SVLVVDDYSTMIRIIRNLLKQLGFEHIDDAS--DGSAALEKMRVKKYGLVISDWNMEPMT 65

Query: 61  --EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             + +  VR  P  +      +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 66  GYDLLKEVRADPNLSQTPFIMITAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|220934512|ref|YP_002513411.1| response regulator receiver protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219995822|gb|ACL72424.1| response regulator receiver protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 126

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ ++L  D GF    EA     A    +     ++L+ D +M  +  +
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGFNNTSEADDGSTALPMLQNGNF-DFLITDWNMPNMPGI 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR       + V  +  E   E+++  A+AG N +++KPF  ETLR
Sbjct: 62  DLLKAVRADEKLKTMPVLLVTAEAKREQIVEAAQAGVNGYIIKPFTAETLR 112


>gi|304312792|ref|YP_003812390.1| Response regulator receiver, CheY-like [gamma proteobacterium HdN1]
 gi|301798525|emb|CBL46755.1| Response regulator receiver, CheY-like [gamma proteobacterium HdN1]
          Length = 120

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 57/115 (49%), Gaps = 9/115 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY-LVIDE----S 55
           M ++L VD S  +R +  +     GF V EA   C+  +   K    +  L++ +     
Sbjct: 1   MPTILAVDDSPSMRHMVTYALRRGGFEVIEA---CDGVDALAKAQGADVDLILSDVNMPQ 57

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           M+G+   +  +R +P  +++ +  L  E+  E+   G  AGAN +++KPF+ + L
Sbjct: 58  MDGI-SLVRELRALPAYSNIPILMLTTEMSTERKTEGRNAGANGWIIKPFDPDRL 111


>gi|159080916|gb|ABW87920.1| CheY [Campylobacter rectus]
 gi|159080918|gb|ABW87921.1| CheY [Campylobacter rectus]
          Length = 121

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD S  +R++ ++     G   + EA    EA +   +    N L+ D +M  +  
Sbjct: 2   KILVVDDSSTMRRIIKNTLQRLGHQEILEAEHGVEAWQILGQHSDINVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LELVKKVRAEQKYVDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|297569043|ref|YP_003690387.1| Fis family transcriptional regulator [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296924958|gb|ADH85768.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Desulfurivibrio alkaliphilus AHT2]
          Length = 461

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 62/134 (46%), Gaps = 5/134 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M ++L+VD       +   L  D G+  F A S  E  E      L + ++ D  M G+ 
Sbjct: 1   MKTILVVDDEPNYLVILSELLRDEGYETFTAGSAEEGLEIARHTDL-DLIITDMRMPGMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE +  ++ +     V +     EVD  K +A  RAGA ++L KPF+ + L  ++R+  
Sbjct: 60  GLELLKTIKGINPSLPVIMITAFGEVD--KAVAAMRAGAFNYLTKPFDNDELLVSIRKAL 117

Query: 119 QMQKSKDENQFLDA 132
           +  +   EN  L A
Sbjct: 118 EHYEVVRENTRLRA 131


>gi|332295880|ref|YP_004437803.1| response regulator receiver modulated diguanylate cyclase
           [Thermodesulfobium narugense DSM 14796]
 gi|332178983|gb|AEE14672.1| response regulator receiver modulated diguanylate cyclase
           [Thermodesulfobium narugense DSM 14796]
          Length = 412

 Score = 43.1 bits (100), Expect = 0.014,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 56/119 (47%), Gaps = 4/119 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--EF 62
           L+VD S + RK    + +     VF A +  EA    EK      ++IDE+M G+   + 
Sbjct: 127 LIVDDSSVSRKFMEDILSSHNLRVFTAINSDEALSILEKNKDIKLMLIDENMPGMRGSDL 186

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           +  VR+      + V  +    +    +   + GAN F+LKPFN+E   F +R +  ++
Sbjct: 187 VNEVRKTYTKEQMSVIGISSYSNSILTVEFLKRGANDFILKPFNKE--EFCLRVMQNLE 243


>gi|322417618|ref|YP_004196841.1| response regulator receiver sensor signal transduction histidine
           kinase [Geobacter sp. M18]
 gi|320124005|gb|ADW11565.1| response regulator receiver sensor signal transduction histidine
           kinase [Geobacter sp. M18]
          Length = 455

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 3/127 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S+L+VD + I  ++   +     + V    S   A +    +L P+ +++D  M G+ 
Sbjct: 12  MPSILIVDDNQINLQLLCGMLAGMSWRVRPVASGIMALKAAMAKL-PDLILLDAMMPGMD 70

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E   H++Q P    + +  +    D E  +   R GA+ FL KP +R  L+   + L 
Sbjct: 71  GFEVCRHLKQTPATEHIPIVMITALTDQESRMKALRCGADDFLSKPVDRSELQVRTKNLL 130

Query: 119 QMQKSKD 125
           +++K  D
Sbjct: 131 RVKKYGD 137


>gi|295687869|ref|YP_003591562.1| response regulator receiver protein [Caulobacter segnis ATCC 21756]
 gi|295429772|gb|ADG08944.1| response regulator receiver protein [Caulobacter segnis ATCC 21756]
          Length = 121

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 52/113 (46%), Gaps = 5/113 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L VD S  +R   +   +  G+ V EA +  E  +        + +V D +M  V+
Sbjct: 1   MSAILTVDDSASIRAAIKIALSSEGYNVTEAANGAEGLDKASAGGF-DLIVTDLNMP-VM 58

Query: 61  EFIAHVRQM---PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + +  +RQ+   P G  V + +L  E D +       AGA  +L KPF  + L
Sbjct: 59  DGLTMIRQLRARPAGAGVPIIFLTTESDADVKAEAKAAGATGWLTKPFEPDQL 111


>gi|37525786|ref|NP_929130.1| chemotaxis regulatory protein CheY [Photorhabdus luminescens subsp.
           laumondii TTO1]
 gi|36785215|emb|CAE14150.1| Chemotaxis protein CheY [Photorhabdus luminescens subsp. laumondii
           TTO1]
          Length = 129

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    EA          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAQDGAEALAKIRASQF-DFIISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R+      + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKIIREDAQLAKIPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|15642065|ref|NP_231697.1| chemotaxis protein CheY [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|121586939|ref|ZP_01676719.1| chemotaxis protein CheY [Vibrio cholerae 2740-80]
 gi|121727384|ref|ZP_01680523.1| chemotaxis protein CheY [Vibrio cholerae V52]
 gi|147675594|ref|YP_001217592.1| chemotaxis protein CheY [Vibrio cholerae O395]
 gi|153213691|ref|ZP_01948943.1| chemotaxis protein CheY [Vibrio cholerae 1587]
 gi|153803627|ref|ZP_01958213.1| chemotaxis protein CheY [Vibrio cholerae MZO-3]
 gi|153821687|ref|ZP_01974354.1| chemotaxis protein CheY [Vibrio cholerae B33]
 gi|153826089|ref|ZP_01978756.1| chemotaxis protein CheY [Vibrio cholerae MZO-2]
 gi|153828909|ref|ZP_01981576.1| chemotaxis protein CheY [Vibrio cholerae 623-39]
 gi|227082192|ref|YP_002810743.1| chemotaxis protein CheY [Vibrio cholerae M66-2]
 gi|229507845|ref|ZP_04397350.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae BX
           330286]
 gi|229511919|ref|ZP_04401398.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae B33]
 gi|229513721|ref|ZP_04403183.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae TMA
           21]
 gi|229519055|ref|ZP_04408498.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae RC9]
 gi|229522024|ref|ZP_04411441.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae TM
           11079-80]
 gi|229524073|ref|ZP_04413478.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae bv.
           albensis VL426]
 gi|229528917|ref|ZP_04418307.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           12129(1)]
 gi|229607390|ref|YP_002878038.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           MJ-1236]
 gi|254286815|ref|ZP_04961768.1| chemotaxis protein CheY [Vibrio cholerae AM-19226]
 gi|254849152|ref|ZP_05238502.1| chemotaxis protein CheY [Vibrio cholerae MO10]
 gi|9656611|gb|AAF95211.1| chemotaxis protein CheY [Vibrio cholerae O1 biovar El Tor str.
           N16961]
 gi|50872119|dbj|BAD34538.1| cheY homolog [Vibrio cholerae]
 gi|121548875|gb|EAX58918.1| chemotaxis protein CheY [Vibrio cholerae 2740-80]
 gi|121630276|gb|EAX62674.1| chemotaxis protein CheY [Vibrio cholerae V52]
 gi|124115752|gb|EAY34572.1| chemotaxis protein CheY [Vibrio cholerae 1587]
 gi|124120836|gb|EAY39579.1| chemotaxis protein CheY [Vibrio cholerae MZO-3]
 gi|126520785|gb|EAZ78008.1| chemotaxis protein CheY [Vibrio cholerae B33]
 gi|146317477|gb|ABQ22016.1| chemotaxis protein CheY [Vibrio cholerae O395]
 gi|148875615|gb|EDL73750.1| chemotaxis protein CheY [Vibrio cholerae 623-39]
 gi|149740206|gb|EDM54359.1| chemotaxis protein CheY [Vibrio cholerae MZO-2]
 gi|150423106|gb|EDN15054.1| chemotaxis protein CheY [Vibrio cholerae AM-19226]
 gi|227010080|gb|ACP06292.1| chemotaxis protein CheY [Vibrio cholerae M66-2]
 gi|227013962|gb|ACP10172.1| chemotaxis protein CheY [Vibrio cholerae O395]
 gi|229332691|gb|EEN98177.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           12129(1)]
 gi|229337654|gb|EEO02671.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae bv.
           albensis VL426]
 gi|229340949|gb|EEO05954.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae TM
           11079-80]
 gi|229343744|gb|EEO08719.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae RC9]
 gi|229348902|gb|EEO13859.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae TMA
           21]
 gi|229351884|gb|EEO16825.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae B33]
 gi|229355350|gb|EEO20271.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae BX
           330286]
 gi|229370045|gb|ACQ60468.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Vibrio cholerae
           MJ-1236]
 gi|254844857|gb|EET23271.1| chemotaxis protein CheY [Vibrio cholerae MO10]
          Length = 130

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 10  KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 68

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 69  IDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 120


>gi|148262168|ref|YP_001228874.1| two component, sigma-54 specific, Fis family transcriptional
           regulator [Geobacter uraniireducens Rf4]
 gi|146395668|gb|ABQ24301.1| two component, sigma-54 specific, transcriptional regulator, Fis
           family [Geobacter uraniireducens Rf4]
          Length = 452

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 33/129 (25%), Positives = 62/129 (48%), Gaps = 5/129 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L++D    +R+V  +   + G+ V +A S  E   +   +  P+ ++ D  M G+  L 
Sbjct: 5   ILVIDDDSSLRRVLEYNLQEEGYEV-QAASSGEEGLYLFGQSRPSLVITDMKMSGMDGLM 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +  V++    T V +      VD    +   +AGA  ++ KPFNR+ L+  +R+  Q  
Sbjct: 64  VLKSVKERSPETLVIIITAFGTVDV--AVEAMKAGAYDYITKPFNRDALKLTVRKALQFT 121

Query: 122 KSKDENQFL 130
              +EN+ L
Sbjct: 122 GLAEENKRL 130


>gi|57506022|ref|ZP_00371945.1| chemotaxis regulatory protein Cj1118c [Campylobacter upsaliensis
           RM3195]
 gi|57015630|gb|EAL52421.1| chemotaxis regulatory protein Cj1118c [Campylobacter upsaliensis
           RM3195]
          Length = 129

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G   + EA    EA +  EK      L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLTRLGHNDILEAEHGVEAWDLLEKNDDVKILITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           L+ +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+  + ++
Sbjct: 62  LDLVKKVRAEKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEDV 119


>gi|304311118|ref|YP_003810716.1| Chemotaxis protein CheY [gamma proteobacterium HdN1]
 gi|301796851|emb|CBL45063.1| Chemotaxis protein CheY [gamma proteobacterium HdN1]
          Length = 123

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D G+     T+  EA +      LP       ++LV D +M
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGY-----TNTHEADD--GNSALPLLRSSDFDFLVTDWNM 55

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  +E +  VR       + V  +  E   E++I  A+AG N +++KPF  + L+
Sbjct: 56  PGMTGIELLKAVRSDDKLRSLPVLMVTAEAKREQIIEAAQAGVNGYVVKPFTAQALK 112


>gi|17232219|ref|NP_488767.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17133864|dbj|BAB76426.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 238

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 35/141 (24%), Positives = 67/141 (47%), Gaps = 12/141 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           MD L++ D S I + + +H     GF    +     A +    E  P+ +++D  + G+ 
Sbjct: 1   MDILIVEDESEIAQLI-QHSLEKEGFSCRTSRDGINALQMFH-ERPPDLIILDLMIPGLD 58

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            LE  A +RQ P   D ++  L  + +    + G   GA+ +++KPF+        R  L
Sbjct: 59  GLEVCARIRQKPGAKDPYILMLTAKGEEIDRVIGLSTGADDYMVKPFSPRELVARVRALL 118

Query: 111 RFAMRELPQMQKSKDENQFLD 131
           R ++R+  Q Q ++ ++  +D
Sbjct: 119 RRSLRQGGQNQVNRTQHFIVD 139


>gi|332994103|gb|AEF04158.1| chemotaxis protein CheY [Alteromonas sp. SN2]
          Length = 127

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF  + EA     A    ++    +++V D +M G+  
Sbjct: 6   KILVVDDFSTMRRIIKNLLKDLGFANIQEADDGNTALPMLQQGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E+++A A+AG N +++KPF   TL+
Sbjct: 65  IDLLRAIRADDKLKHLPVLMVTAEAKKEQIVAAAQAGVNGYVVKPFTAATLK 116


>gi|190890340|ref|YP_001976882.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CIAT 652]
 gi|209547905|ref|YP_002279822.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|218515826|ref|ZP_03512666.1| response regulator receiver protein [Rhizobium etli 8C-3]
 gi|218658981|ref|ZP_03514911.1| response regulator receiver protein [Rhizobium etli IE4771]
 gi|218671150|ref|ZP_03520821.1| response regulator receiver protein [Rhizobium etli GR56]
 gi|218679436|ref|ZP_03527333.1| response regulator receiver protein [Rhizobium etli CIAT 894]
 gi|190695619|gb|ACE89704.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CIAT 652]
 gi|209533661|gb|ACI53596.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|327193013|gb|EGE59925.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CNPAF512]
          Length = 121

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R +     N+ GF   +A    E  E  E E  P+ +V D +M  +    
Sbjct: 5   VLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEVLE-ESNPDVIVTDINMPRLDGFG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           FI  VR+      + +  L  E D EK     +AGA  +++KPF+
Sbjct: 64  FIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|86359114|ref|YP_471006.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CFN 42]
 gi|86283216|gb|ABC92279.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CFN 42]
          Length = 122

 Score = 43.1 bits (100), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R   +    + G+ V EA +  E     +     + +V D     M+G 
Sbjct: 4   NILTVDDSASIRLTTKVTLTNAGYSVTEAVNGAEGLAAAKSNSF-DLIVTDLNMPVMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R++P    V + +L  E D +       AGA  +L KPF+ E L
Sbjct: 62  LTMIEELRKLPAQAGVPIIFLTTESDADLKARAKAAGATGWLTKPFDPENL 112


>gi|259417672|ref|ZP_05741591.1| response regulator receiver modulated serine phosphatase
           [Silicibacter sp. TrichCH4B]
 gi|259346578|gb|EEW58392.1| response regulator receiver modulated serine phosphatase
           [Silicibacter sp. TrichCH4B]
          Length = 423

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 56/112 (50%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R++       +GF V EA    EA + C  +  P+ ++ D  M G+  ++
Sbjct: 21  VLVVDDSRLQRRILVASLKKWGFDVVEAEGGEEAMDICRAD-PPDLILSDWMMPGMNGID 79

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR 111
           F    R      + + Y++L+    EK  +  G  AGA+ FL KP + + LR
Sbjct: 80  FCRAFRAE--SHEAYSYFILLTSKSEKNEVAEGLDAGADDFLTKPVSSDELR 129


>gi|325982951|ref|YP_004295353.1| response regulator receiver protein [Nitrosomonas sp. AL212]
 gi|325532470|gb|ADZ27191.1| response regulator receiver protein [Nitrosomonas sp. AL212]
          Length = 135

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 64/124 (51%), Gaps = 6/124 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEA-REFCEKELLPNYLVIDESMEGV--L 60
           L+VD    +R++ R+L  + GF+ V EA     A R+  +     +++V D +M  +  L
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFVNVDEAEDGAIALRKLQDGNF--DFIVSDWNMPNMDGL 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             + +VR      ++ V  +  E   E ++A A+AGA+ +++KPF    L   + ++ Q 
Sbjct: 67  TMLQNVRANSALKNIPVLMVTAEAKKENIVAAAQAGASGYIVKPFTAAVLEEKLNKIFQN 126

Query: 121 QKSK 124
            K+K
Sbjct: 127 MKAK 130


>gi|187926232|ref|YP_001892577.1| response regulator receiver protein [Ralstonia pickettii 12J]
 gi|241665720|ref|YP_002984079.1| response regulator receiver protein [Ralstonia pickettii 12D]
 gi|187727986|gb|ACD29150.1| response regulator receiver protein [Ralstonia pickettii 12J]
 gi|240867747|gb|ACS65407.1| response regulator receiver protein [Ralstonia pickettii 12D]
          Length = 137

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 54/119 (45%), Gaps = 6/119 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELL-PNYLVIDE----SMEG 58
           +L+VD S  +R++      + GF V EA     A E         ++LVI +    SM+G
Sbjct: 6   ILVVDDSTSIRRMIAACLRECGFAVTEAGDGSAALEAVRTSAQGSHHLVITDQVMPSMDG 65

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            L  I  +R +P   D  +  L  E D         AGA  FL KPF+ + L  ++ +L
Sbjct: 66  -LTLIRALRALPAYADTPILMLTTEADNSIRDQARAAGATGFLPKPFDPDGLTDSVMQL 123


>gi|30249875|ref|NP_841945.1| response regulator receiver domain-containing protein [Nitrosomonas
           europaea ATCC 19718]
 gi|30180912|emb|CAD85834.1| Response regulator receiver domain [Nitrosomonas europaea ATCC
           19718]
          Length = 131

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 8/120 (6%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP---NYLVIDESMEGV-- 59
           L+VD    +R++ R+L  + GF   E     E      K+L     +++V D +M  +  
Sbjct: 9   LVVDDFSTMRRIIRNLLKELGFNNVEE---AEDGAMALKKLRDGGFDFVVSDWNMPNMDG 65

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L  + +VR      D+ V  +  E   E +IA A+AGA+ +++KPF   TL   + ++ Q
Sbjct: 66  LTMLQNVRADDALKDIPVLMVTAEAKKENIIAAAQAGASGYIVKPFTAATLDEKLNKILQ 125


>gi|169831989|ref|YP_001717971.1| response regulator receiver modulated diguanylate cyclase
           [Candidatus Desulforudis audaxviator MP104C]
 gi|169638833|gb|ACA60339.1| response regulator receiver modulated diguanylate cyclase
           [Candidatus Desulforudis audaxviator MP104C]
          Length = 314

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 33/138 (23%), Positives = 68/138 (49%), Gaps = 11/138 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE----LLPNYLVIDESMEGV 59
           +L+ D S +  +V +    ++G  +  A    EA E  ++E    ++ ++++    M+G 
Sbjct: 3   ILVADDSLVSARVVQKALEEWGHSIIVARDGAEAWEILQREEIRLVIADWIM--PVMDG- 59

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR----FAMR 115
           LE    +R   L   V+V  L  +   + ++ G  AGA+ ++ KPF+ E L+      +R
Sbjct: 60  LELCRTIRHSQLAGYVYVILLTSKGSKDDIVEGLGAGADDYITKPFHHEELKARVQVGIR 119

Query: 116 ELPQMQKSKDENQFLDAI 133
            +   +K K+ N+ + A+
Sbjct: 120 IIELEEKLKEANKKIAAL 137


>gi|85703149|ref|ZP_01034253.1| nitrogen assimilation regulatory protein NtrX [Roseovarius sp. 217]
 gi|85672077|gb|EAQ26934.1| nitrogen assimilation regulatory protein NtrX [Roseovarius sp. 217]
          Length = 469

 Score = 42.7 bits (99), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 59/135 (43%), Gaps = 9/135 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID-----ES 55
           M  +L+VD    +R++   +  D G+    A +  EA      E  P  L++D       
Sbjct: 1   MSDILIVDDERDIRELISDILEDEGYSTRRAGNSDEAMAAIAAEQ-PGLLILDIWLKDSH 59

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G+    A  R  P   DV V  +    + E  +A  + GA  F+ KPFN + L   +R
Sbjct: 60  MDGIDILKAVKRDYP---DVPVVIISGHGNIEIAVAAIKQGAYDFIEKPFNIDQLMVVIR 116

Query: 116 ELPQMQKSKDENQFL 130
              +  + + ENQ L
Sbjct: 117 RGMETSRLRRENQAL 131


>gi|298251729|ref|ZP_06975532.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297546321|gb|EFH80189.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 225

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           D L++ +  H++ ++ R  F   G    +A    EA    E  L P+ +++D  M G+  
Sbjct: 15  DHLVVREGLHMMLEIAREGFTWLG----DAADGAEAVRVVEA-LQPDVVLMDLRMPGMDG 69

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           LE I  +R+      V +     E D   M+ G RAGA  +LLK  +RETL  A+R
Sbjct: 70  LEAITQIREQWPHIAVIILTTYDEDDL--MLRGLRAGACGYLLKDTDRETLFHAIR 123


>gi|119493971|ref|ZP_01624531.1| Two Component Transcriptional Regulator, LuxR family protein
           [Lyngbya sp. PCC 8106]
 gi|119452292|gb|EAW33488.1| Two Component Transcriptional Regulator, LuxR family protein
           [Lyngbya sp. PCC 8106]
          Length = 246

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/116 (29%), Positives = 57/116 (49%), Gaps = 3/116 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    +R+  +    D  F V  A +  E  E  ++ L P+ ++ D  M  V   +
Sbjct: 22  LLLVDDEPGLREAVQAYLEDSDFTVDVAGNAREGWELLQQNL-PDLVITDIMMPEVDGYQ 80

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           F+  +R+ PL   + V +L  +      I G +AG +++L KPF+ E L   ++ L
Sbjct: 81  FLKQMREDPLFKALPVVFLTAKGMTTDRIQGYQAGCDAYLSKPFDPEELVVIVKNL 136


>gi|116250459|ref|YP_766297.1| CheY response regulator transcriptional regulatory protein
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|241203083|ref|YP_002974179.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
 gi|115255107|emb|CAK06181.1| CheY protein, probably minor role in reorientation [Rhizobium
           leguminosarum bv. viciae 3841]
 gi|240856973|gb|ACS54640.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM1325]
          Length = 121

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R +     N+ GF   +A    E  E  E E  P+ +V D +M  +    
Sbjct: 5   VLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLE-ESNPDVIVTDINMPRLDGFG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           FI  VR+      + +  L  E D EK     +AGA  +++KPF+
Sbjct: 64  FIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|239905419|ref|YP_002952158.1| OmpR family two-component response regulator [Desulfovibrio
           magneticus RS-1]
 gi|239795283|dbj|BAH74272.1| OmpR family two-component response regulator [Desulfovibrio
           magneticus RS-1]
          Length = 229

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 40/140 (28%), Positives = 62/140 (44%), Gaps = 14/140 (10%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           D +L++D    +RK+       +G+ V E     EA +  E +L P+ +++D  M G   
Sbjct: 3   DVVLIIDDDLKLRKMLGDYLAGYGYEVRELPDGGEAAKALE-QLRPSVVILDIMMPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETLR 111
           LE +A +R+    + V V  L  + D    + G   GA+ +L KPFN        R  LR
Sbjct: 62  LEVLADIRR---ASTVPVIMLTAKGDPMDRVVGLEMGADDYLPKPFNLRELLARIRAALR 118

Query: 112 FAMRELPQMQKSKDENQFLD 131
               E P   + K     LD
Sbjct: 119 RHAPEAPNKGRLKSGGISLD 138


>gi|94310484|ref|YP_583694.1| response regulator receiver domain-containing protein [Cupriavidus
           metallidurans CH34]
 gi|93354336|gb|ABF08425.1| Hydrogenase transcriptional regulatory protein [Cupriavidus
           metallidurans CH34]
          Length = 309

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 8/109 (7%)

Query: 26  FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVR-QMPLGTDVFVYYLLM 82
           F V  A+   EAR   E++ +   L+ D+ M G+  +EF+  VR Q P   DV    +  
Sbjct: 31  FEVLTASGAGEARGIMERDFV-QLLLCDQRMPGMSGVEFLKQVRSQWP---DVVRMIISG 86

Query: 83  EVDFEKMIAGAR-AGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL 130
             D + +IAG   AG   ++LKP+  E L   +    ++ + + ENQ L
Sbjct: 87  YTDSKDIIAGINDAGIYQYILKPWQPEQLLLTLHNAAELYRLQSENQRL 135


>gi|291278837|ref|YP_003495672.1| two-component system, chemotaxis family, response regulator CheY
           [Deferribacter desulfuricans SSM1]
 gi|290753539|dbj|BAI79916.1| two-component system, chemotaxis family, response regulator CheY
           [Deferribacter desulfuricans SSM1]
          Length = 125

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 26/113 (23%), Positives = 59/113 (52%), Gaps = 4/113 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           D ++ VD S  +R++ ++     GF  + EA++  EA +   K  + + ++ D +M  + 
Sbjct: 5   DVIITVDDSSTMRRIIKNTLIKIGFNNILEASNGVEALDVISKNKV-DLIITDWNMPEMD 63

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            L F+  +R      ++ +  +  E   E ++   ++G N++++KPF  +TL+
Sbjct: 64  GLTFVKTIRSNSEYDEIPILMVTTEAAKEDILMALKSGVNNYIVKPFTPDTLK 116


>gi|52425559|ref|YP_088696.1| two-component response regulator [Mannheimia succiniciproducens
           MBEL55E]
 gi|52307611|gb|AAU38111.1| OmpR protein [Mannheimia succiniciproducens MBEL55E]
          Length = 236

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/133 (24%), Positives = 61/133 (45%), Gaps = 5/133 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+   + R   + +F   G+ VFEAT   +  +  E + + N +V+D ++ G    
Sbjct: 5   QILIVEDETVTRNTLKSIFEAEGYEVFEATDGNQMHQIIETQEI-NLVVMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL---PQ 119
           +   R++   T+  + +L    +    I G   GA+ ++ KPFN   L    R L     
Sbjct: 64  ML-ARELREKTNTALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELAIRARNLLHRTM 122

Query: 120 MQKSKDENQFLDA 132
            +  K+ N  +DA
Sbjct: 123 AENEKNSNTHVDA 135


>gi|288959667|ref|YP_003450008.1| two-component response regulator [Azospirillum sp. B510]
 gi|288911975|dbj|BAI73464.1| two-component response regulator [Azospirillum sp. B510]
          Length = 121

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 52/123 (42%), Gaps = 15/123 (12%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEAT------SVCEAREFCEKELLPNYLVIDESM 56
           ++L VD S  +R +        G+ V EA       ++   R F       + ++ D +M
Sbjct: 4   NVLTVDDSKTIRDMVGFTLKGAGYEVAEAPDGNAGLALVNQRRF-------DCIITDLNM 56

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            G+  L     +R         V  L  E D  K  AG  AGA  +L+KPFN E L   +
Sbjct: 57  PGLDGLALTRAIRASATNRATPVLLLTTEADPTKKTAGREAGATGWLVKPFNPEKLVETV 116

Query: 115 REL 117
           R++
Sbjct: 117 RKV 119


>gi|298247701|ref|ZP_06971506.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297550360|gb|EFH84226.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 231

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 46/89 (51%), Gaps = 6/89 (6%)

Query: 25  GF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLL 81
           GF +V +A     A    E EL P+ +++D  M G+  LE IAH+R       V +    
Sbjct: 33  GFALVGDAADGATALRVVE-ELQPDVVLMDLRMPGMDGLEAIAHIRNAWPQIAVVILTTY 91

Query: 82  MEVDFEKMIAGARAGANSFLLKPFNRETL 110
            E D   M+ G R+GA  +LLK  NRETL
Sbjct: 92  NEDDL--MVRGLRSGACGYLLKDTNRETL 118


>gi|294673053|ref|YP_003573669.1| sensor histidine kinase/DNA-binding response regulator [Prevotella
            ruminicola 23]
 gi|294472787|gb|ADE82176.1| sensor histidine kinase/DNA-binding response regulator [Prevotella
            ruminicola 23]
          Length = 1314

 Score = 42.7 bits (99), Expect = 0.016,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 62/124 (50%), Gaps = 8/124 (6%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE----LLPNYLVIDESMEG 58
            S+L+VD S  +R+   + F D  + +  A    EA    ++     ++ ++++    M+G
Sbjct: 1064 SMLIVDDSEDMRQFLENNFKD-KYHIITAGDGIEALHLLQQHQVSIIISDWMM--PRMDG 1120

Query: 59   VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
              EF   VRQ PL + +    L  + D    + G   GA++++ KPF+ + L   +R + 
Sbjct: 1121 A-EFCRRVRQNPLTSHIPFVMLTAKTDDNSKVKGMDVGADAYIEKPFSVQYLEACIRNIL 1179

Query: 119  QMQK 122
            Q+++
Sbjct: 1180 QIRR 1183


>gi|297579571|ref|ZP_06941499.1| chemotaxis protein CheY [Vibrio cholerae RC385]
 gi|298497907|ref|ZP_07007714.1| chemotaxis protein CheY [Vibrio cholerae MAK 757]
 gi|297537165|gb|EFH75998.1| chemotaxis protein CheY [Vibrio cholerae RC385]
 gi|297542240|gb|EFH78290.1| chemotaxis protein CheY [Vibrio cholerae MAK 757]
          Length = 135

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 15  KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 73

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 74  IDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 125


>gi|288929443|ref|ZP_06423288.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           sp. oral taxon 317 str. F0108]
 gi|288329545|gb|EFC68131.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           sp. oral taxon 317 str. F0108]
          Length = 963

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 22/82 (26%), Positives = 46/82 (56%), Gaps = 2/82 (2%)

Query: 43  KELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF 100
           ++++P+ +V D  M GV  LE    +R   + + + +  +  ++     + G  AGA+++
Sbjct: 750 EQMVPDVIVTDLMMPGVDGLEVCRRIRANEVTSHIPIIVVTAKITEADRVKGLEAGADAY 809

Query: 101 LLKPFNRETLRFAMRELPQMQK 122
           L KPFNR+ LR  + +L + ++
Sbjct: 810 LAKPFNRDELRMRVEKLLEQRR 831


>gi|269139260|ref|YP_003295961.1| response regulator receiver modulated diguanylate cyclase
           [Edwardsiella tarda EIB202]
 gi|267984921|gb|ACY84750.1| response regulator receiver modulated diguanylate cyclase
           [Edwardsiella tarda EIB202]
 gi|304559168|gb|ADM41832.1| Response regulator [Edwardsiella tarda FL6-60]
          Length = 319

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 52/110 (47%), Gaps = 4/110 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD   I  ++   LF D    VF AT+  +A   C  +  P+ +++D  M  +  LE
Sbjct: 21  LLIVDDEPINIQILYQLFAD-DHTVFMATNGQQALNICMNQH-PDLVLLDIEMPEMNGLE 78

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
               ++  P   D+ V ++   +D      G RAGA  F+ KP N   +R
Sbjct: 79  VCQRLKASPQTQDIPVIFITAHIDEAMETTGLRAGAVDFISKPINHNIVR 128


>gi|225570394|ref|ZP_03779419.1| hypothetical protein CLOHYLEM_06494 [Clostridium hylemonae DSM
           15053]
 gi|225160765|gb|EEG73384.1| hypothetical protein CLOHYLEM_06494 [Clostridium hylemonae DSM
           15053]
          Length = 251

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 31/132 (23%), Positives = 67/132 (50%), Gaps = 8/132 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLE 61
           +LLV+ +  + +  R +    GF V  A ++CEA +   +E  P+ LV+D  +     +E
Sbjct: 28  VLLVEDNEAILRTNRRILEAEGFTVLCAGTLCEAGQRLSEE-TPDVLVLDIMLPDGSGIE 86

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F   ++++   T   V +L    +  +++ G  AG + ++ KP+N +  +F  R   Q+Q
Sbjct: 87  FCREIQEL---TAAPVLFLTALDEDHEIVEGLTAGGSDYITKPYNMD--QFVARVKAQLQ 141

Query: 122 KSKDENQFLDAI 133
            ++   + ++ +
Sbjct: 142 LARRNQRAIEQV 153


>gi|19552100|ref|NP_600102.1| two-component system, response regulator [Corynebacterium
           glutamicum ATCC 13032]
 gi|11526729|gb|AAG36759.1|AF119221_1 response regulator [Corynebacterium glutamicum]
 gi|21323640|dbj|BAB98267.1| Two-component system, response regulators consisting of a CheY-like
           receiver domain and a HTH DNA-binding domain
           [Corynebacterium glutamicum ATCC 13032]
          Length = 232

 Score = 42.7 bits (99), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (45%), Gaps = 5/116 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR   R   +  G+ V  A    +A E  +KE  P  +++D  M G+  LE
Sbjct: 3   ILVVDDEQAVRDSLRRSLSFNGYNVVLAEDGIQALEMIDKEQ-PALVILDVMMPGMDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              H+R    G D  +  L    +    + G  AGA+ +L KPF  E L   +R L
Sbjct: 62  VCRHLRSE--GDDRPILILTARDNVSDRVGGLDAGADDYLAKPFALEELLARVRSL 115


>gi|317152393|ref|YP_004120441.1| response regulator receiver [Desulfovibrio aespoeensis Aspo-2]
 gi|316942644|gb|ADU61695.1| response regulator receiver [Desulfovibrio aespoeensis Aspo-2]
          Length = 528

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGVLE 61
           L  D S  +  + R +  D GF  F A++  EA +F E+      ++ D +M   +G +E
Sbjct: 411 LAADDSRSMCAMHRAILTDLGFEPFMASNGEEAYDFIEQGKDFEVIITDMNMPVMDG-ME 469

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            +  VR  P   +V +  +  E +  +     +AG  +F+ KPF  E L+  + E+
Sbjct: 470 LVGKVRHTPGYEEVPIIMVTTESEASQQDMARKAGVTAFITKPFKPEALKAKILEV 525


>gi|149376624|ref|ZP_01894384.1| CheY-like receiver protein [Marinobacter algicola DG893]
 gi|149359142|gb|EDM47606.1| CheY-like receiver protein [Marinobacter algicola DG893]
          Length = 127

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTDEADD--GNTALPMLKSGKYDFLVTDWN 58

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  L+ +  VR       + V  +  E   ++++A A+AG N +++KPF    L+
Sbjct: 59  MPGMSGLDLLKEVRADDGLKTLPVLMVTAEAKRDQIVAAAQAGVNGYVVKPFTAAVLK 116


>gi|300311293|ref|YP_003775385.1| chemotaxis regulator protein [Herbaspirillum seropedicae SmR1]
 gi|300074078|gb|ADJ63477.1| chemotaxis regulator protein [Herbaspirillum seropedicae SmR1]
          Length = 135

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 6/112 (5%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDES----MEGV 59
           L+VD    +R++   L  +  +  + EA     A +  E   LP   V+ +     M+G 
Sbjct: 9   LVVDDFSTMRRIVSGLLKELEYTKIVEADDGSSALKILEAGALPVTFVLTDWNMPVMDG- 67

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L  +  +R  P    + V  +  E   E ++  A++GA+ +++KPFN  TL+
Sbjct: 68  LTLLKKIRATPSMAHLPVLMITAEAKKENIVEAAQSGADGYIVKPFNAATLK 119


>gi|188996860|ref|YP_001931111.1| response regulator receiver protein [Sulfurihydrogenibium sp.
           YO3AOP1]
 gi|188931927|gb|ACD66557.1| response regulator receiver protein [Sulfurihydrogenibium sp.
           YO3AOP1]
          Length = 130

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 31/124 (25%), Positives = 63/124 (50%), Gaps = 14/124 (11%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESM-- 56
           +L VD    +RK+ + L N  G+     T++ EA    E     K+   + +++D +M  
Sbjct: 9   ILTVDDMATMRKIIKSLLNQLGY-----TNIDEAENGKEALAKLKQSKYDLVLLDWNMPE 63

Query: 57  -EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +G+   +  +R+     D+ V  +  E   E ++   ++GAN++++KPF  ETL+  + 
Sbjct: 64  MDGI-TLLQEIRKDTHLKDIPVIMVTAEAKKENVLIAIQSGANNYIVKPFTAETLKEKLE 122

Query: 116 ELPQ 119
           ++ Q
Sbjct: 123 KVWQ 126


>gi|62389763|ref|YP_225165.1| two component response regulator [Corynebacterium glutamicum ATCC
           13032]
 gi|41325098|emb|CAF19579.1| putative two component response regulator [Corynebacterium
           glutamicum ATCC 13032]
          Length = 255

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 53/116 (45%), Gaps = 5/116 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR   R   +  G+ V  A    +A E  +KE  P  +++D  M G+  LE
Sbjct: 26  ILVVDDEQAVRDSLRRSLSFNGYNVVLAEDGIQALEMIDKEQ-PALVILDVMMPGMDGLE 84

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              H+R    G D  +  L    +    + G  AGA+ +L KPF  E L   +R L
Sbjct: 85  VCRHLRSE--GDDRPILILTARDNVSDRVGGLDAGADDYLAKPFALEELLARVRSL 138


>gi|325298664|ref|YP_004258581.1| integral membrane sensor hybrid histidine kinase [Bacteroides
            salanitronis DSM 18170]
 gi|324318217|gb|ADY36108.1| integral membrane sensor hybrid histidine kinase [Bacteroides
            salanitronis DSM 18170]
          Length = 1327

 Score = 42.7 bits (99), Expect = 0.017,   Method: Composition-based stats.
 Identities = 36/124 (29%), Positives = 60/124 (48%), Gaps = 10/124 (8%)

Query: 4    LLLVDSSHIVRKVGRHLFNDF--GFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            L++ D +H+     R L  D   G++VFEA    EA E  +K   P+ ++ D  M G+  
Sbjct: 1074 LIVEDDAHL-----RDLLRDILKGYIVFEAADGKEALEKIKKTH-PDIILTDIIMNGMDG 1127

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              FI  V+  P  + + +  +  +   E  I  +  GANS+L KPF+   ++  +  L  
Sbjct: 1128 FTFIQAVKSDPNISYIPLVVISAKNSVEDQIKASNLGANSYLTKPFHPLQIKSTIENLIS 1187

Query: 120  MQKS 123
             Q+S
Sbjct: 1188 RQES 1191


>gi|312130761|ref|YP_003998101.1| two component transcriptional regulator, winged helix family
           [Leadbetterella byssophila DSM 17132]
 gi|311907307|gb|ADQ17748.1| two component transcriptional regulator, winged helix family
           [Leadbetterella byssophila DSM 17132]
          Length = 241

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 61/129 (47%), Gaps = 5/129 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPNYLVIDESMEGV-- 59
            +L ++ S  +  V + L    GF+V   T    A E+  K     + +VID  + G+  
Sbjct: 4   KILFLEDSDDLGLVVKQLLEINGFVVERCTRAQAAYEYLAKFHAEIDLIVIDVGLPGIDG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            +F   +RQ  L T +   YL    + +  I G + GA+ ++ KPF+ E L   +R + Q
Sbjct: 64  FQFTEMLRQ--LNTPIPFIYLTARAEKDDRIRGLKYGASDYITKPFDIEELLLRVRNIIQ 121

Query: 120 MQKSKDENQ 128
            Q+ + + +
Sbjct: 122 WQRPRRDTE 130


>gi|253702066|ref|YP_003023255.1| Fis family transcriptional regulator [Geobacter sp. M21]
 gi|251776916|gb|ACT19497.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Geobacter sp. M21]
          Length = 453

 Score = 42.7 bits (99), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 35/130 (26%), Positives = 60/130 (46%), Gaps = 7/130 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLPNYLVIDESMEGV--L 60
           +L++D    +R+V  +     G+ V+ A       + F EK   P  +V D  M G    
Sbjct: 5   ILVIDDDSSLRRVLEYNLQQEGYDVYTAADGDAGLQLFVEKS--PAVVVTDLKMPGKSGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E ++ +++    T V V      +D    +   + GA  +L KPFNRE L+  + +  Q+
Sbjct: 63  EVLSAIKESSPATVVIVLTAFGAID--TAVEAMKLGAFHYLTKPFNREELKVTVLKALQL 120

Query: 121 QKSKDENQFL 130
           Q   +EN+ L
Sbjct: 121 QGLSEENRLL 130


>gi|328542823|ref|YP_004302932.1| transcription regulator protein [polymorphum gilvum SL003B-26A1]
 gi|326412569|gb|ADZ69632.1| Putative transcription regulator protein [Polymorphum gilvum
           SL003B-26A1]
          Length = 233

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 47/104 (45%), Gaps = 6/104 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           LLLVD    +R +   +  D G+ V  A +  EAR  C   L  + L++D  M G   L+
Sbjct: 14  LLLVDDDSRIRDLLSRVLRDSGYRVTSAANAAEARR-CMAGLEFDLLILDVMMPGETGLD 72

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
               +R+      V +  L    D    IAG   GA+ +L KPF
Sbjct: 73  LARTIRRE---NTVPILMLTARSDAADRIAGLEVGADDYLAKPF 113


>gi|261856844|ref|YP_003264127.1| PhoB family transcriptional regulator [Halothiobacillus
           neapolitanus c2]
 gi|261837313|gb|ACX97080.1| two component transcriptional regulator PhoB, winged helix family
           [Halothiobacillus neapolitanus c2]
          Length = 230

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/106 (25%), Positives = 56/106 (52%), Gaps = 3/106 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+V+    +R++        G+ + EA+ V EA E    +L P+ +++D  + G   +
Sbjct: 5   TILIVEDEKPIREMVTFALGRAGYDLIEASDVSEAFEQLSHKL-PDLVLLDWMLPGASGI 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           EF   +++  +  DV +  L    + E  ++G  AGA+ ++ KPF+
Sbjct: 64  EFARRMKRDEITRDVPIVMLTARGEEEDKVSGLEAGADDYITKPFS 109


>gi|260767644|ref|ZP_05876579.1| chemotaxis regulator CheY [Vibrio furnissii CIP 102972]
 gi|260617153|gb|EEX42337.1| chemotaxis regulator CheY [Vibrio furnissii CIP 102972]
 gi|315179525|gb|ADT86439.1| chemotaxis protein CheY [Vibrio furnissii NCTC 11218]
          Length = 126

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLRNIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|206889466|ref|YP_002249856.1| putative Chemotaxis protein CheY [Thermodesulfovibrio yellowstonii
           DSM 11347]
 gi|206741404|gb|ACI20461.1| putative Chemotaxis protein CheY [Thermodesulfovibrio yellowstonii
           DSM 11347]
          Length = 124

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 5/118 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGV 59
            +L+VD     RK+   +    G+ V  A +  EA +    E + N ++ D +M   +G+
Sbjct: 2   KVLIVDDDKTTRKMISLILKSKGYEVVTAENGIEALQKLGLERI-NLILTDMNMPYMDGI 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            EFI  VR  P   ++ +  +  E D ++      AG + +L+KP N E +  +M+++
Sbjct: 61  -EFIKQVRANPDIANIPIVMITTEADEDEKRRAFEAGVDDYLVKPTNAEQISESMKKI 117


>gi|86356289|ref|YP_468181.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CFN 42]
 gi|86280391|gb|ABC89454.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CFN 42]
          Length = 121

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 49/105 (46%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R +     N+ GF   +A    E  E  E E  P+ +V D +M  +    
Sbjct: 5   VLTVDDSRTIRNMLLVTLNNAGFDTIQAEDGVEGLEVLE-ESNPDVIVTDINMPRLDGFG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           FI  VR+      + +  L  E D EK     +AGA  +++KPF+
Sbjct: 64  FIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|332885682|gb|EGK05928.1| hypothetical protein HMPREF9456_02192 [Dysgonomonas mossii DSM
           22836]
          Length = 377

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 48/93 (51%), Gaps = 3/93 (3%)

Query: 20  LFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV 77
           L +  GF V  A     A E   K++ P+ +++D +M  +   E I  V++  L  ++ V
Sbjct: 26  LLDKEGFNVVTANDGQAAIEIIRKDV-PDLILLDINMPNMDGFEVIREVKKYSLYREIPV 84

Query: 78  YYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +L    D + ++ G R G + ++ KPFN+E L
Sbjct: 85  IFLTAMNDVDSIVKGFRLGGSDYITKPFNKEEL 117


>gi|117928994|ref|YP_873545.1| response regulator receiver protein [Acidothermus cellulolyticus
           11B]
 gi|117649457|gb|ABK53559.1| response regulator receiver protein [Acidothermus cellulolyticus
           11B]
          Length = 141

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 54/108 (50%), Gaps = 2/108 (1%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           +++D S  +R +   +    GF V EA +  EA    E   LP+  +ID +M  +  L F
Sbjct: 23  MVIDDSSAMRLILGRIMRGLGFDVVEAPNGAEAIARLESGTLPDIALIDWNMPVMDGLAF 82

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  VR+     ++ +  +  E +  +++    AGA+ +++KPF  + +
Sbjct: 83  VNAVRKREEWRNITLMMVTTESEQSQIVRALAAGAHEYVIKPFTPDAI 130


>gi|254422985|ref|ZP_05036703.1| response regulator receiver domain protein [Synechococcus sp. PCC
           7335]
 gi|196190474|gb|EDX85438.1| response regulator receiver domain protein [Synechococcus sp. PCC
           7335]
          Length = 233

 Score = 42.7 bits (99), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +LLVD    +R+  +    D  F V  A++  E  E  ++E+ PN L+ D  M  V   +
Sbjct: 8   ILLVDDEPGLRESVQAYLEDSDFEVRVASNAQEGWELLQQEI-PNVLISDIMMPQVDGYQ 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+  VR+      + V +L         I G +AGA+++L KPF+ E L
Sbjct: 67  FLKQVREDARFQALPVVFLTARGMTSDRIQGYQAGADAYLPKPFDPEEL 115


>gi|291613019|ref|YP_003523176.1| response regulator receiver protein [Sideroxydans lithotrophicus
           ES-1]
 gi|291583131|gb|ADE10789.1| response regulator receiver protein [Sideroxydans lithotrophicus
           ES-1]
          Length = 132

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 63/125 (50%), Gaps = 8/125 (6%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A      E   +++V D +M  +  ++
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFANVQEAEDGVDALNKLRSETF-DFVVSDWNMPNMTGID 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL---- 117
            +  +R       + V  +  E   E +IA A+AGA+ +++KPF   TL   ++++    
Sbjct: 68  LLRAIRADNSLKHLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATLDEKLKKIFAAF 127

Query: 118 PQMQK 122
           PQ+ K
Sbjct: 128 PQLNK 132


>gi|103486250|ref|YP_615811.1| two component transcriptional regulator [Sphingopyxis alaskensis
           RB2256]
 gi|98976327|gb|ABF52478.1| two component transcriptional regulator, winged helix family
           [Sphingopyxis alaskensis RB2256]
          Length = 244

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/134 (26%), Positives = 62/134 (46%), Gaps = 8/134 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M  +LL+D    +R+         GF V +A S  EAR     + + + +V D  M G  
Sbjct: 6   MPRILLIDDEPSIREPLGEYLTAQGFAVTDAASAAEARSVLRAKSV-DLVVSDIMMPGED 64

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            L    H+R+    + + V  L    +  + I G   GA+ +++KPFN   L   +R + 
Sbjct: 65  GLSLTRHLRET---SSIPVILLTARAEDTERIIGLEIGADDYVVKPFNPRELVARIRTV- 120

Query: 119 QMQKSKDENQFLDA 132
            +++++   + LDA
Sbjct: 121 -LRRTQQNGRSLDA 133


>gi|298530465|ref|ZP_07017867.1| response regulator receiver protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298509839|gb|EFI33743.1| response regulator receiver protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 120

 Score = 42.7 bits (99), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 59/118 (50%), Gaps = 6/118 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           +++ VD S  VR++      D G+ V EA    +A +  + ++  + ++ D    +M+G+
Sbjct: 4   TIMTVDDSSSVRQMVSFTLKDAGYSVVEAADGKDALQKLQGQV--DMIITDLNMPNMDGI 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            E I +VR       + +  L  E   EK   G +AGA+ +++KPF    +   +++L
Sbjct: 62  -ELIKNVRATSGYKFIPIVMLTTESQDEKKQEGKKAGASGWIVKPFKPPQILSVVQKL 118


>gi|219849580|ref|YP_002464013.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219543839|gb|ACL25577.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 236

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 49/106 (46%), Gaps = 3/106 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD    + K+ R      GF V  A     A     +E  P+ +V+D  + G+  L
Sbjct: 4   TILVVDDEPGIVKIARDYLERAGFHVISAGDGPSALRLARQEH-PSLIVLDLMLPGMDGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           +    +RQ PL   V +  L   V+    + G   GA+ ++ KPF+
Sbjct: 63  DVTRALRQDPLTAGVPIIMLTARVEETDRLIGLELGADDYITKPFS 108


>gi|56460224|ref|YP_155505.1| chemotaxis protein CheY [Idiomarina loihiensis L2TR]
 gi|56179234|gb|AAV81956.1| Chemotaxis protein CheY [Idiomarina loihiensis L2TR]
          Length = 123

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 60/118 (50%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T++ EA +      LP       +++V D +
Sbjct: 2   KILVVDDFSTMRRIIKNLLRDLGF-----TNIQEADD--GNTALPMLQNGDFDFVVTDWN 54

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  +R+      + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 55  MPGMQGIDLLREIRKDDNLAHLPVLMVTAEAKREQIIMAAQAGVNGYIVKPFTAVTLK 112


>gi|149925935|ref|ZP_01914198.1| response regulator [Limnobacter sp. MED105]
 gi|149825223|gb|EDM84434.1| response regulator [Limnobacter sp. MED105]
          Length = 1026

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S + R +  H+   +G+ V  A S  EA E  E++     ++ D  M G+   E
Sbjct: 13  ILVVDDSVVERNLFVHMVAKWGYPVEFAASGQEAIELVERDRF-QLVLADWQMPGMQGTE 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
               +RQ+ LG   ++  +  + D E +I    AGA+  L KP +   L
Sbjct: 72  LCVALRQLDLGQYTYIILMSAQNDEEFLIKALDAGADDVLTKPVDGNEL 120



 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 53/115 (46%), Gaps = 3/115 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+++VD S    ++   + + +G+ V  A +  EA    EK   P++++ D  M G+  +
Sbjct: 451 SIVIVDDSRSFLRIFEAMLHSWGYTVHSAKNGHEALALIEKHQ-PDFVLTDWDMPGMSGI 509

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           E    VR        ++  +      + ++   R GA+ F+ KP N   L+  ++
Sbjct: 510 ELCEQVRAQKQNAYTYIIMITGYASRDDLLNSLRVGADDFMTKPVNPGELKVRLK 564


>gi|114777170|ref|ZP_01452181.1| two component, sigma54 specific, transcriptional regulator, Fis
           family protein [Mariprofundus ferrooxydans PV-1]
 gi|114552315|gb|EAU54798.1| two component, sigma54 specific, transcriptional regulator, Fis
           family protein [Mariprofundus ferrooxydans PV-1]
          Length = 228

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 30/105 (28%), Positives = 51/105 (48%), Gaps = 4/105 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+VD   I+R + + L    G  V  A+   EA    E++  P+ +++D  + G   + 
Sbjct: 7   ILIVDDEEIIRSILKKLLLTMGHEVTTASGSEEAIALIEQQR-PDIILLDIVLPGDNSMN 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            +  VRQ P      +  +    + + M    +AGA+ FLLKPFN
Sbjct: 66  IVQTVRQ-PHKHHTAIVMISGHDNLDTMAKYIQAGADDFLLKPFN 109


>gi|207092642|ref|ZP_03240429.1| chemotaxis protein [Helicobacter pylori HPKX_438_AG0C1]
 gi|2199516|gb|AAB66375.1| chemotaxis response regulator [Helicobacter pylori]
          Length = 124

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++  +  G+  V EA    EA E  +       L+ D +M  +  L
Sbjct: 3   LLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 63  DLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|42524790|ref|NP_970170.1| response regulator of hydrogenase 3 activity (sensor HydH)
           [Bdellovibrio bacteriovorus HD100]
 gi|39577000|emb|CAE78229.1| response regulator of hydrogenase 3 activity (sensor HydH)
           [Bdellovibrio bacteriovorus HD100]
          Length = 467

 Score = 42.4 bits (98), Expect = 0.019,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 62/130 (47%), Gaps = 6/130 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGVL 60
           +L++D    +R     + +  G  V  A  + EA+  C+ +   +  ++D ++   +G+ 
Sbjct: 6   VLILDDESSLRTALFRVLDRKGLNVITANKIEEAKVLCQGDSPVDLAIVDLNLPDGDGI- 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           EF+ +++ +   T+V +  L      E  I   + GA  F+ KPFN E L   + +    
Sbjct: 65  EFMTYLKALTPATEVII--LTGHATIESAIRATQKGAFHFVTKPFNLEELMSLIEKALTH 122

Query: 121 QKSKDENQFL 130
           +K + ENQ L
Sbjct: 123 KKLQQENQQL 132


>gi|182680518|ref|YP_001834664.1| response regulator receiver protein [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182636401|gb|ACB97175.1| response regulator receiver protein [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 121

 Score = 42.4 bits (98), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 35/117 (29%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L VD S  +R +      D G+ V +A    +  E   +E+ P+ +V D +M  +   
Sbjct: 4   TVLTVDDSRTMRDMLLLTLLDAGYRVLQAEDGEKGLEVLAQEI-PDVIVTDINMPRLDGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            FI  VR       V +  L  E D EK     RAGA  +++KPF+   L  A+R +
Sbjct: 63  GFIKGVRGDARHRAVPILVLTTESDAEKKDRARRAGATGWIVKPFDPVKLVDAIRRV 119


>gi|300726400|ref|ZP_07059850.1| putative DNA-binding response regulator/sensor histidine kinase
           [Prevotella bryantii B14]
 gi|299776300|gb|EFI72860.1| putative DNA-binding response regulator/sensor histidine kinase
           [Prevotella bryantii B14]
          Length = 778

 Score = 42.4 bits (98), Expect = 0.020,   Method: Composition-based stats.
 Identities = 31/112 (27%), Positives = 58/112 (51%), Gaps = 4/112 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           + ++L+VD +  +RK    LF D  + V EA       +   +E +P+ +V D  M  + 
Sbjct: 506 LPTILVVDENSDMRKFLHTLFAD-NYYVIEAADGQSGLKLA-REGVPDLIVSDIIMPVMN 563

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            LEF   +++ P+ + + V  L  +    ++I G + GA +++ KPFN + L
Sbjct: 564 GLEFCKRIKEDPITSHIPVLLLSAQSTDHQLIEGFKNGAEAYITKPFNAQLL 615


>gi|291276453|ref|YP_003516225.1| chemotaxis regulatory protein [Helicobacter mustelae 12198]
 gi|290963647|emb|CBG39479.1| chemotaxis regulatory protein [Helicobacter mustelae 12198]
          Length = 124

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G+  + EA    EA +    +   + L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLQRLGYEDILEAEHGVEAWDILNGDSKIDVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE +   R      D+ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LELVKKTRADARYEDIPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|262170943|ref|ZP_06038621.1| chemotaxis regulator CheY [Vibrio mimicus MB-451]
 gi|261892019|gb|EEY38005.1| chemotaxis regulator CheY [Vibrio mimicus MB-451]
          Length = 126

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 57/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLRNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|169335013|ref|ZP_02862206.1| hypothetical protein ANASTE_01419 [Anaerofustis stercorihominis DSM
           17244]
 gi|169257751|gb|EDS71717.1| hypothetical protein ANASTE_01419 [Anaerofustis stercorihominis DSM
           17244]
          Length = 233

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 3/103 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           L++ D   IV+ +  +L N+ G+ +FEA    EA    EKE +  +L++ + M   L+ I
Sbjct: 7   LVVDDDKEIVKAINIYLSNE-GYNIFEAYDGYEALSVLEKEEI--HLIVLDIMMPKLDGI 63

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           A + ++    +V V +L  + +    I G   GA+ ++ KPFN
Sbjct: 64  ATITKVREKQNVPVIFLSAKSEDTDKIIGLNIGADDYVTKPFN 106


>gi|118619772|ref|YP_908104.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium ulcerans Agy99]
 gi|160012527|sp|A0PWB4|MPRA_MYCUA RecName: Full=Response regulator mprA; AltName: Full=Mycobacterial
           persistence regulator A
 gi|118571882|gb|ABL06633.1| mycobacterial persistence regulator MprA [Mycobacterium ulcerans
           Agy99]
          Length = 232

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 39/125 (31%), Positives = 58/125 (46%), Gaps = 5/125 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA E    +  P+ LV+D  M  +  LE
Sbjct: 5   ILVVDDDRAVRESLRRSLSFNGYTVELAHDGVEALEMIASDR-PDALVLDVMMPRLDGLE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 64  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 121

Query: 122 KSKDE 126
           K +D+
Sbjct: 122 KLEDD 126


>gi|283852821|ref|ZP_06370084.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Desulfovibrio sp. FW1012B]
 gi|283571813|gb|EFC19810.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Desulfovibrio sp. FW1012B]
          Length = 372

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 4/125 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L +D   I  +V   L  + G       S  EAR   +  +  + +++D  M     F 
Sbjct: 20  ILAIDDERINLRVIGGLLRNLGHEPILTESFTEARGLLDASI--DLVLLDVMMPETDGFT 77

Query: 64  A--HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+MP  +DV +  +      +  +    AGAN F+ KP +   LR  M  L +M+
Sbjct: 78  VARRIREMPGVSDVPIIMVTALTSKQDRLKAVEAGANDFISKPIDLTELRVRMGSLLKMK 137

Query: 122 KSKDE 126
           +S+DE
Sbjct: 138 ESQDE 142


>gi|261868543|ref|YP_003256465.1| two-component response regulator [Aggregatibacter
           actinomycetemcomitans D11S-1]
 gi|261413875|gb|ACX83246.1| TorCAD operon transcriptional regulatory protein TorR
           [Aggregatibacter actinomycetemcomitans D11S-1]
          Length = 235

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 4/125 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+V+   I R   + +F   G+ VFEA+   +  +  + E + + +++D ++ G    +
Sbjct: 6   ILIVEDETITRNTLKSIFEAEGYEVFEASDGTQMHQVLDTEDI-HLVIMDINLPGKNGLM 64

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
              R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L  +Q++
Sbjct: 65  L-ARELRENADIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL--LQRT 121

Query: 124 KDENQ 128
             ENQ
Sbjct: 122 MQENQ 126


>gi|298528058|ref|ZP_07015462.1| response regulator receiver protein [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511710|gb|EFI35612.1| response regulator receiver protein [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 378

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 53/104 (50%), Gaps = 3/104 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +L+VD S + R++ R + N  G+ + EA    +ARE   +E LP+ +++D  M  E   +
Sbjct: 12  ILIVDDSPLNRRMLRVVLNKAGYRIQEAEDGLQAREMA-REHLPDLILLDVMMPHEDGFD 70

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
               +++     D+ + ++    D E ++ G   G   ++ KPF
Sbjct: 71  TCIKLKKQSSTQDIPIIFISALNDTENIVKGLELGGVDYISKPF 114


>gi|197334742|ref|YP_002156659.1| chemotaxis protein CheY [Vibrio fischeri MJ11]
 gi|197316232|gb|ACH65679.1| chemotaxis protein CheY [Vibrio fischeri MJ11]
          Length = 126

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPLLKKGGF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 65  IDLLKTIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 116


>gi|196230258|ref|ZP_03129121.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
 gi|196225855|gb|EDY20362.1| response regulator receiver protein [Chthoniobacter flavus
           Ellin428]
          Length = 204

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 26/118 (22%), Positives = 57/118 (48%), Gaps = 4/118 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           ++ +L+ +  ++ R +      ++GF V  A     A E  E    P+  ++D     M+
Sbjct: 6   INRILVAEDHYVSRHLLERNLQNWGFEVISAQDGAAAAEILEGPEAPSIAILDWMMPRMD 65

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           GV E    +R+      +++  L  +   +++  G  AGA+ +++KPF+ + LR  ++
Sbjct: 66  GV-EVCQRIRKNHKNPYIYLLMLTAKSQKDEIATGLDAGADDYVIKPFDPDELRARLK 122


>gi|15645681|ref|NP_207858.1| chemotaxis protein (cheY) [Helicobacter pylori 26695]
 gi|108562805|ref|YP_627121.1| chemotaxis protein [Helicobacter pylori HPAG1]
 gi|208434327|ref|YP_002265993.1| chemotaxis protein [Helicobacter pylori G27]
 gi|254779070|ref|YP_003057175.1| Chemotactic response regulator, two-component system [Helicobacter
           pylori B38]
 gi|298736679|ref|YP_003729207.1| chemotaxis family two-component system response regulator CheY
           [Helicobacter pylori B8]
 gi|308182549|ref|YP_003926676.1| Chemotactic response regulator, two-component system [Helicobacter
           pylori PeCan4]
 gi|308184182|ref|YP_003928315.1| Chemotactic response regulator, two-component system [Helicobacter
           pylori SJM180]
 gi|2500738|sp|P71403|CHEY_HELPY RecName: Full=Chemotaxis protein CheY homolog
 gi|2314217|gb|AAD08113.1| chemotaxis protein (cheY) [Helicobacter pylori 26695]
 gi|4103138|gb|AAD01682.1| CheY [Helicobacter pylori NCTC 11637]
 gi|107836578|gb|ABF84447.1| chemotaxis protein [Helicobacter pylori HPAG1]
 gi|208432256|gb|ACI27127.1| chemotaxis protein [Helicobacter pylori G27]
 gi|254000981|emb|CAX28925.1| Chemotactic response regulator, two-component system [Helicobacter
           pylori B38]
 gi|281429784|gb|ADA70031.1| CheY [Helicobacter pylori SS1]
 gi|298355871|emb|CBI66743.1| two-component system, chemotaxis family, response regulator CheY
           [Helicobacter pylori B8]
 gi|308060102|gb|ADO01998.1| Chemotactic response regulator, two-component system [Helicobacter
           pylori SJM180]
 gi|308064734|gb|ADO06626.1| Chemotactic response regulator, two-component system [Helicobacter
           pylori PeCan4]
 gi|317009026|gb|ADU79606.1| Chemotactic response regulator, two-component system [Helicobacter
           pylori India7]
 gi|317013823|gb|ADU81259.1| Chemotactic response regulator, two-component system [Helicobacter
           pylori Gambia94/24]
          Length = 124

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++  +  G+  V EA    EA E  +       L+ D +M  +  L
Sbjct: 3   LLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 63  DLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|220920432|ref|YP_002495733.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
 gi|219945038|gb|ACL55430.1| response regulator receiver protein [Methylobacterium nodulans ORS
           2060]
          Length = 127

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+VD    + ++ R+L    GF   +  S         K+     ++ D +ME +   E
Sbjct: 9   ILVVDDYQTMVRIIRNLLKQLGFEEVDDASDGTGALAKLKQKKYGLVISDWNMEPMTGYE 68

Query: 62  FIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            + HVR    L T  F+  +  E   E +IA  +AG N++++KPFN +TL+
Sbjct: 69  LLRHVRADDALRTTPFIM-VTAESKTENVIAAKKAGVNNYIVKPFNAQTLK 118


>gi|148546766|ref|YP_001266868.1| response regulator receiver protein [Pseudomonas putida F1]
 gi|148510824|gb|ABQ77684.1| response regulator receiver protein [Pseudomonas putida F1]
 gi|313497817|gb|ADR59183.1| Response regulator receiver protein [Pseudomonas putida BIRD-1]
          Length = 128

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    E     ++LV D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFTNTDEADDGTTALPMLENGHY-DFLVTDWNMPGMSG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 65  IDLLRKVRASDKLKSMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|293390558|ref|ZP_06634892.1| TorCAD operon transcriptional regulatory protein TorR
           [Aggregatibacter actinomycetemcomitans D7S-1]
 gi|290951092|gb|EFE01211.1| TorCAD operon transcriptional regulatory protein TorR
           [Aggregatibacter actinomycetemcomitans D7S-1]
          Length = 235

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 31/125 (24%), Positives = 61/125 (48%), Gaps = 4/125 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+V+   I R   + +F   G+ VFEA+   +  +  + E + + +++D ++ G    +
Sbjct: 6   ILIVEDETITRNTLKSIFEAEGYEVFEASDGTQMHQVLDTEDI-HLVIMDINLPGKNGLM 64

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
              R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L  +Q++
Sbjct: 65  L-ARELRENADIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL--LQRT 121

Query: 124 KDENQ 128
             ENQ
Sbjct: 122 MQENQ 126


>gi|59712440|ref|YP_205216.1| chemotaxis regulator CheY, transmits signal to flagellar motor
           component [Vibrio fischeri ES114]
 gi|59480541|gb|AAW86328.1| chemotaxis regulator CheY, transmits signal to flagellar motor
           component [Vibrio fischeri ES114]
          Length = 122

 Score = 42.4 bits (98), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPLLKKGGF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLKTIRADDELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|290790025|pdb|3GWG|A Chain A, Crystal Structure Of Chey Of Helicobacter Pylori
 gi|290790026|pdb|3H1E|A Chain A, Crystal Structure Of Mg(2+) And Beh(3)(-)-Bound Chey Of
           Helicobacter Pylori
          Length = 129

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++  +  G+  V EA    EA E  +       L+ D +M  +  L
Sbjct: 8   LLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGL 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 68  DLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 118


>gi|291279592|ref|YP_003496427.1| two-component system, chemotaxis family, response regulator CheY
           [Deferribacter desulfuricans SSM1]
 gi|290754294|dbj|BAI80671.1| two-component system, chemotaxis family, response regulator CheY
           [Deferribacter desulfuricans SSM1]
          Length = 122

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 11/112 (9%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES-----MEG 58
           +L+VD S +VR    ++    GF   E  +  +  +  EK L  NY +I        M+G
Sbjct: 5   ILVVDDSDLVRHFHSNILRASGF---ETDTAVDGMDALEKALSNNYSLILSDLNMPRMDG 61

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            L FI  +R+    T V +  +  + + E  IAG +AGAN +++KP   + L
Sbjct: 62  -LTFIKELRKADNETPVII--ITTQEENENRIAGLKAGANLYIVKPVKPQDL 110


>gi|254785492|ref|YP_003072921.1| response regulator receiver domain-containing protein
           [Teredinibacter turnerae T7901]
 gi|237685475|gb|ACR12739.1| response regulator receiver domain protein [Teredinibacter turnerae
           T7901]
          Length = 128

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTHEADDGTTA--LPMLRSGDFDFLVTDWN 58

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 59  MPGMTGIDLLKEVRADAKLAGLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|39996140|ref|NP_952091.1| sensory box histidine kinase/response regulator [Geobacter
           sulfurreducens PCA]
 gi|39982905|gb|AAR34364.1| sensory box histidine kinase/response regulator [Geobacter
           sulfurreducens PCA]
 gi|307634791|gb|ADI83878.2| response receiver histidine kinase [Geobacter sulfurreducens KN400]
          Length = 513

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 37/125 (29%), Positives = 59/125 (47%), Gaps = 8/125 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +LLVD   + RK+ R+LF   G+ V +A     A E   +EL P+ +++D     M+G  
Sbjct: 23  ILLVDDDAVTRKMLRNLFTLSGYRVADAEDGARAVEMF-RELSPDLVLLDIMMPVMDG-Y 80

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              A +R +P G  V +  +    D   +     AGA  F+ KP N   L      LP +
Sbjct: 81  GACAAIRGLPGGEHVPIIIMTALDDANSIGRAFDAGATDFIEKPVNWMLLNH---RLPYL 137

Query: 121 QKSKD 125
            +++D
Sbjct: 138 LRARD 142


>gi|51094316|gb|AAT95326.1| response regulator [Bifidobacterium breve UCC2003]
          Length = 243

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 1/115 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+++VD    +R++     +  GF V  A S  EA E  EK + P+ +V+D  +  +  F
Sbjct: 8   SIVVVDDEPSIRELLVASLHFAGFEVNTAASGSEAIEVIEK-VQPDLIVLDVMLPDIDGF 66

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               R    G D  V +L    D +  I G   G + ++ KPF+ E +   +R +
Sbjct: 67  TVTRRIRQEGIDAPVLFLTARDDTQDKIMGLTVGGDDYVTKPFSLEEVVARIRAI 121


>gi|307133596|dbj|BAJ19085.1| GppX [Tannerella forsythia]
          Length = 710

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 59/118 (50%), Gaps = 8/118 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--ELLPNYLVIDESMEGV-- 59
           LL+++ +H +      LF D     +  +     +E  EK  +L+P+ ++ D  M G+  
Sbjct: 462 LLVIEDNHDIAAYIGSLFADR----YAVSYAANGKEGMEKALDLVPDLIITDLMMPGMDG 517

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           LE    VR   +   + +  +  ++  E+ I G  AGA++++ KPFN + LR  + +L
Sbjct: 518 LEVCRQVRGNEIINHIPIIVVTAKITEEERIKGLEAGADAYISKPFNADELRTRVEKL 575


>gi|41407014|ref|NP_959850.1| hypothetical protein MAP0916 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118464125|ref|YP_880347.1| two component response transcriptional regulator MprA
           [Mycobacterium avium 104]
 gi|254773974|ref|ZP_05215490.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium avium subsp. avium ATCC 25291]
 gi|81700688|sp|Q742C1|MPRA_MYCPA RecName: Full=Response regulator mprA; AltName: Full=Mycobacterial
           persistence regulator A
 gi|160012422|sp|A0QBQ9|MPRA_MYCA1 RecName: Full=Response regulator mprA; AltName: Full=Mycobacterial
           persistence regulator A
 gi|41395365|gb|AAS03233.1| hypothetical protein MAP_0916 [Mycobacterium avium subsp.
           paratuberculosis K-10]
 gi|118165412|gb|ABK66309.1| mycobacterial persistence regulator mrpa [Mycobacterium avium 104]
          Length = 228

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 38/127 (29%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA +    +  P+ LV+D  M  +  LE
Sbjct: 3   ILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDR-PDALVLDVMMPRLDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 62  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 119

Query: 122 KSKDENQ 128
           K +D+ +
Sbjct: 120 KPEDDAE 126


>gi|253701161|ref|YP_003022350.1| response regulator receiver sensor signal transduction histidine
           kinase [Geobacter sp. M21]
 gi|251776011|gb|ACT18592.1| response regulator receiver sensor signal transduction histidine
           kinase [Geobacter sp. M21]
          Length = 396

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 7/110 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L+VD   ++  +   +  + G+ VF A S  E  E  +KE  P  +++D    +M+G+ 
Sbjct: 12  VLIVDDEKVILDLTAIILKNRGYQVFTALSALEGLETIDKE-RPELVLLDYMMPNMDGLT 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
                 R  P   D +V     +   E  +   +AGA+ ++LKPFN + L
Sbjct: 71  ALKEIRRSYP---DTYVIMFTGKGSEEIAVELMKAGASDYILKPFNNQDL 117


>gi|291457450|ref|ZP_06596840.1| DNA-binding response regulator PhoP [Bifidobacterium breve DSM
           20213]
 gi|291381285|gb|EFE88803.1| DNA-binding response regulator PhoP [Bifidobacterium breve DSM
           20213]
          Length = 243

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 54/115 (46%), Gaps = 1/115 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+++VD    +R++     +  GF V  A S  EA E  EK + P+ +V+D  +  +  F
Sbjct: 8   SIVVVDDEPSIRELLVASLHFAGFEVNTAASGSEAIEVIEK-VQPDLIVLDVMLPDIDGF 66

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               R    G D  V +L    D +  I G   G + ++ KPF+ E +   +R +
Sbjct: 67  TVTRRIRQEGIDAPVLFLTARDDTQDKIMGLTVGGDDYVTKPFSLEEVVARIRAI 121


>gi|170740463|ref|YP_001769118.1| response regulator receiver protein [Methylobacterium sp. 4-46]
 gi|168194737|gb|ACA16684.1| response regulator receiver protein [Methylobacterium sp. 4-46]
          Length = 127

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+VD    + ++ R+L    GF   +  S         K+     ++ D +ME +   E
Sbjct: 9   ILVVDDYQTMVRIIRNLLKQLGFEDVDDASDGTGALAKLKQKKYGLVISDWNMEPMTGYE 68

Query: 62  FIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            + HVR    L T  F+  +  E   E +IA  +AG N++++KPFN +TL+
Sbjct: 69  LLRHVRADDALRTTPFIM-VTAESKTENVIAAKKAGVNNYIVKPFNAQTLK 118


>gi|297617890|ref|YP_003703049.1| response regulator receiver protein [Syntrophothermus lipocalidus
           DSM 12680]
 gi|297145727|gb|ADI02484.1| response regulator receiver protein [Syntrophothermus lipocalidus
           DSM 12680]
          Length = 124

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 52/111 (46%), Gaps = 5/111 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEGV 59
           +L+ D S ++R    ++    GF V  A    +A E       P  +VI +    +++G 
Sbjct: 5   ILVADDSEMIRNFHSYILKSAGFDVVTAVDGADALEKAYGSSAPWAVVITDINMPNLDG- 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
              I H+R  P   D+ +  +  E + +    G  AGAN++L+KP +  TL
Sbjct: 64  YALIEHLRGEPEFEDIPIIIVSTEDELKDKQRGFEAGANAYLVKPTDPATL 114


>gi|1653994|emb|CAA57487.1| cheY [Helicobacter pylori NCTC 11637]
          Length = 140

 Score = 42.4 bits (98), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++  +  G+  V EA    EA E  +       L+ D +M  +  L
Sbjct: 19  LLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGL 78

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 79  DLVKKVRSDSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 129


>gi|189461492|ref|ZP_03010277.1| hypothetical protein BACCOP_02151 [Bacteroides coprocola DSM 17136]
 gi|189431826|gb|EDV00811.1| hypothetical protein BACCOP_02151 [Bacteroides coprocola DSM 17136]
          Length = 1373

 Score = 42.4 bits (98), Expect = 0.022,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 57/116 (49%), Gaps = 4/116 (3%)

Query: 2    DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL- 60
            D+LL+V+    +R   R  F  + + V +  +  EA ++   E  P+ ++ D  M G   
Sbjct: 1095 DTLLIVEDHEELRYYLRKTFEHY-YRVIDVANGKEALDYLSNEY-PDLILSDVMMPGTQG 1152

Query: 61   -EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
             E    V++ P    +    L  + +++ ++ G + GA+ ++ KPF+ E L+  +R
Sbjct: 1153 DELCQMVKENPDTAGIPFILLTAKTNYDAVVEGLKKGADDYIPKPFSTEILKLKVR 1208


>gi|301059424|ref|ZP_07200345.1| putative Response regulator PleD [delta proteobacterium NaphS2]
 gi|300446460|gb|EFK10304.1| putative Response regulator PleD [delta proteobacterium NaphS2]
          Length = 312

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 52/109 (47%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+ + + + RK+        G+ V  A +  EA +  ++   P  ++ D  M  +  LE
Sbjct: 7   ILIAEDNAVSRKLMEKTLRQAGYAVVSAANGREAFKIFKERFFP-IILTDWGMPEMDGLE 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
               +R+ P    VF++ +      + +I G  AGA+ +L KPF+R  L
Sbjct: 66  LCRAIRENPTEGYVFIFLITGRDSRKDIIVGLEAGADDYLTKPFDRSEL 114


>gi|56550975|ref|YP_161814.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241761436|ref|ZP_04759524.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|260753351|ref|YP_003226244.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
 gi|56542549|gb|AAV88703.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis ZM4]
 gi|241374343|gb|EER63840.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis ATCC 10988]
 gi|258552714|gb|ACV75660.1| response regulator receiver protein [Zymomonas mobilis subsp.
           mobilis NCIMB 11163]
          Length = 121

 Score = 42.4 bits (98), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 54/117 (46%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           +++ VD S  +R + R      G+ + EA    +A E       P+ L+ D +M  +  F
Sbjct: 4   TIMTVDDSPSMRMLLRAALGKMGYTIIEAEDGIDAMEKLSNNR-PDLLITDINMPRMDGF 62

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             I  VRQ     ++ +  L  E   EK      AGA  +++KPF+ + L  A+R +
Sbjct: 63  GLIESVRQDDSWRNMPILVLTTETSDEKKQRARIAGATGWIVKPFSPDKLAAAIRRV 119


>gi|329908546|ref|ZP_08274890.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Oxalobacteraceae
           bacterium IMCC9480]
 gi|327546688|gb|EGF31641.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Oxalobacteraceae
           bacterium IMCC9480]
          Length = 132

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 62/120 (51%), Gaps = 12/120 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE--FCEKELLP---NYLVIDESMEGV 59
           L+VD    +R++ R+L  + G+     T+V EA +      +L     +++V D +M  +
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGY-----TNVDEAEDGAMALAKLRAGQFDFVVSDWNMPVM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             L  + ++R  P    + V  +  E   E +IA A+AGAN +++KPF   TL   ++++
Sbjct: 64  DGLTMLQNIRADPALAKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATLDEKLKKI 123


>gi|309790461|ref|ZP_07685022.1| two component transcriptional regulator [Oscillochloris trichoides
           DG6]
 gi|308227509|gb|EFO81176.1| two component transcriptional regulator [Oscillochloris trichoides
           DG6]
          Length = 226

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 59/118 (50%), Gaps = 8/118 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L+VD  + +R++ R      G+ V +A    +  E   ++  P+ +++D     M+GV
Sbjct: 5   TILVVDDDNGLRELIRINLEHEGYTVIQAADGLQCLELV-RDQRPDLVILDVMMPEMDGV 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            E    +R+  L   + V  L  +V  E +I G   GA+ +LLKPFN   L   +R L
Sbjct: 64  -EACTKLREFSL---LPVLMLTAKVQSEDVIQGLDCGADDYLLKPFNMNELSARIRAL 117


>gi|26991030|ref|NP_746455.1| response regulator receiver protein [Pseudomonas putida KT2440]
 gi|24986060|gb|AAN69919.1|AE016630_10 chemotaxis protein CheY [Pseudomonas putida KT2440]
          Length = 124

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ ++L  D GF    EA     A    E     ++LV D +M G+  +
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGFTNTDEADDGTTALPMLENGHY-DFLVTDWNMPGMSGI 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 62  DLLRKVRASDKLKSMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 112


>gi|298244434|ref|ZP_06968240.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
 gi|297551915|gb|EFH85780.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
          Length = 235

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 2/103 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+L+VD    VR + +  F+  GF VF AT+  +A +  + E  P+ +++D  + G  + 
Sbjct: 17  SVLIVDDEPQVRDLLQMGFSYEGFQVFLATNGPDATQVAQ-EQQPDVVILDLMLPG-YDG 74

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
           +   R++    D+ +  L    + +  + G  AGA+ +L KPF
Sbjct: 75  LEVTRRLRRSRDLPIIMLTARDEIDDRVTGLDAGADDYLTKPF 117


>gi|220909984|ref|YP_002485295.1| two component LuxR family transcriptional regulator [Cyanothece sp.
           PCC 7425]
 gi|219866595|gb|ACL46934.1| two component transcriptional regulator, LuxR family [Cyanothece
           sp. PCC 7425]
          Length = 226

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 60/130 (46%), Gaps = 7/130 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    +R+  +    D GF V  A +     E  +++  P+ ++ D  M  V   +
Sbjct: 5   LLLVDDEPGLREAVQAYLEDSGFSVAAAPNAQAGWELLQQQ-TPDLVITDIMMPQVDGYQ 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL----RFAMREL 117
           F+  +R  P  + + V +L      +  I G  AG +++L KPF+ + L    +  +R+ 
Sbjct: 64  FLQQLRDDPRYSRLPVVFLTARGMTKDRIQGHNAGVDAYLAKPFDPDELVAIVKNILRQR 123

Query: 118 PQMQKSKDEN 127
              Q S+  N
Sbjct: 124 TNQQSSESTN 133


>gi|228469513|ref|ZP_04054508.1| DNA-binding response regulator/sensor histidine kinase
           [Porphyromonas uenonis 60-3]
 gi|228308952|gb|EEK17621.1| DNA-binding response regulator/sensor histidine kinase
           [Porphyromonas uenonis 60-3]
          Length = 958

 Score = 42.4 bits (98), Expect = 0.023,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 43/82 (52%), Gaps = 2/82 (2%)

Query: 44  ELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFL 101
           EL+P+ ++ D  M G+  L+    +R   +   + +  +  +V  E+ I G  AGA+++L
Sbjct: 735 ELVPDIIITDLMMPGLNGLDLCRQIRGNEIVNHIPIIVVTAKVSEEERIKGIEAGADAYL 794

Query: 102 LKPFNRETLRFAMRELPQMQKS 123
            KPFN   LR  +  L   +K+
Sbjct: 795 TKPFNTTELRMQVERLLDSRKT 816


>gi|109896413|ref|YP_659668.1| two-component response regulator [Pseudoalteromonas atlantica T6c]
 gi|332304474|ref|YP_004432325.1| two component transcriptional regulator, winged helix family
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|109698694|gb|ABG38614.1| two component transcriptional regulator, winged helix family
           [Pseudoalteromonas atlantica T6c]
 gi|332171803|gb|AEE21057.1| two component transcriptional regulator, winged helix family
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 235

 Score = 42.4 bits (98), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 55/115 (47%), Gaps = 2/115 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+   + R   + LF   G+ VFEA +  E  EF E   + N +++D ++ G    
Sbjct: 5   NILIVEDEVVTRTTLKSLFEAEGYNVFEAENGSEMHEFFENHAI-NLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           I   R++    ++ + +L    +    I G   GA+ +L KPFN   L    R L
Sbjct: 64  IL-AREVRDRKNIGLIFLTGRDNDVDRILGLEIGADDYLTKPFNPRELTIRARNL 117


>gi|209695721|ref|YP_002263651.1| chemotaxis protein CheY [Aliivibrio salmonicida LFI1238]
 gi|208009674|emb|CAQ79973.1| chemotaxis protein CheY [Aliivibrio salmonicida LFI1238]
          Length = 122

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPLLKKGGF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 61  IDLLKTIRADGELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 112


>gi|157961207|ref|YP_001501241.1| response regulator receiver protein [Shewanella pealeana ATCC
           700345]
 gi|157846207|gb|ABV86706.1| response regulator receiver protein [Shewanella pealeana ATCC
           700345]
          Length = 135

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 14  KILVVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQKGDF-DFVVTDWNMPGMQG 72

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 73  IDLLKAIRADDNLKHLPVLMVTAEAKREQIITAAQAGVNGYVVKPFTAATLK 124


>gi|194334237|ref|YP_002016097.1| response regulator receiver protein [Prosthecochloris aestuarii DSM
           271]
 gi|194312055|gb|ACF46450.1| response regulator receiver protein [Prosthecochloris aestuarii DSM
           271]
          Length = 122

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 56/111 (50%), Gaps = 7/111 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           +L++D S  +R++   L ++ G  F V  A +   A E  E+ + P+  ++D +M G+  
Sbjct: 6   ILIIDDSASIRRL---LAHNLGKRFEVLVADNANHALELLEQGVTPDLAIVDVAMPGMDG 62

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F  +  +++ P  + + +  L    +      G + GA+ +L KPFN E L
Sbjct: 63  FSLVERLKKDPSYSTIPIIMLTARDESADKEKGLKLGADDYLTKPFNTEDL 113


>gi|269797048|ref|YP_003316503.1| CheY-like receiver domain/HTH DNA-binding domain-containing
           response regulator [Sanguibacter keddieii DSM 10542]
 gi|269099233|gb|ACZ23669.1| response regulator containing a CheY-like receiver domain and an
           HTH DNA-binding domain [Sanguibacter keddieii DSM 10542]
          Length = 221

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 56/120 (46%), Gaps = 4/120 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+VD   +VR+  R +  D G  V    S           L P+ +++D  M G L
Sbjct: 1   MTTVLVVDDQPLVRQAVRDILTDGGVDVVGEASTGHEAVRAAAALAPDVVLMDIRMPG-L 59

Query: 61  EFIAHVRQM---PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           + IA   Q+   P G+   V  L    + E ++A  RAGA+ F+ K    + +  A+R +
Sbjct: 60  DGIAATEQICAGPAGSTTRVLVLTTFEEDEYVVAALRAGASGFIGKGAEPDDIVRAVRTV 119


>gi|121609136|ref|YP_996943.1| response regulator receiver protein [Verminephrobacter eiseniae
           EF01-2]
 gi|121553776|gb|ABM57925.1| response regulator receiver protein [Verminephrobacter eiseniae
           EF01-2]
          Length = 120

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S+L VD S  +RK+        G+ V EA    +A E  E   + + ++ D++M  + 
Sbjct: 1   MPSILAVDDSPSMRKMVAFTLTGAGYHVVEAVDGQDALEKAETHRI-DLVLADQNMPRLD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            L     +R++P    + +  L  E   +   AG  AGA  +L+KPF+   L
Sbjct: 60  GLGLTRKLRELPKFKTIPILILTTESSDQMKQAGRTAGATGWLVKPFDPHRL 111


>gi|238894401|ref|YP_002919135.1| hypothetical protein KP1_2384 [Klebsiella pneumoniae NTUH-K2044]
 gi|238546717|dbj|BAH63068.1| conserved hypothetical protein [Klebsiella pneumoniae subsp.
           pneumoniae NTUH-K2044]
          Length = 404

 Score = 42.4 bits (98), Expect = 0.024,   Method: Composition-based stats.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEGV 59
           +L+V+ S + R++   +   +G++V EA +  +A    E +  P  LVI +     M G 
Sbjct: 6   VLIVEDSLVYRRLLSRMLTQWGYIVSEAENGVDALAILENQ--PVSLVISDWEMPEMNG- 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L     +R+   G  V++  L    D   +  G  AGA+ FL KP  +  LR
Sbjct: 63  LTLCREIRRRQFGRYVYLILLTAREDPGDLTQGFEAGADDFLSKPVEQSELR 114


>gi|119946934|ref|YP_944614.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase [Psychromonas ingrahamii 37]
 gi|119865538|gb|ABM05015.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase [Psychromonas ingrahamii 37]
          Length = 711

 Score = 42.4 bits (98), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 58/136 (42%), Gaps = 13/136 (9%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD     R + R       F V EA     A    E  + P+ +++D  M G+ 
Sbjct: 1   MTRVLVVDDDITARLMARQALGKENFAVIEAEDGFAALALFEA-VQPDIVLLDVEMPGMN 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR--- 115
             E    +R+ P G  V +     + D + +     AGA  F+ KPFN + L   +R   
Sbjct: 60  GFEVCRQLRRFPCGKLVPILMATGQDDLDSVRQAYEAGATDFVTKPFNWKILAHRLRYMV 119

Query: 116 -------ELPQMQKSK 124
                  +L ++QKS+
Sbjct: 120 RASDITEQLEELQKSE 135


>gi|330502784|ref|YP_004379653.1| response regulator receiver protein [Pseudomonas mendocina NK-01]
 gi|328917070|gb|AEB57901.1| response regulator receiver protein [Pseudomonas mendocina NK-01]
          Length = 128

 Score = 42.4 bits (98), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGF-----TNTAEADDGTSA--LPMLQSGSFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 60  PGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|290790028|pdb|3H1G|A Chain A, Crystal Structure Of Chey Mutant T84a Of Helicobacter
           Pylori
          Length = 129

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++  +  G+  V EA    EA E  +       L+ D +M  +  L
Sbjct: 8   LLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGL 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 68  DLVKKVRSDSRFKEIPIIMITAEGGKAEVITALKAGVNNYIVKPFTPQVLK 118


>gi|325107081|ref|YP_004268149.1| response regulator receiver protein [Planctomyces brasiliensis DSM
           5305]
 gi|324967349|gb|ADY58127.1| response regulator receiver protein [Planctomyces brasiliensis DSM
           5305]
          Length = 121

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/113 (27%), Positives = 54/113 (47%), Gaps = 8/113 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEA-REFCEKELLPNYLVIDESME--G 58
           ++LLVD S   R + +   +  G+  +FEA     A R F EK +  + +  D +M    
Sbjct: 2   NILLVDDSSTTRLIAKKTLSSLGYDSIFEAPDGAAALRTFTEKPI--DVIFTDWNMPIMN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            LE +  +R   +  +V V  +  E    K++   + G N +L+KPF  + L+
Sbjct: 60  GLELLRQIRA--IDQNVPVIMITTEGSRAKVLEAIQNGVNDYLVKPFTPQALK 110


>gi|167034904|ref|YP_001670135.1| response regulator receiver protein [Pseudomonas putida GB-1]
 gi|166861392|gb|ABY99799.1| response regulator receiver protein [Pseudomonas putida GB-1]
          Length = 128

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    E     ++LV D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFTNTEEADDGTTALPMLENGHY-DFLVTDWNMPGMSG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 65  IDLLRKVRASEKLKSMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|15887864|ref|NP_353545.1| chemotaxis receiver protein [Agrobacterium tumefaciens str. C58]
 gi|325291905|ref|YP_004277769.1| chemotaxis receiver protein [Agrobacterium sp. H13-3]
 gi|3282791|gb|AAC25076.1| CheY homolog [Agrobacterium tumefaciens]
 gi|15155450|gb|AAK86330.1| chemotaxis receiver protein [Agrobacterium tumefaciens str. C58]
 gi|325059758|gb|ADY63449.1| chemotaxis receiver protein [Agrobacterium sp. H13-3]
          Length = 121

 Score = 42.0 bits (97), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 49/105 (46%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R +     N+ GF   +A    E  E  E+   P+ +V D +M  +    
Sbjct: 5   VLTVDDSRTIRNMLLVTLNNAGFETIQAEDGIEGLEVLEQSN-PDVIVTDINMPRLDGFG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           FI  VR+      + +  L  E D EK     +AGA  +++KPF+
Sbjct: 64  FIEGVRRNEKYRAIPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|149202612|ref|ZP_01879584.1| nitrogen assimilation regulatory protein NtrX [Roseovarius sp.
           TM1035]
 gi|149143894|gb|EDM31928.1| nitrogen assimilation regulatory protein NtrX [Roseovarius sp.
           TM1035]
          Length = 469

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 9/135 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID-----ES 55
           M  +L+VD    +R++   +  D G+    A +  EA      E  P  L++D       
Sbjct: 1   MSDILIVDDERDIRELISDILEDEGYATRRAGNSDEAMAAIAAEQ-PGLLILDIWLKDSH 59

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G+       R+ P   DV V  +    + E  +A  + GA  F+ KPFN + L   +R
Sbjct: 60  MDGIDILKTVKREYP---DVPVVIISGHGNIEIAVAAIKQGAYDFIEKPFNIDQLMVVIR 116

Query: 116 ELPQMQKSKDENQFL 130
              +  + + ENQ L
Sbjct: 117 RGMETSRLRRENQAL 131


>gi|89073162|ref|ZP_01159701.1| putative transcriptional regulator [Photobacterium sp. SKA34]
 gi|89051115|gb|EAR56572.1| putative transcriptional regulator [Photobacterium sp. SKA34]
          Length = 404

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 54/124 (43%), Gaps = 2/124 (1%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLEF 62
           L+VD S +VR    HL       V+EA+   EA +  +     + ++ D  M  +  +  
Sbjct: 127 LVVDDSDMVRNHVSHLLKKQNLTVYEASDGNEALQIIDDNPDISLVITDNDMPEKDGITM 186

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+     ++ V  L    D        +AGAN FL KPFN+E     +  +  M+ 
Sbjct: 187 TREIRREYSRNEMAVLGLSGSDDNTMTAQFLKAGANDFLYKPFNQEEFNCRIHHILNMKD 246

Query: 123 SKDE 126
           + D+
Sbjct: 247 TSDK 250


>gi|251793101|ref|YP_003007827.1| two-component response regulator [Aggregatibacter aphrophilus
           NJ8700]
 gi|247534494|gb|ACS97740.1| TorCAD operon transcriptional regulatory protein TorR
           [Aggregatibacter aphrophilus NJ8700]
          Length = 234

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 4/126 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+   I R   + +F   G+ VFEA+   +  +  + + + + +++D ++ G    
Sbjct: 5   QILIVEDETITRNTLKSIFEAEGYDVFEASDGSQMHKILDTQTI-HLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
           +   R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L  +Q+
Sbjct: 64  ML-ARELRENADIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL--LQR 120

Query: 123 SKDENQ 128
           +  ENQ
Sbjct: 121 TMQENQ 126


>gi|255320247|ref|ZP_05361432.1| protein PetR [Acinetobacter radioresistens SK82]
 gi|262380462|ref|ZP_06073616.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acinetobacter radioresistens SH164]
 gi|255302686|gb|EET81918.1| protein PetR [Acinetobacter radioresistens SK82]
 gi|262297908|gb|EEY85823.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acinetobacter radioresistens SH164]
          Length = 254

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 13/128 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEG 58
           ++ +L+VD    +R + +    D GF+V  A    +     ++EL  + +V+D    +E 
Sbjct: 20  VERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDATQMDRLLQRELF-SLIVLDFMLPVED 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            L     +RQ     D+ +  L         IAG  AGA+ +L KPFN        R  L
Sbjct: 79  GLSICRRLRQS--NIDIPIIMLTARGSDSDRIAGLEAGADDYLPKPFNPNELLARIRAVL 136

Query: 111 RFAMRELP 118
           R  +RE+P
Sbjct: 137 RRQVREVP 144


>gi|83749534|ref|ZP_00946522.1| Probable chemotaxis response regulator protein (cheY1) [Ralstonia
           solanacearum UW551]
 gi|207725010|ref|YP_002255407.1| chemotaxis response regulator protein [Ralstonia solanacearum
           MolK2]
 gi|207738652|ref|YP_002257045.1| chemotaxis response regulator protein [Ralstonia solanacearum
           IPO1609]
 gi|83723809|gb|EAP70999.1| Probable chemotaxis response regulator protein (cheY1) [Ralstonia
           solanacearum UW551]
 gi|206590238|emb|CAQ37199.1| chemotaxis response regulator protein [Ralstonia solanacearum
           MolK2]
 gi|206592020|emb|CAQ58926.1| chemotaxis response regulator protein [Ralstonia solanacearum
           IPO1609]
          Length = 133

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L+VD    +R++ R+L  + GF   +      A     KE   ++++ D +M  +  L+ 
Sbjct: 9   LVVDDFPTMRRIVRNLLKELGFANVDEAEDGAAGLAKVKEGRFDFVISDWNMPNMDGLQM 68

Query: 63  IAHVRQMP-LGTDVF-VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R  P  G +   V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 69  LQGIRADPNPGINKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 118


>gi|114319835|ref|YP_741518.1| two-component response regulator CbrB [Alkalilimnicola ehrlichii
           MLHE-1]
 gi|114226229|gb|ABI56028.1| Two-component response regulator CbrB [Alkalilimnicola ehrlichii
           MLHE-1]
          Length = 453

 Score = 42.0 bits (97), Expect = 0.026,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 62/136 (45%), Gaps = 13/136 (9%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE---FCEKELLPNYLVI-DESM 56
           M  LL+++   ++R   R L    G+ V EA S+ EARE   F + +L+   L +  E  
Sbjct: 1   MAHLLIIEDEAVIRSALRRLLTRNGYRVAEAESLEEAREGHRFADYDLIIADLRLPGEPG 60

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
            GV+         PL ++V V  +         +   R GA  ++ KPF+ + L   + +
Sbjct: 61  TGVI---------PLASEVPVIIMTSYASVRSAVEAMREGAVDYIAKPFDHDELLLTVDK 111

Query: 117 LPQMQKSKDENQFLDA 132
           + +  + + +N  L A
Sbjct: 112 VLKDHRLQRQNAALKA 127


>gi|300697979|ref|YP_003748640.1| Chemotaxis protein cheY; chemotactic response regulator [Ralstonia
           solanacearum CFBP2957]
 gi|299074703|emb|CBJ54260.1| Chemotaxis protein cheY; chemotactic response regulator [Ralstonia
           solanacearum CFBP2957]
          Length = 133

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L+VD    +R++ R+L  + GF   +      A     KE   ++++ D +M  +  L+ 
Sbjct: 9   LVVDDFPTMRRIVRNLLKELGFANVDEAEDGAAGLAKVKEGRFDFVISDWNMPNMDGLQM 68

Query: 63  IAHVRQMP-LGTDVF-VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R  P  G +   V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 69  LQGIRADPNPGINKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 118


>gi|119476299|ref|ZP_01616650.1| two-component response regulator CheY [marine gamma proteobacterium
           HTCC2143]
 gi|119450163|gb|EAW31398.1| two-component response regulator CheY [marine gamma proteobacterium
           HTCC2143]
          Length = 124

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T++ EA +      LP       +++V D +M
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGF-----TNMAEADDGSTA--LPMLRNGDFDFVVTDWNM 55

Query: 57  EGVLEF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  F  +  VR       + V  +  E   +++IA A+AG N +++KPF    L+
Sbjct: 56  PGMSGFDLLKAVRADEKLKTLPVLMVTAEAKRDQIIAAAQAGVNGYIVKPFTAAVLK 112


>gi|17549621|ref|NP_522961.1| chemotaxis response regulator transcription regulator protein
           [Ralstonia solanacearum GMI1000]
 gi|17431875|emb|CAD18553.1| probable chemotaxis response regulator transcription regulator
           protein [Ralstonia solanacearum GMI1000]
 gi|299069786|emb|CBJ41065.1| Chemotaxis protein cheY; chemotactic response regulator [Ralstonia
           solanacearum CMR15]
          Length = 133

 Score = 42.0 bits (97), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L+VD    +R++ R+L  + GF   +      A     KE   ++++ D +M  +  L+ 
Sbjct: 9   LVVDDFPTMRRIVRNLLKELGFANVDEAEDGAAGLAKVKEGRFDFVISDWNMPNMDGLQM 68

Query: 63  IAHVRQMP-LGTDVF-VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R  P  G +   V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 69  LQGIRADPNPGINKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 118


>gi|325523756|gb|EGD02010.1| sigma-54 interacting response regulator protein [Burkholderia sp.
           TJI49]
          Length = 461

 Score = 42.0 bits (97), Expect = 0.027,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARNALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQALRA 133


>gi|86610346|ref|YP_479108.1| response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558888|gb|ABD03845.1| response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 373

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 52/117 (44%), Gaps = 3/117 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M ++L+VD    +R V +      G+ V  A++  E  E     L+P  ++ D  M  + 
Sbjct: 1   MTTILIVDDDPTIRLVLKRSLERQGYTVEMASNGSEGLEQAHL-LVPGLIICDWMMPDMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            LE    ++  P  +  F   L    + E  I G  AGA+ FL KP +   LR  +R
Sbjct: 60  GLEVCRRIKADPKFSTTFFILLTARTEVEDRIQGLDAGADEFLSKPIDPNELRARVR 116


>gi|163943024|ref|YP_001647908.1| response regulator receiver protein [Bacillus weihenstephanensis
           KBAB4]
 gi|229014505|ref|ZP_04171623.1| Sporulation initiation phosphotransferase F [Bacillus mycoides DSM
           2048]
 gi|229020556|ref|ZP_04177299.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           AH1273]
 gi|229026775|ref|ZP_04183107.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           AH1272]
 gi|229033969|ref|ZP_04188922.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           AH1271]
 gi|229064986|ref|ZP_04200284.1| Sporulation initiation phosphotransferase F [Bacillus cereus AH603]
 gi|229136155|ref|ZP_04264908.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           BDRD-ST196]
 gi|229164285|ref|ZP_04292217.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           R309803]
 gi|229170045|ref|ZP_04297736.1| Sporulation initiation phosphotransferase F [Bacillus cereus AH621]
 gi|163865221|gb|ABY46280.1| response regulator receiver protein [Bacillus weihenstephanensis
           KBAB4]
 gi|228613392|gb|EEK70526.1| Sporulation initiation phosphotransferase F [Bacillus cereus AH621]
 gi|228619168|gb|EEK76062.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           R309803]
 gi|228647314|gb|EEL03396.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           BDRD-ST196]
 gi|228716287|gb|EEL67999.1| Sporulation initiation phosphotransferase F [Bacillus cereus AH603]
 gi|228728344|gb|EEL79367.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           AH1271]
 gi|228734498|gb|EEL85160.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           AH1272]
 gi|228740742|gb|EEL90997.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           AH1273]
 gi|228746855|gb|EEL96740.1| Sporulation initiation phosphotransferase F [Bacillus mycoides DSM
           2048]
          Length = 122

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 62/117 (52%), Gaps = 7/117 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +  +A +  +K+  P+ +V+D  + G+  +
Sbjct: 4   KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKD-NPDLVVLDMKIPGMDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETLRFAMRE 116
           E + HV+++     V +     E+D   MI  A+  GA     KPF+ + +R A+R+
Sbjct: 63  EILKHVKEIDESIKVILMTAYGELD---MIQEAKDLGALMHFAKPFDIDEIRQAVRD 116


>gi|146307826|ref|YP_001188291.1| response regulator receiver protein [Pseudomonas mendocina ymp]
 gi|145576027|gb|ABP85559.1| response regulator receiver protein [Pseudomonas mendocina ymp]
          Length = 139

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 18  ILIVDDFSTMRRIIKNLLRDLGF-----TNTAEADDGTSA--LPMLQSGSFDFLVTDWNM 70

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 71  PGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 127


>gi|302873857|ref|YP_003842490.1| response regulator receiver sensor signal transduction histidine
           kinase [Clostridium cellulovorans 743B]
 gi|307689897|ref|ZP_07632343.1| response regulator receiver sensor signal transduction histidine
           kinase [Clostridium cellulovorans 743B]
 gi|302576714|gb|ADL50726.1| response regulator receiver sensor signal transduction histidine
           kinase [Clostridium cellulovorans 743B]
          Length = 366

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 38/143 (26%), Positives = 66/143 (46%), Gaps = 17/143 (11%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L+VD +    K+   +  + G+ ++  TS  EA E   K +  N +++D     M+G  
Sbjct: 9   ILVVDDTPFNIKIVSTILQEVGYNIYSTTSGREALEMV-KNIRFNLILLDVMMPEMDG-Y 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRE----------TL 110
           E I  ++      D+ + +L    D E ++     GA  +L+KPFN +           L
Sbjct: 67  EVIRKLKNDEDTRDIPIIFLTARGDSESVVRAFDEGAYDYLIKPFNPKELLSRVKTHIEL 126

Query: 111 RFAMRELPQMQKSKDENQFLDAI 133
           +FA   L +  K+KD  +FL  I
Sbjct: 127 KFARENLEEANKTKD--KFLSII 147


>gi|210134575|ref|YP_002301014.1| chemotaxis protein [Helicobacter pylori P12]
 gi|210132543|gb|ACJ07534.1| chemotaxis protein [Helicobacter pylori P12]
 gi|317012219|gb|ADU82827.1| chemotaxis protein [Helicobacter pylori Lithuania75]
          Length = 124

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++  +  G+  V EA    EA E  +       L+ D +M  +  L
Sbjct: 3   LLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 63  DLVKKVRADSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|126664989|ref|ZP_01735972.1| CheY-like receiver protein [Marinobacter sp. ELB17]
 gi|126630359|gb|EBA00974.1| CheY-like receiver protein [Marinobacter sp. ELB17]
          Length = 123

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 53/111 (47%), Gaps = 2/111 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++ ++L  D GF   +            K    ++LV D +M G+  F
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGFTNTDEADDGNTAMPMLKTGKYDFLVTDWNMPGMSGF 61

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             + +VR       + +  +  E   ++++A A+AG N +++KPF    L+
Sbjct: 62  DLLKNVRADDQLKTLPILMVTAEAKRDQIVAAAQAGVNGYIIKPFTAAVLK 112


>gi|300694363|ref|YP_003750336.1| chemotaxis protein chey; chemotactic response regulator [Ralstonia
           solanacearum PSI07]
 gi|299076400|emb|CBJ35716.1| Chemotaxis protein cheY; chemotactic response regulator [Ralstonia
           solanacearum PSI07]
          Length = 133

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L+VD    +R++ R+L  + GF   +      A     KE   ++++ D +M  +  L+ 
Sbjct: 9   LVVDDFPTMRRIVRNLLKELGFANVDEAEDGAAGLAKVKEGRFDFVISDWNMPNMDGLQM 68

Query: 63  IAHVRQMP-LGTDVF-VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R  P  G +   V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 69  LQGIRADPNPGINKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 118


>gi|188592093|ref|YP_001796691.1| chemotaxis protein chey; chemotactic response regulator
           [Cupriavidus taiwanensis LMG 19424]
 gi|170938467|emb|CAP63454.1| Chemotaxis protein cheY; chemotactic response regulator
           [Cupriavidus taiwanensis LMG 19424]
          Length = 128

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 2/109 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    +R++ R+L  + GF+  E      A     K+    +++ D +M  +  L 
Sbjct: 7   ILVVDDFPTMRRIIRNLLKELGFVNVEEAEDGGAGLEKAKDGSFQFVISDWNMPNMDGLS 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R       + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 67  MLQAIRADANIGKIPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 115


>gi|108760999|ref|YP_632634.1| response regulator/GGDEF domain-containing protein [Myxococcus
           xanthus DK 1622]
 gi|108464879|gb|ABF90064.1| response regulator/GGDEF domain protein [Myxococcus xanthus DK
           1622]
          Length = 457

 Score = 42.0 bits (97), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 39/136 (28%), Positives = 63/136 (46%), Gaps = 13/136 (9%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDF----GFMVFEATSVCEAREFCEKELLPNYLVIDESM 56
           M  +LLVD      K+ R L+ D+    G  V    ++ EA+E    +   + +V D  +
Sbjct: 1   MARILLVDDE----KIARTLYGDYLTAVGHAVTAVGTLQEAKEALAGDRF-DAVVTDLIL 55

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            G   +E + HVR+   G +V V   L +VD    +   ++GA  +L+KP   E L+ A+
Sbjct: 56  PGGDGMEVLRHVREHHPGVEVVVITGLEKVD--PAVRAIKSGAAEYLVKPVAPEALQHAV 113

Query: 115 RELPQMQKSKDENQFL 130
           R     +    EN  L
Sbjct: 114 RRALTTRDLMQENASL 129


>gi|203284476|ref|YP_002222216.1| chemotaxis response regulator [Borrelia duttonii Ly]
 gi|201083919|gb|ACH93510.1| chemotaxis response regulator [Borrelia duttonii Ly]
          Length = 124

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 56/112 (50%), Gaps = 5/112 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA----REFCEKELLPNYLVIDESMEGV 59
           +L++D +  +R+   ++    GF V EA    E     +E   +      LVI +     
Sbjct: 5   ILVIDDNRAIRQSVAYILEQNGFAVAEAQDGLEGVSKFKEAVGQSDKDFDLVITDINMPN 64

Query: 60  LEFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L+ I  ++++  LG+ V +  L  E +  K+  G +AGA  +L+KPFN +TL
Sbjct: 65  LDGIGVIKEIRGLGSFVPILVLTTESEQSKVDEGRKAGATGWLVKPFNPDTL 116


>gi|154252823|ref|YP_001413647.1| response regulator receiver protein [Parvibaculum lavamentivorans
           DS-1]
 gi|154156773|gb|ABS63990.1| response regulator receiver protein [Parvibaculum lavamentivorans
           DS-1]
          Length = 208

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 51/109 (46%), Gaps = 5/109 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKEL--LPNYLVIDESMEGVLE 61
           +L++D    +R+    LF   G    EA +    RE  E +L  +P+ LV+D  + G   
Sbjct: 8   VLIIDDDLAMRESLESLFRSLGH---EARAFATGRELVESDLPDMPSCLVLDVRLPGASG 64

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
               +  + LG D+ + ++    D    +A  +AGA  FL KPF  + L
Sbjct: 65  LELQLELLRLGFDLPIVFITGHGDVPMSVAAMKAGAIEFLTKPFREQEL 113


>gi|317180724|dbj|BAJ58510.1| response regulator [Helicobacter pylori F32]
          Length = 124

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ R+  +  G+  V EA    EA E          L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIRNTLSRLGYEDVLEAEHGVEAWEKLNANADTKVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L+ +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LDLVIKVRADERFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|116694199|ref|YP_728410.1| chemotaxis response regulator [Ralstonia eutropha H16]
 gi|113528698|emb|CAJ95045.1| chemotaxis response regulator [Ralstonia eutropha H16]
          Length = 128

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 2/109 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    +R++ R+L  + GF+  E      A     K+    +++ D +M  +  L 
Sbjct: 7   ILVVDDFPTMRRIIRNLLKELGFVNVEEAEDGAAGLEKAKDGSFQFVISDWNMPNMDGLT 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R       + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 67  MLQAIRADANIGKIPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 115


>gi|144897301|emb|CAM74165.1| Response regulator receiver [Magnetospirillum gryphiswaldense
           MSR-1]
          Length = 129

 Score = 42.0 bits (97), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 8/120 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNY--LVIDESMEGV 59
           ++L+VD    + ++ R+L    GF  V EAT    A +      + NY  ++ D +ME +
Sbjct: 8   NVLIVDDYKTMLRIIRNLLKQLGFNNVDEATDGSMALQMLR---VGNYGLIISDWNMEPM 64

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             L+ +  VR       +    +  E   E +IA   AG +++++KPFN ETL+  M  +
Sbjct: 65  TGLQLLREVRSDAKLKSIPFIMVTAESKSENVIAAKEAGVSNYIVKPFNAETLKTKMSSV 124


>gi|302843336|ref|XP_002953210.1| hypothetical protein VOLCADRAFT_93905 [Volvox carteri f.
           nagariensis]
 gi|300261597|gb|EFJ45809.1| hypothetical protein VOLCADRAFT_93905 [Volvox carteri f.
           nagariensis]
          Length = 1844

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 5/116 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVID---ESMEGV 59
           LL VD  H+ + V + L    G+ V    S  EA R       LP+ +++D     M+G 
Sbjct: 774 LLSVDDDHVNQSVVKSLLGSTGYEVVAVPSGPEALRYVATAPALPDLVLLDCMMPEMDG- 832

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            E +  +R M     V +  +  + + E ++ G   GA+ ++ KPF R  L   +R
Sbjct: 833 YEVLQRLRAMTPNVHVPIIMVSAQTEEEHVVCGLDLGADDYVTKPFKRNELLARIR 888


>gi|78065724|ref|YP_368493.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Burkholderia sp. 383]
 gi|77966469|gb|ABB07849.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia sp. 383]
          Length = 461

 Score = 42.0 bits (97), Expect = 0.029,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQSLRA 133


>gi|302878246|ref|YP_003846810.1| response regulator receiver protein [Gallionella capsiferriformans
           ES-2]
 gi|302581035|gb|ADL55046.1| response regulator receiver protein [Gallionella capsiferriformans
           ES-2]
          Length = 129

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 61/118 (51%), Gaps = 4/118 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF+ V EA    EA +    E   +++V D +M  +  +E
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFVNVQEAEDGVEALKKLRAETY-DFVVSDWNMPNMTGIE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            +  +R       + V  +  E   E +I  A+AGA+ +++KPF   TL   ++++ Q
Sbjct: 68  LLREIRADAKLKHLPVLMVTAEAKRENIIEAAQAGASGYVVKPFTAATLDEKLKKIFQ 125


>gi|114763420|ref|ZP_01442827.1| diguanylate cyclase [Pelagibaca bermudensis HTCC2601]
 gi|114543958|gb|EAU46969.1| diguanylate cyclase [Roseovarius sp. HTCC2601]
          Length = 314

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 53/114 (46%), Gaps = 10/114 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK----ELLPNYLVID--- 53
           M   + VD S I R++ +    DFG+   + +S    +E  E     E+  + +++D   
Sbjct: 1   MRKFIAVDDSEIARELIKATLADFGY--HDVSSFGNPKEALESMSASEVAADLVLLDVMM 58

Query: 54  ESMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNR 107
             M+GV E  A +R +    DV +  L    D   +     AGAN +L KPF+R
Sbjct: 59  PEMDGV-ELCARIRALDKWRDVPIVMLTSREDKSTLSRAFMAGANDYLTKPFDR 111


>gi|332707455|ref|ZP_08427504.1| two-component response regulator, CheY subfamily [Lyngbya majuscula
           3L]
 gi|332353806|gb|EGJ33297.1| two-component response regulator, CheY subfamily [Lyngbya majuscula
           3L]
          Length = 236

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 5/107 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESME 57
           M  +L+VD    +  + +      G+ V +  S  EA E C K   P+ +V D     M+
Sbjct: 1   MKKILVVDDDKTLLTLLKRYLEHRGYQVEQVCSGTEALEACVKNP-PDLVVSDVLMPEMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKP 104
           G LEF   +R +P G  +   +L  + + E  I G   GA+ +L KP
Sbjct: 60  G-LEFCRRLRNIPNGRLMPFIFLSSKAELEDRINGHSMGADDYLTKP 105


>gi|327481247|gb|AEA84557.1| two-component response regulator CheY [Pseudomonas stutzeri DSM
           4166]
          Length = 128

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 7   ILIVDDFSTMRRIIKNLLRDLGF-----TNTAEADDGTTA--LPMLKSGSFDFLVTDWNM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 60  PGMSGIDLLRTVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|237751140|ref|ZP_04581620.1| chemotaxis regulatory protein CheY [Helicobacter bilis ATCC 43879]
 gi|229373585|gb|EEO23976.1| chemotaxis regulatory protein CheY [Helicobacter bilis ATCC 43879]
          Length = 124

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G+  + EA    EA          N L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLQRLGYEDILEAEHGVEAWNQMSTIEGINVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LELVKKVRAEEKYKDIPIIMVTTEGGKSEVITALKAGVNNYIVKPFTPQVLK 113


>gi|325273564|ref|ZP_08139792.1| response regulator receiver protein [Pseudomonas sp. TJI-51]
 gi|324101303|gb|EGB98921.1| response regulator receiver protein [Pseudomonas sp. TJI-51]
          Length = 128

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    E     ++LV D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFTNTDEADDGTTALPMLENGHY-DFLVTDWNMPGMSG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 65  IDLLRKVRAHDRLKTMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|297570436|ref|YP_003691780.1| Fis family transcriptional regulator [Desulfurivibrio alkaliphilus
           AHT2]
 gi|296926351|gb|ADH87161.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Desulfurivibrio alkaliphilus AHT2]
          Length = 448

 Score = 42.0 bits (97), Expect = 0.030,   Method: Composition-based stats.
 Identities = 38/123 (30%), Positives = 58/123 (47%), Gaps = 7/123 (5%)

Query: 13  VRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE---FIAHVRQM 69
           +R+V  H     GF V  A S  +  E  + E     LVI +   G L+    +A +++ 
Sbjct: 14  LRRVTGHNLERAGFTVRLAASGRQGLELFKAESFD--LVITDVKLGDLDGLTVLAAIKER 71

Query: 70  PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQF 129
              T V V      +D    +   + GA +F+ KPF+RETLR A R+  +M+  K  N+ 
Sbjct: 72  APETPVIVITAFGSIDLA--VRAMQEGAFTFITKPFDRETLRLACRKALEMRNLKLRNRD 129

Query: 130 LDA 132
           L A
Sbjct: 130 LAA 132


>gi|268589997|ref|ZP_06124218.1| chemotaxis protein CheY [Providencia rettgeri DSM 1131]
 gi|291314716|gb|EFE55169.1| chemotaxis protein CheY [Providencia rettgeri DSM 1131]
          Length = 130

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           S L+VD    +R++ R+L  + GF  + EA    +A E      + +++V D +M  +  
Sbjct: 7   SFLVVDDFSTMRRIVRNLLKELGFNKIEEAEDGVDALEKIRTGSI-DFVVADWNMPNMDG 65

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           LE +  +R       + V  +  E   E +IA A+AGA+ +++KPF    L
Sbjct: 66  LELLKTIRGDDALKHIPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAAIL 116


>gi|219871643|ref|YP_002476018.1| two-component response regulator [Haemophilus parasuis SH0165]
 gi|219691847|gb|ACL33070.1| aerobic respiration control protein ArcA/two-component response
           regulator, DNA-binding response regulator in
           two-component regulatory system with ArcB or CpxA
           [Haemophilus parasuis SH0165]
          Length = 238

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 2/117 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+   + R   + +F   G+ VFEAT   E     +   + N +++D ++ G    
Sbjct: 5   QILIVEDEAVTRSTLKSIFEAEGYDVFEATDGNEMNTILDNHEI-NLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +   R++   TD+ + +L    +    I G   GA+ ++ KPFN   L    R L Q
Sbjct: 64  ML-ARELRENTDIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLQ 119


>gi|71906375|ref|YP_283962.1| response regulator receiver [Dechloromonas aromatica RCB]
 gi|71845996|gb|AAZ45492.1| Response regulator receiver [Dechloromonas aromatica RCB]
          Length = 131

 Score = 42.0 bits (97), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 32/113 (28%), Positives = 57/113 (50%), Gaps = 12/113 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE--FCEKELLPN---YLVIDESMEGV 59
           L+VD    +R++ R+L  + G+     T+V EA +     ++L      ++V D +M  +
Sbjct: 10  LVVDDFSTMRRIVRNLLKELGY-----TNVDEAEDGAIALQKLQAGGFEFVVTDWNMPNM 64

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             L  +  +R  P    + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 65  DGLTLLQTIRATPNLKHLPVLMITAEAKKENIIAAAQAGASGYIVKPFTAGTL 117


>gi|331006361|ref|ZP_08329671.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [gamma proteobacterium
           IMCC1989]
 gi|330419821|gb|EGG94177.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [gamma proteobacterium
           IMCC1989]
          Length = 126

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 57/118 (48%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTQEADDGLTA--LPMLKGGDFDFLVTDWN 58

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  +E +  VR       +    +  E   ++++  A+AG N +++KPF  + L+
Sbjct: 59  MPGMTGIELLKEVRADDKLASLPTLMVTAEAKKDQIVEAAQAGVNGYVVKPFTAQALK 116


>gi|258592053|emb|CBE68358.1| putative response regulator in two-component reguatory system,
           sigma54 dependent transcriptional regulator [NC10
           bacterium 'Dutch sediment']
          Length = 455

 Score = 42.0 bits (97), Expect = 0.031,   Method: Composition-based stats.
 Identities = 38/129 (29%), Positives = 58/129 (44%), Gaps = 5/129 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +L+VD    +R+V R      GF V EA+   +A     +EL P   ++D  M  +  LE
Sbjct: 8   ILVVDDDTDIREVIRDRLKAMGFEVVEASDGEQALVRLREEL-PTITLLDLHMPKKSGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +  +R+  L T   V  +      EK +   R GA  FL KPF+   L   + +  + +
Sbjct: 67  VLQAIRENGLETTTIV--MTAYATIEKAVEAMRVGAYDFLTKPFSPGHLEVVIGKALERE 124

Query: 122 KSKDENQFL 130
             K EN  L
Sbjct: 125 GLKRENLLL 133


>gi|218674017|ref|ZP_03523686.1| chemotaxis two-component response regulator protein [Rhizobium etli
           GR56]
          Length = 122

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R   +   ++ G+ V EA    E     +     + +V D     M+G 
Sbjct: 4   NILTVDDSASIRLTTKVTLSNAGYNVTEAADGAEGLATAKSRSF-DLIVTDLNMPVMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R++P    V + +L  E D +       AGA  +L KPF+ E L
Sbjct: 62  LTMIEELRKLPGQAGVPIIFLTTESDADLKARAKAAGATGWLTKPFDPENL 112


>gi|190893346|ref|YP_001979888.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CIAT 652]
 gi|218513510|ref|ZP_03510350.1| chemotaxis two-component response regulator protein [Rhizobium etli
           8C-3]
 gi|190698625|gb|ACE92710.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CIAT 652]
          Length = 122

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R   +   ++ G+ V EA    E     +     + +V D     M+G 
Sbjct: 4   NILTVDDSASIRLTTKVTLSNAGYNVTEAVDGAEGLATAKSSRF-DLIVTDLNMPVMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R++P    V + +L  E D +       AGA  +L KPF+ E L
Sbjct: 62  LTMIEELRKLPGQAGVPIIFLTTESDTDLKARAKAAGATGWLTKPFDPENL 112


>gi|225573147|ref|ZP_03781902.1| hypothetical protein RUMHYD_01338 [Blautia hydrogenotrophica DSM
           10507]
 gi|225039502|gb|EEG49748.1| hypothetical protein RUMHYD_01338 [Blautia hydrogenotrophica DSM
           10507]
          Length = 223

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 65/130 (50%), Gaps = 3/130 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY-LVIDESMEGV 59
           M  +L+ D  +++R + + +  +  + V EA +  EA E   +   P   LVI + M   
Sbjct: 1   MKKILVADDDYLLRDLIKDILEEKNYEVLEAKNGQEAVEIFNQN--PEISLVILDVMMPQ 58

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            + +  +R++ L ++V V  L    D +  ++  R+GAN ++ KPF+ E L      L +
Sbjct: 59  YDGMEVLRRIRLQSNVPVLILTALGDTQNELSSLRSGANDYMAKPFHPEVLLARAENLMR 118

Query: 120 MQKSKDENQF 129
           M ++K ++  
Sbjct: 119 MVRNKSDSHL 128


>gi|13378328|gb|AAD47845.2|AF171076_1 probable CheY1 protein [Vibrio cholerae]
          Length = 123

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 45/109 (41%), Gaps = 9/109 (8%)

Query: 7   VDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDES-----MEGVLE 61
           VD S  +R++  H   D G+   E  +  + RE   K     + VI        M G  E
Sbjct: 11  VDDSISIRQMVSHTLQDAGY---EVETAADGREALAKAQKARFDVIISDVNMPVMTG-FE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+  VR         +  L  E   EK   G   GA  +L+KPFN ETL
Sbjct: 67  FVKAVRMQSQYKFTPILMLTTETSPEKKQEGKAVGATGWLVKPFNPETL 115


>gi|218680418|ref|ZP_03528315.1| chemotaxis two-component response regulator protein [Rhizobium etli
           CIAT 894]
          Length = 122

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R   +   ++ G+ V EA    E     +     + +V D     M+G 
Sbjct: 4   NILTVDDSASIRLTTKVTLSNAGYSVTEAADGAEGLAKAKSSSF-DLIVTDLNMPVMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R++P    V + +L  E D +       AGA  +L KPF+ E L
Sbjct: 62  LTMIEELRKLPGQAGVPIIFLTTESDADLKARAKAAGATGWLTKPFDPENL 112


>gi|57238000|ref|YP_179249.1| chemotaxis protein CheY [Campylobacter jejuni RM1221]
 gi|121613202|ref|YP_001000796.1| chemotaxis protein CheY [Campylobacter jejuni subsp. jejuni 81-176]
 gi|153952086|ref|YP_001397770.1| chemotaxis protein CheY [Campylobacter jejuni subsp. doylei 269.97]
 gi|157415379|ref|YP_001482635.1| chemotaxis protein CheY [Campylobacter jejuni subsp. jejuni 81116]
 gi|167005711|ref|ZP_02271469.1| chemotaxis regulatory protein [Campylobacter jejuni subsp. jejuni
           81-176]
 gi|218562732|ref|YP_002344511.1| chemotaxis regulatory protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|143955301|sp|A1W0A5|CHEY_CAMJJ RecName: Full=Chemotaxis protein CheY homolog
 gi|166201766|sp|A8FMH1|CHEY_CAMJ8 RecName: Full=Chemotaxis protein CheY homolog
 gi|166201767|sp|P0C635|CHEY_CAMJE RecName: Full=Chemotaxis protein CheY homolog
 gi|1644429|gb|AAB17571.1| response regulator protein [Campylobacter jejuni]
 gi|3413457|emb|CAA72347.1| cheY [Campylobacter jejuni]
 gi|57166804|gb|AAW35583.1| chemotaxis protein CheY [Campylobacter jejuni RM1221]
 gi|87249184|gb|EAQ72145.1| chemotaxis protein CheY [Campylobacter jejuni subsp. jejuni 81-176]
 gi|112360438|emb|CAL35235.1| chemotaxis regulatory protein [Campylobacter jejuni subsp. jejuni
           NCTC 11168]
 gi|152939532|gb|ABS44273.1| chemotaxis protein CheY [Campylobacter jejuni subsp. doylei 269.97]
 gi|157386343|gb|ABV52658.1| chemotaxis regulatory protein [Campylobacter jejuni subsp. jejuni
           81116]
 gi|284926346|gb|ADC28698.1| chemotaxis protein CheY [Campylobacter jejuni subsp. jejuni IA3902]
 gi|307748020|gb|ADN91290.1| Chemotaxis protein cheY [Campylobacter jejuni subsp. jejuni M1]
 gi|315932258|gb|EFV11201.1| chemotaxis protein CheY [Campylobacter jejuni subsp. jejuni 327]
          Length = 130

 Score = 42.0 bits (97), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 56/118 (47%), Gaps = 3/118 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G   V EA    EA +   K      L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLTRLGHDDVLEAEHGVEAWDLLTKNEDVKVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           LE +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+  + ++
Sbjct: 62  LELVKKVRAEKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEDV 119


>gi|329908339|ref|ZP_08274852.1| putative response regulator [Oxalobacteraceae bacterium IMCC9480]
 gi|327546736|gb|EGF31681.1| putative response regulator [Oxalobacteraceae bacterium IMCC9480]
          Length = 345

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 50/100 (50%), Gaps = 11/100 (11%)

Query: 36  EAREFCEKELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAG 92
           +A  +C ++  P+ L++D     M+G LEF+   RQ+P  +DV +  +  ++  E     
Sbjct: 36  KALAWC-RDNAPDLLLVDYMMPDMDG-LEFLQAFRQLPGKSDVPIVMVTADIQTEVRHKA 93

Query: 93  ARAGANSFLLKPFNRETLR------FAMRELPQMQKSKDE 126
            + GAN FL KP N+  LR       A+R   Q   S+ E
Sbjct: 94  LQLGANDFLTKPVNKTELRARVSNLLALRVAQQQLASRAE 133


>gi|300868772|ref|ZP_07113383.1| putative chemotaxis protein [Oscillatoria sp. PCC 6506]
 gi|300333333|emb|CBN58575.1| putative chemotaxis protein [Oscillatoria sp. PCC 6506]
          Length = 121

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 28/118 (23%), Positives = 58/118 (49%), Gaps = 3/118 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M ++++VD  H  R++  +L    G  V EA+   EA E  E    P+ +++D  M G+ 
Sbjct: 1   MKTVIVVDDQHSHREMISNLLKGSGINVIEASDGVEAIEKIEVNC-PDLIILDIVMPGMN 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
             E    ++  PL  ++ + +  ++ +      G + GA++++ KPF    L   +++
Sbjct: 60  GFEVCRRLKNNPLTQNIPIVFCSVKGEEFDRYWGIKQGADAYIAKPFGPRELVGTVKQ 117


>gi|2914154|pdb|1AB5|A Chain A, Structure Of Chey Mutant F14n, V21t
 gi|2914155|pdb|1AB5|B Chain B, Structure Of Chey Mutant F14n, V21t
          Length = 125

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD +  +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 5   LVVDDNSTMRRITRNLLKELGFNNVEEAEDGVDALNKLQAGGY-GFVISDWNMPNMDGLE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 64  LLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 112


>gi|227820834|ref|YP_002824804.1| putative two-component response regulator receiver protein
           [Sinorhizobium fredii NGR234]
 gi|227339833|gb|ACP24051.1| putative two-component response regulator receiver protein
           [Sinorhizobium fredii NGR234]
          Length = 121

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 48/105 (45%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R +     N+ GF   +A    E  E  E    P+ +V D +M  +    
Sbjct: 5   VLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEVLETAN-PDVIVTDINMPRLDGFG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           FI  VR+      V +  L  E D EK     +AGA  +++KPF+
Sbjct: 64  FIEGVRRNDRYRAVPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|225027536|ref|ZP_03716728.1| hypothetical protein EUBHAL_01793 [Eubacterium hallii DSM 3353]
 gi|224955136|gb|EEG36345.1| hypothetical protein EUBHAL_01793 [Eubacterium hallii DSM 3353]
          Length = 204

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 61/113 (53%), Gaps = 7/113 (6%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           +S+L+VD   I+ K    + +   + V  A S  +A    +K ++P+ +++D +M  +  
Sbjct: 4   NSILIVDDDLILLKTAEEILSSI-YTVSVAKSGKQAITLLKKGVVPDLILLDIAMPEMDG 62

Query: 62  F--IAHVRQMPLGTDVFVYYL--LMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +  ++ +P   D+ V +L    E D+E  + G +AGA  +++KPF +E L
Sbjct: 63  YTTLEKMKSIPNCQDIPVIFLTGFAESDYE--VKGLKAGAVDYIVKPFVKEVL 113


>gi|146282907|ref|YP_001173060.1| two-component response regulator CheY [Pseudomonas stutzeri A1501]
 gi|145571112|gb|ABP80218.1| two-component response regulator CheY [Pseudomonas stutzeri A1501]
          Length = 124

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 31/117 (26%), Positives = 58/117 (49%), Gaps = 16/117 (13%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDESM 56
           +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +M
Sbjct: 3   ILIVDDFSTMRRIIKNLLRDLGF-----TNTAEADDGTTA--LPMLKSGSFDFLVTDWNM 55

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 56  PGMSGIDLLRTVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 112


>gi|15826987|ref|NP_301250.1| two-component response regulator [Mycobacterium leprae TN]
 gi|221229465|ref|YP_002502881.1| putative two-component response regulator [Mycobacterium leprae
           Br4923]
 gi|81856515|sp|Q9CD68|MPRA_MYCLE RecName: Full=Response regulator mprA; AltName: Full=Mycobacterial
           persistence regulator A
 gi|13092534|emb|CAC29682.1| putative two-component response regulator [Mycobacterium leprae]
 gi|219932572|emb|CAR70267.1| putative two-component response regulator [Mycobacterium leprae
           Br4923]
          Length = 228

 Score = 42.0 bits (97), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 5/124 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD    VR+  R   +  G+ V  A    EA E   ++  P+ LV+D  M  +  LE
Sbjct: 3   ILAVDDDRAVRESLRRSLSFNGYSVELANDGVEALEMVARDR-PDALVLDVMMPRLDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   +R L +  
Sbjct: 62  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARIRALLRRT 119

Query: 122 KSKD 125
           K  D
Sbjct: 120 KPDD 123


>gi|298527922|ref|ZP_07015326.1| multi-sensor hybrid histidine kinase [Desulfonatronospira
           thiodismutans ASO3-1]
 gi|298511574|gb|EFI35476.1| multi-sensor hybrid histidine kinase [Desulfonatronospira
           thiodismutans ASO3-1]
          Length = 1044

 Score = 41.6 bits (96), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 56/110 (50%), Gaps = 6/110 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+L+VD     R + + +    G+ V EA S  E  E   ++  P+ +++D  + G    
Sbjct: 27  SILIVDDEPEQRIIIKKILTSAGYRVLEAESGVECTELIRRQQ-PDLVLLDVKL-GDESG 84

Query: 63  IAHVRQMPLGTDVFVYYLL----MEVDFEKMIAGARAGANSFLLKPFNRE 108
           +   RQ+   +D+   +++    ++   ++   G RAGA+ +++KP N+E
Sbjct: 85  LDICRQIKTDSDIADTHIMFLSGVKTSPQEQARGLRAGADGYIVKPVNKE 134


>gi|186475612|ref|YP_001857082.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Burkholderia phymatum STM815]
 gi|184192071|gb|ACC70036.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia phymatum STM815]
          Length = 460

 Score = 41.6 bits (96), Expect = 0.032,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 52/110 (47%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  A ++ EAR    +  +P+ +++D ++     L+ + H+   P G  + V  +  
Sbjct: 25  GFSVDTAITLSEARAALTR-FIPDVVLVDLNLPDGSGLDLLQHLPAQPPGGALPVIVMTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPVNIPRLRSLLARIPRPYELTEEVQTLRA 133


>gi|323494171|ref|ZP_08099286.1| response regulator [Vibrio brasiliensis LMG 20546]
 gi|323311565|gb|EGA64714.1| response regulator [Vibrio brasiliensis LMG 20546]
          Length = 298

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 60/133 (45%), Gaps = 6/133 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE--FCEKELLPNYLVIDESMEGVLE 61
           +L+VD S    ++ R     FG+        C+ARE     +E  P  ++ D  M  +  
Sbjct: 3   ILIVDDSKATLEIVRRGLESFGYCRLSIKKTCDAREAITIAQEWHPEIVLTDWYMPEMTG 62

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLL-KPFNRETLRFAMRELPQM 120
                  M LG ++ +  ++  VD +  I  A+    SF+L KPF    L   +  LP +
Sbjct: 63  LTLIKELMKLGDEIKI-GMITTVDDQLQIKQAKQAGASFVLSKPFEDAELHRLL--LPLV 119

Query: 121 QKSKDENQFLDAI 133
           Q +++  + LD+I
Sbjct: 120 QGAQESQKTLDSI 132


>gi|227506355|ref|ZP_03936404.1| response regulator [Corynebacterium striatum ATCC 6940]
 gi|227197006|gb|EEI77054.1| response regulator [Corynebacterium striatum ATCC 6940]
          Length = 234

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 47/93 (50%), Gaps = 5/93 (5%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLM 82
           GF VF A S  EA     +E+ P+  ++D  M G+   E +  +RQ   G D  V YL  
Sbjct: 30  GFEVFSANSGTEALRVA-REVNPDAYIMDVMMPGMDGFELLGKLRQE--GLDGPVLYLTA 86

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           +   ++ I G   GA+ ++ KPF+ E +   +R
Sbjct: 87  KDSVDQRIHGLTIGADDYVTKPFSLEEVITRLR 119


>gi|152989425|ref|YP_001349225.1| two-component response regulator CheY [Pseudomonas aeruginosa PA7]
 gi|296390177|ref|ZP_06879652.1| two-component response regulator CheY [Pseudomonas aeruginosa PAb1]
 gi|313106455|ref|ZP_07792686.1| two-component response regulator CheY [Pseudomonas aeruginosa
           39016]
 gi|150964583|gb|ABR86608.1| two-component response regulator CheY [Pseudomonas aeruginosa PA7]
 gi|270160586|gb|ACZ63263.1| chemotaxis response regulator [Pseudomonas pseudoalcaligenes]
 gi|310879188|gb|EFQ37782.1| two-component response regulator CheY [Pseudomonas aeruginosa
           39016]
          Length = 128

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTAEADDGTTA--LPMLHSGNFDFLVTDWN 58

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 59  MPGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|322418862|ref|YP_004198085.1| response regulator receiver modulated PAS/PAC sensor-containing
           diguanylate cyclase/phosphodiesterase [Geobacter sp.
           M18]
 gi|320125249|gb|ADW12809.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase with PAS/PAC sensor(s)
           [Geobacter sp. M18]
          Length = 705

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 50/112 (44%), Gaps = 5/112 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLPNYLVIDESMEGVLEF 62
           +++VD    VR + R      GF V +A    +A E F      P+ +++D  M G+  F
Sbjct: 13  VMVVDDDQAVRLMARQTLEHSGFAVRDAEDGAQALEDFAAHA--PDIVLLDVMMPGIDGF 70

Query: 63  I--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRF 112
              + +R+   G D  V  +    D E + +   AGA  F+ KP N   L +
Sbjct: 71  CVCSAIRRTETGRDTPVLMMTGLDDLESIDSAYEAGATDFITKPINWHILGY 122


>gi|119485204|ref|ZP_01619589.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
 gi|119457432|gb|EAW38557.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
          Length = 237

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 58/119 (48%), Gaps = 4/119 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  L++ D   I + + + L N+ GF    A     A E+ + +  P+ +V+D  + G+ 
Sbjct: 1   MKILIVEDDGEIAQLIQQTLENE-GFSCETARDGWGALEWFQTQQ-PDLIVLDLMLPGLD 58

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LE  A +RQ P   D ++  L  + +    + G   GA+ +L+KPF+   L   +R L
Sbjct: 59  GLEVCARIRQQPGVKDPYILMLTAKGEEIDRVIGLSTGADDYLVKPFSPRELVARIRAL 117


>gi|58582245|ref|YP_201261.1| chemotaxis protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|78047532|ref|YP_363707.1| chemotaxis response regulator CheY [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|188576808|ref|YP_001913737.1| chemotaxis response regulator CheY [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188577001|ref|YP_001913930.1| chemotaxis response regulator CheY [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|289670574|ref|ZP_06491649.1| chemotaxis response regulator CheY [Xanthomonas campestris pv.
           musacearum NCPPB4381]
 gi|58426839|gb|AAW75876.1| chemotaxis protein [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|78035962|emb|CAJ23653.1| chemotaxis response regulator CheY [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|188521260|gb|ACD59205.1| chemotaxis response regulator CheY [Xanthomonas oryzae pv. oryzae
           PXO99A]
 gi|188521453|gb|ACD59398.1| chemotaxis response regulator CheY [Xanthomonas oryzae pv. oryzae
           PXO99A]
          Length = 130

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 57/114 (50%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE----FCEKELLP-NYLVIDESMEG 58
           +L+VD    +R++ ++L  D GF     T+  EA +           P +++V D +M G
Sbjct: 7   ILIVDDFSTMRRIVKNLLGDLGF-----TNTAEAEDGNSALAALRAGPFDFVVTDWNMPG 61

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  ++ + ++R       + V  +  E   E++I  A+ G N +++KPF  +TL
Sbjct: 62  MTGIDLLRNIRADAKLKHLPVMMVTAEAKREQIIEAAQCGVNGYIIKPFTAQTL 115


>gi|257092371|ref|YP_003166012.1| two component sigma-54 specific Fis family transcriptional
           regulator [Candidatus Accumulibacter phosphatis clade
           IIA str. UW-1]
 gi|257044895|gb|ACV34083.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Candidatus Accumulibacter phosphatis clade IIA
           str. UW-1]
          Length = 486

 Score = 41.6 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 66/134 (49%), Gaps = 9/134 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           + ++L++D     ++  R    D  F VF A++  EA+   E E +   +V D+ M G+ 
Sbjct: 9   LPTVLVIDDEIRSQEALRRTLED-DFDVFTASTGEEAQRIMETEWV-QIVVCDQRMPGMT 66

Query: 60  -LEFIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGA-RAGANSFLLKPFNRETLRFAMRE 116
            +EF+  VR Q P   D     L    D E +IAG   AG   +L+KP+  E L   ++ 
Sbjct: 67  GVEFLKTVRSQWP---DTLRIILSGYTDAEDIIAGVNEAGIYQYLMKPWQPEQLLLTLQT 123

Query: 117 LPQMQKSKDENQFL 130
             ++ + + ENQ L
Sbjct: 124 AARVYRLQQENQRL 137


>gi|218658439|ref|ZP_03514369.1| response regulator receiver protein [Rhizobium etli IE4771]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 49/111 (44%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R   +    + G+ V EA    E     +     + +V D     M+G 
Sbjct: 6   NILTVDDSASIRLTTKVTLTNAGYSVTEAADGAEGLATAKGSRF-DLIVTDLNMPVMDG- 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R++P    V + +L  E D +       AGA  +L KPF+ E L
Sbjct: 64  LTMIEELRKLPGQAGVPIIFLTTESDADLKARAKAAGATGWLTKPFDPENL 114


>gi|114766915|ref|ZP_01445836.1| chemotaxis response regulator, CheY1 [Pelagibaca bermudensis
           HTCC2601]
 gi|114540893|gb|EAU43954.1| chemotaxis response regulator, CheY1 [Roseovarius sp. HTCC2601]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 55/118 (46%), Gaps = 7/118 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--ELLPNYLVIDESMEGVLE 61
           +L +D S  +R + R      GF   E  S C+  E  E+  E+ P+ ++ D +M  +  
Sbjct: 5   VLAIDDSRTIRNLLRVSLEGAGF---EYHSACDGVEGVEQFSEVEPDVVITDINMPNMDG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           F  I ++R  P  T V +  L  E   +       AGA  +++KPF+  +L   +R L
Sbjct: 62  FGVIDNLRSGPNRTTVPIIVLTTESGPDLKARAREAGATGWIVKPFDDASLVSVLRRL 119


>gi|107022216|ref|YP_620543.1| Fis family transcriptional regulator [Burkholderia cenocepacia AU
           1054]
 gi|105892405|gb|ABF75570.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia cenocepacia AU 1054]
          Length = 461

 Score = 41.6 bits (96), Expect = 0.033,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQSLRA 133


>gi|239502003|ref|ZP_04661313.1| osmolarity response regulator [Acinetobacter baumannii AB900]
          Length = 254

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEG 58
           ++ +L+VD    +R + +    D GF+V  A    +     ++EL  + +V+D    +E 
Sbjct: 20  VERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDASQMDRLLQRELF-SLIVLDFMLPVED 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            L     +RQ  + T + +  L         IAG  AGA+ +L KPFN        R  L
Sbjct: 79  GLSICRRLRQTNIDTPIIM--LTARGSDSDRIAGLEAGADDYLPKPFNPNELLARIRAVL 136

Query: 111 RFAMRELP 118
           R  +RE+P
Sbjct: 137 RRQVREVP 144


>gi|4455703|emb|CAB36688.1| putative two-component response regulator [Mycobacterium leprae]
          Length = 253

 Score = 41.6 bits (96), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 5/124 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD    VR+  R   +  G+ V  A    EA E   ++  P+ LV+D  M  +  LE
Sbjct: 28  ILAVDDDRAVRESLRRSLSFNGYSVELANDGVEALEMVARDR-PDALVLDVMMPRLDGLE 86

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   +R L +  
Sbjct: 87  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARIRALLRRT 144

Query: 122 KSKD 125
           K  D
Sbjct: 145 KPDD 148


>gi|326385623|ref|ZP_08207257.1| hypothetical protein Y88_1821 [Novosphingobium nitrogenifigens DSM
           19370]
 gi|326209957|gb|EGD60740.1| hypothetical protein Y88_1821 [Novosphingobium nitrogenifigens DSM
           19370]
          Length = 122

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 48/111 (43%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           S+L VD S  +R   R      G+ V EA    E       E   + ++ D     M+G 
Sbjct: 4   SILTVDDSPSLRMAVRIALTGAGYAVTEAGDGTEGLAKAGAERF-DLIITDLNMPRMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R+ P  T V + +L  E +         AGA  +L+KPFN + L
Sbjct: 62  LTMIRELRKSPTNTGVPIIFLTTESEDGLKAQAKAAGATGWLVKPFNADQL 112


>gi|298376717|ref|ZP_06986672.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_19]
 gi|301310020|ref|ZP_07215959.1| two-component system sensor histidine kinase [Bacteroides sp. 20_3]
 gi|298266595|gb|EFI08253.1| two-component system sensor histidine kinase [Bacteroides sp.
           3_1_19]
 gi|300831594|gb|EFK62225.1| two-component system sensor histidine kinase [Bacteroides sp. 20_3]
          Length = 374

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 8/108 (7%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVFVYYLL 81
           G+ +    S  +A      E  PN +++D     M+G  E + H++  P  TD+ V  + 
Sbjct: 31  GYTLLTCDSGTKALRIAN-EKHPNLILLDIMMPEMDG-YEVLQHLKSNPETTDIPVIIMS 88

Query: 82  MEVDFEKMIAGARAGANSFLLKPFNRETL--RFAMR-ELPQMQKSKDE 126
              D + ++ G + GA  ++ KPF RE L  R A R EL  +++ K E
Sbjct: 89  ALSDMQSIVKGYQLGATEYVTKPFQREELVKRVAHRYELYSIKRIKAE 136


>gi|167586639|ref|ZP_02379027.1| two component, sigma54 specific, transcriptional regulator, Fis
           family protein [Burkholderia ubonensis Bu]
          Length = 461

 Score = 41.6 bits (96), Expect = 0.034,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQSLRA 133


>gi|299134232|ref|ZP_07027425.1| response regulator receiver protein [Afipia sp. 1NLS2]
 gi|298590979|gb|EFI51181.1| response regulator receiver protein [Afipia sp. 1NLS2]
          Length = 130

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+VD  + + ++ R+L    GF   +  S   A     +      ++ D +ME +   +
Sbjct: 9   VLVVDDYNTMIRIIRNLLKQLGFENIDDASDGSAALAKMRGKKYGLVISDWNMEPMTGYD 68

Query: 62  FIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +  VR  P L T  F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 69  LLKEVRGDPNLATTPFIM-ITAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|254293652|ref|YP_003059675.1| response regulator receiver [Hirschia baltica ATCC 49814]
 gi|254042183|gb|ACT58978.1| response regulator receiver protein [Hirschia baltica ATCC 49814]
          Length = 173

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 57/112 (50%), Gaps = 6/112 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFE-ATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD +H +  + + L   FG   F+ A+   EA E    E + +++++D  ME +   
Sbjct: 11  VLIVDDNHHMINIIKTLLRGFGIKNFDSASDAVEAFEIVNSEPI-DFIIVDYHMEILDGA 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEK-MIAGAR-AGANSFLLKPFNRETL 110
           +F+  VR  P   + F+  +++    E+  + GAR AG + FL KP     L
Sbjct: 70  DFVRLVRNAPDSNNPFIPIIMLTAYSERSKVEGARDAGVSEFLAKPVTSSDL 121


>gi|7677126|gb|AAF67045.1|AF183382_5 response regulator CheY [Pseudomonas putida]
 gi|2853598|gb|AAC08062.1| CheY [Pseudomonas putida]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    E     ++LV D +M G+  
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGFTNTEEADDGTTALPMLENGHY-DFLVTDWNMPGMSG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 61  IDLLRKVRASEKLKTMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 112


>gi|34558269|ref|NP_908084.1| sensor kinase of two-component regulatory system [Wolinella
           succinogenes DSM 1740]
 gi|34483988|emb|CAE10984.1| sensor kinase of two-component regulatory system [Wolinella
           succinogenes]
          Length = 645

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 34/108 (31%), Positives = 50/108 (46%), Gaps = 6/108 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           ++ L + D   ++  V RHL    G+  FEA S  EA+    KE   + L+ D  M   G
Sbjct: 7   INILCMEDDPLVLSSVARHL-RKRGYDTFEANSGSEAQRIL-KERPIDILIADIRMPDMG 64

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
             E I+ VR M L   + +     E D+   I   R+  + F+LKP N
Sbjct: 65  AFELISRVRAMGLRPKILILTAYEESDY--FIEAIRSKVDGFILKPLN 110


>gi|15611426|ref|NP_223077.1| response regulator [Helicobacter pylori J99]
 gi|12229777|sp|Q9ZM64|CHEY_HELPJ RecName: Full=Chemotaxis protein CheY homolog
 gi|4154896|gb|AAD05946.1| response regulator [Helicobacter pylori J99]
 gi|317010656|gb|ADU84403.1| response regulator [Helicobacter pylori SouthAfrica7]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++  +  G+  V EA    EA E  +       L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLDANADTKVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L+ +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LDLVKKVRADNRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|170732450|ref|YP_001764397.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Burkholderia cenocepacia MC0-3]
 gi|254245905|ref|ZP_04939226.1| Response regulator [Burkholderia cenocepacia PC184]
 gi|124870681|gb|EAY62397.1| Response regulator [Burkholderia cenocepacia PC184]
 gi|169815692|gb|ACA90275.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia cenocepacia MC0-3]
          Length = 461

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQSLRA 133


>gi|59712727|ref|YP_205503.1| two-component response regulator [Vibrio fischeri ES114]
 gi|197335075|ref|YP_002156920.1| aerobic respiration control protein ArcA [Vibrio fischeri MJ11]
 gi|59480828|gb|AAW86615.1| DNA-binding response regulator in two-component regulatory system
           with ArcB or CpxA [Vibrio fischeri ES114]
 gi|112005082|gb|ABH85384.1| response regulator [Aliivibrio fischeri]
 gi|197316565|gb|ACH66012.1| aerobic respiration control protein ArcA [Vibrio fischeri MJ11]
          Length = 239

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 63/128 (49%), Gaps = 4/128 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+V+  H+ R   + +F   G+ VFEA+   E  +   ++ L N +++D ++ G    +
Sbjct: 6   ILIVEDEHVTRNTLKSIFEAEGYNVFEASDGEEMHKVLSEQQL-NLVIMDINLPGKNGLL 64

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
              R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L  + +S
Sbjct: 65  L-ARELRERGDMALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL--LTRS 121

Query: 124 KDENQFLD 131
            ++N  ++
Sbjct: 122 MNQNTVVE 129


>gi|116689162|ref|YP_834785.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Burkholderia cenocepacia HI2424]
 gi|116647251|gb|ABK07892.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia cenocepacia HI2424]
          Length = 461

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQSLRA 133


>gi|206559404|ref|YP_002230165.1| sigma-54 interacting response regulator protein [Burkholderia
           cenocepacia J2315]
 gi|206561194|ref|YP_002231959.1| sigma-54 interacting response regulator protein [Burkholderia
           cenocepacia J2315]
 gi|198035442|emb|CAR51318.1| sigma-54 interacting response regulator protein [Burkholderia
           cenocepacia J2315]
 gi|198037236|emb|CAR53158.1| sigma-54 interacting response regulator protein [Burkholderia
           cenocepacia J2315]
          Length = 461

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQSLRA 133


>gi|160885643|ref|ZP_02066646.1| hypothetical protein BACOVA_03646 [Bacteroides ovatus ATCC 8483]
 gi|156109265|gb|EDO11010.1| hypothetical protein BACOVA_03646 [Bacteroides ovatus ATCC 8483]
          Length = 1368

 Score = 41.6 bits (96), Expect = 0.035,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 61/112 (54%), Gaps = 6/112 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            SLL+V+ +  VR+  R LF    + V+EA +  E      KE LP+ L+I + M  V + 
Sbjct: 1115 SLLIVEDNEDVREYIRSLFIS-KYTVYEAGNGEEGVRMA-KEKLPD-LIISDVMMPVKDG 1171

Query: 63   IAHVRQMPLGTDV-FVYYLLMEVDFEKM--IAGARAGANSFLLKPFNRETLR 111
                R++    +   + +L++    E +  + G+R+GA+ +++KPFN E L+
Sbjct: 1172 FTCCREIRTQQETAHIPFLMLTAKAEDVDVLQGSRSGADDYMMKPFNPEILK 1223


>gi|150007937|ref|YP_001302680.1| two-component hybrid sensor kinase/response regulator
           [Parabacteroides distasonis ATCC 8503]
 gi|255013375|ref|ZP_05285501.1| two-component hybrid sensor kinase/response regulator [Bacteroides
           sp. 2_1_7]
 gi|262381501|ref|ZP_06074639.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_1_33B]
 gi|149936361|gb|ABR43058.1| two-component system sensor histidine kinase, with a response
           regulator receiver domain [Parabacteroides distasonis
           ATCC 8503]
 gi|262296678|gb|EEY84608.1| two-component system sensor histidine kinase [Bacteroides sp.
           2_1_33B]
          Length = 374

 Score = 41.6 bits (96), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 8/108 (7%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVFVYYLL 81
           G+ +    S  +A      E  PN +++D     M+G  E + H++  P  TD+ V  + 
Sbjct: 31  GYTLLTCDSGTKALRIAN-EKHPNLILLDIMMPEMDG-YEVLQHLKSNPETTDIPVIIMS 88

Query: 82  MEVDFEKMIAGARAGANSFLLKPFNRETL--RFAMR-ELPQMQKSKDE 126
              D + ++ G + GA  ++ KPF RE L  R A R EL  +++ K E
Sbjct: 89  ALSDMQSIVKGYQLGATEYVTKPFQREELVKRVAHRYELYSIKRIKAE 136


>gi|301062173|ref|ZP_07202858.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
 gi|300443726|gb|EFK07806.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
          Length = 175

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/115 (28%), Positives = 57/115 (49%), Gaps = 7/115 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L+VD + +V K+ RHL     ++V  A +  EA +    E  P+ +V D     M+GV 
Sbjct: 56  ILVVDDNLVVLKLLRHLLESQDYLVITAQNGVEALKLASTE-DPDMVVTDYVMPEMDGVA 114

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
             I  +++     ++ +  L  + + E  + G  AGA+ +L KP  R+  RF  R
Sbjct: 115 -LIKELKRRKETRNIPIMMLTAKDEEESELEGLDAGADDYLTKPIARK--RFLAR 166


>gi|300024575|ref|YP_003757186.1| response regulator receiver protein [Hyphomicrobium denitrificans
           ATCC 51888]
 gi|299526396|gb|ADJ24865.1| response regulator receiver protein [Hyphomicrobium denitrificans
           ATCC 51888]
          Length = 120

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 54/119 (45%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L VD S  +R + R    + GF V +A    +  +  ++   P+ +V D +M  + 
Sbjct: 1   MQTILTVDDSRTMRDMLRMALVEAGFNVVQAVDGVDGLDVLQQST-PDVIVTDINMPKMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            F  I  VR+      V +  L  E D  K      AGA  +++KPF    L  A+R +
Sbjct: 60  GFGLIEAVRKDNRYRKVPILVLTTESDAAKKQRAKEAGATGWIVKPFEPTKLIAAIRRV 118


>gi|197285521|ref|YP_002151393.1| chemotaxis response regulator [Proteus mirabilis HI4320]
 gi|227356016|ref|ZP_03840407.1| response regulator [Proteus mirabilis ATCC 29906]
 gi|194683008|emb|CAR43470.1| chemotaxis response regulator [Proteus mirabilis HI4320]
 gi|227163793|gb|EEI48701.1| response regulator [Proteus mirabilis ATCC 29906]
          Length = 129

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GFM V EA    +A    +     ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFMNVEEAEDGADALAKLQSSAY-DFVITDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            + ++R       + V  +  E   E +IA A++GA+ +++KPF    L
Sbjct: 68  LLKNIRSDAGLATLPVLMVTAEAKKENIIAAAQSGASGYVVKPFTAAIL 116


>gi|225849130|ref|YP_002729294.1| chemotaxis protein CheY [Sulfurihydrogenibium azorense Az-Fu1]
 gi|225644563|gb|ACN99613.1| CheY chemotaxis protein [Sulfurihydrogenibium azorense Az-Fu1]
          Length = 130

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 59/120 (49%), Gaps = 14/120 (11%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESM- 56
            +L VD    +RK+ + L    G+     T+V EA    E     K+   + +++D +M 
Sbjct: 8   KILTVDDMATMRKIIKSLLTQLGY-----TNVDEAENGKEALAKLKQQKYDLVLLDWNMP 62

Query: 57  --EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
             +G+   +  +++ P   ++ V  +  E   E ++   + GAN++++KPF  ETL+  M
Sbjct: 63  EMDGIT-LLQEIKKDPDLKNIPVIMVTAEAKKENVLQAIQTGANNYIVKPFTAETLKEKM 121


>gi|149927471|ref|ZP_01915725.1| chemotaxis protein CheY [Limnobacter sp. MED105]
 gi|149823744|gb|EDM82970.1| chemotaxis protein CheY [Limnobacter sp. MED105]
          Length = 121

 Score = 41.6 bits (96), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 59/120 (49%), Gaps = 9/120 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPNYLVIDE----SME 57
           ++L+VD S  +R+V        GF V E    C+ ++   K +    +L++ +    +M+
Sbjct: 4   TVLVVDDSTSLRQVVGMTLKSQGFEVIEG---CDGKDALTKLDGRKVHLIVSDLNMPNMD 60

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G L F+  V++MP    V +  L  E D      G  AG  ++++KPF  E +  A+ +L
Sbjct: 61  G-LSFVREVKKMPDYKFVPIIMLTTETDDTLKAQGQAAGLKAWMVKPFKPEQMLAAVNKL 119


>gi|221209520|ref|ZP_03582501.1| C4-dicarboxylate transport transcriptional regulatory protein DctR
           [Burkholderia multivorans CGD1]
 gi|221170208|gb|EEE02674.1| C4-dicarboxylate transport transcriptional regulatory protein DctR
           [Burkholderia multivorans CGD1]
          Length = 205

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 49/118 (41%), Gaps = 11/118 (9%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK------ELLPNYLVIDE 54
           M +L L+D   ++R     LF   G     A +  +AR F +          P  L+ID 
Sbjct: 1   MRNLYLIDDDDVIRDALDALFRSRGLA---ARAFGDARAFLDAWREGGLARAPACLLIDV 57

Query: 55  SMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            M G+   E  A +R   LG    V +L    D    +   RAGA  FL KPF+   L
Sbjct: 58  RMPGMSGFELFAQLRDAGLGAHHAVVFLTGHGDIPMAVDALRAGAYDFLEKPFSDNRL 115


>gi|15596653|ref|NP_250147.1| two-component response regulator CheY [Pseudomonas aeruginosa PAO1]
 gi|116049401|ref|YP_791796.1| two-component response regulator CheY [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|218892671|ref|YP_002441540.1| two-component response regulator CheY [Pseudomonas aeruginosa
           LESB58]
 gi|254234555|ref|ZP_04927878.1| two-component response regulator CheY [Pseudomonas aeruginosa
           C3719]
 gi|254239805|ref|ZP_04933127.1| two-component response regulator CheY [Pseudomonas aeruginosa 2192]
 gi|2500739|sp|Q51455|CHEY_PSEAE RecName: Full=Chemotaxis protein CheY
 gi|9947408|gb|AAG04845.1|AE004575_4 two-component response regulator CheY [Pseudomonas aeruginosa PAO1]
 gi|45323|emb|CAA43549.1| CheY [Pseudomonas aeruginosa]
 gi|115584622|gb|ABJ10637.1| two-component response regulator CheY [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126166486|gb|EAZ51997.1| two-component response regulator CheY [Pseudomonas aeruginosa
           C3719]
 gi|126193183|gb|EAZ57246.1| two-component response regulator CheY [Pseudomonas aeruginosa 2192]
 gi|218772899|emb|CAW28711.1| two-component response regulator CheY [Pseudomonas aeruginosa
           LESB58]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGF-----TNTAEADDGTTA--LPMLHSGNFDFLVTDWN 54

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 55  MPGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 112


>gi|300870098|ref|YP_003784969.1| chemotaxis response regulator CheY [Brachyspira pilosicoli 95/1000]
 gi|300687797|gb|ADK30468.1| chemotaxis response regulator, CheY [Brachyspira pilosicoli
           95/1000]
          Length = 122

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 49/111 (44%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L+VD S+  R    +      + V  A       E   K    + ++ D     M+G+
Sbjct: 4   TILIVDDSNTARASVEYTLKKGSYDVISADDGTTGLEAVNKAANIDMIITDLNMPKMDGI 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            EFI +VR+        +  L  E   +K + G  AGA+ +L+KPFN   L
Sbjct: 64  -EFIKNVRKFDKYKYTPILMLTTESQDDKKMEGKAAGASGWLVKPFNPTQL 113


>gi|256840897|ref|ZP_05546405.1| two-component system sensor histidine kinase [Parabacteroides sp.
           D13]
 gi|256738169|gb|EEU51495.1| two-component system sensor histidine kinase [Parabacteroides sp.
           D13]
          Length = 374

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 53/108 (49%), Gaps = 8/108 (7%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVFVYYLL 81
           G+ +    S  +A      E  PN +++D     M+G  E + H++  P  TD+ V  + 
Sbjct: 31  GYTLLTCDSGTKALRIAN-EKHPNLILLDIMMPEMDG-YEVLQHLKSNPETTDIPVIIMS 88

Query: 82  MEVDFEKMIAGARAGANSFLLKPFNRETL--RFAMR-ELPQMQKSKDE 126
              D + ++ G + GA  ++ KPF RE L  R A R EL  +++ K E
Sbjct: 89  ALSDMQSIVKGYQLGATEYVTKPFQREELVKRVAHRYELYSIKRIKAE 136


>gi|91205788|ref|YP_538143.1| response regulator PleD [Rickettsia bellii RML369-C]
 gi|91069332|gb|ABE05054.1| Regulatory components of sensory transduction system [Rickettsia
           bellii RML369-C]
          Length = 457

 Score = 41.6 bits (96), Expect = 0.037,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHI-VRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYL--VIDESMEGV 59
           ++L+VD     ++ +   L N++ + VF+A+S  EA    +KE +   L  V+   M+G 
Sbjct: 4   NILIVDDIETNIKLLEAKLLNEY-YTVFKASSGKEALNILKKEKVDIVLLDVMMPEMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    ++  P  T + V  +    D +  + G  AGA+ FL KP N   L   ++ L +
Sbjct: 62  FEVCKKIKSDPETTHIPVVMVTALSDVDDRVKGLEAGADEFLTKPINDNALFIRIKSLSR 121

Query: 120 MQKSKDE 126
           M+   DE
Sbjct: 122 MKSLIDE 128


>gi|21242676|ref|NP_642258.1| chemotaxis protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|84624138|ref|YP_451510.1| chemotaxis protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|289666125|ref|ZP_06487706.1| chemotaxis response regulator CheY [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|294664735|ref|ZP_06730064.1| chemotaxis protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|325921796|ref|ZP_08183615.1| response regulator with CheY-like receiver, AAA-type ATPase, and
           DNA-binding domains [Xanthomonas gardneri ATCC 19865]
 gi|325928019|ref|ZP_08189236.1| response regulator with CheY-like receiver, AAA-type ATPase, and
           DNA-binding domains [Xanthomonas perforans 91-118]
 gi|21108147|gb|AAM36794.1| chemotaxis protein [Xanthomonas axonopodis pv. citri str. 306]
 gi|84368078|dbj|BAE69236.1| chemotaxis protein [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|292605489|gb|EFF48811.1| chemotaxis protein [Xanthomonas fuscans subsp. aurantifolii str.
           ICPB 10535]
 gi|325541615|gb|EGD13140.1| response regulator with CheY-like receiver, AAA-type ATPase, and
           DNA-binding domains [Xanthomonas perforans 91-118]
 gi|325547728|gb|EGD18763.1| response regulator with CheY-like receiver, AAA-type ATPase, and
           DNA-binding domains [Xanthomonas gardneri ATCC 19865]
          Length = 126

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 57/114 (50%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE----FCEKELLP-NYLVIDESMEG 58
           +L+VD    +R++ ++L  D GF     T+  EA +           P +++V D +M G
Sbjct: 3   ILIVDDFSTMRRIVKNLLGDLGF-----TNTAEAEDGNSALAALRAGPFDFVVTDWNMPG 57

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  ++ + ++R       + V  +  E   E++I  A+ G N +++KPF  +TL
Sbjct: 58  MTGIDLLRNIRADAKLKHLPVMMVTAEAKREQIIEAAQCGVNGYIIKPFTAQTL 111


>gi|86141687|ref|ZP_01060211.1| DNA-binding response regulator [Leeuwenhoekiella blandensis MED217]
 gi|85831250|gb|EAQ49706.1| DNA-binding response regulator [Leeuwenhoekiella blandensis MED217]
          Length = 227

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 64/127 (50%), Gaps = 6/127 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           LL+ D   I+  VG +L N+ G+ V  A++  E  +  +K   P+ +++D     M+G+ 
Sbjct: 9   LLVDDEPDILEIVGYNLSNE-GYQVITASNGKEGVKAAKKNN-PHLIILDVMMPEMDGI- 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R++P   +  + +L    +    +AG  AGA+ ++ KP   + L   ++ L + 
Sbjct: 66  EACEQIRKLPGHEETIIAFLTARGEDYSQVAGYDAGADDYITKPIKPKVLVSKVKALLRR 125

Query: 121 QKSKDEN 127
            K ++E 
Sbjct: 126 LKEEEEG 132


>gi|218548515|ref|YP_002382306.1| chemotaxis regulatory protein CheY [Escherichia fergusonii ATCC
           35469]
 gi|218356056|emb|CAQ88672.1| chemotaxis regulator transmitting signal to flagellar motor
           component [Escherichia fergusonii ATCC 35469]
 gi|324113664|gb|EGC07639.1| response regulator receiver domain-containing protein [Escherichia
           fergusonii B253]
 gi|325496934|gb|EGC94793.1| chemotaxis regulatory protein CheY [Escherichia fergusonii ECD227]
          Length = 129

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +     N+++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFHNVEEAEDGVDALNKLQMGGF-NFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRADGAMSTLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|254459380|ref|ZP_05072801.1| chemotaxis protein CheA [Campylobacterales bacterium GD 1]
 gi|207083993|gb|EDZ61284.1| chemotaxis protein CheA [Campylobacterales bacterium GD 1]
          Length = 121

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 51/112 (45%), Gaps = 1/112 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLV-IDESMEGV 59
           M ++++VD S  VR     +    G  + EA +  EA E      +  YLV ++  +   
Sbjct: 1   MPTIMVVDDSKTVRNYHGAIIKSQGLDIIEAENGMEALEKSLDAKIDLYLVDVNMPIMDG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             FI+ +R+ P   +V V  +  +   E  I+  + GAN F  KP   + L+
Sbjct: 61  YSFISDLRKQPNHKNVPVIMVTTQAKLEDKISAYKVGANLFETKPIKPDLLQ 112


>gi|39934250|ref|NP_946526.1| CheY-like response regulator receiver [Rhodopseudomonas palustris
           CGA009]
 gi|192289776|ref|YP_001990381.1| response regulator receiver protein [Rhodopseudomonas palustris
           TIE-1]
 gi|316932719|ref|YP_004107701.1| response regulator receiver protein [Rhodopseudomonas palustris
           DX-1]
 gi|39648098|emb|CAE26618.1| response regulator receiver (CheY-like protein) [Rhodopseudomonas
           palustris CGA009]
 gi|192283525|gb|ACE99905.1| response regulator receiver protein [Rhodopseudomonas palustris
           TIE-1]
 gi|315600433|gb|ADU42968.1| response regulator receiver protein [Rhodopseudomonas palustris
           DX-1]
          Length = 131

 Score = 41.6 bits (96), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 29/111 (26%), Positives = 52/111 (46%), Gaps = 2/111 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           S+L+VD    + ++ R+L    GF   +  S   A     +      ++ D +ME +   
Sbjct: 8   SVLVVDDYSTMIRIIRNLLKQLGFENIDDASDGSAALAKMRTKKYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR  P  +      +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 68  DLLKEVRADPNLSQTPFIMITAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|260425706|ref|ZP_05779686.1| response regulator receiver protein [Citreicella sp. SE45]
 gi|260423646|gb|EEX16896.1| response regulator receiver protein [Citreicella sp. SE45]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 33/118 (27%), Positives = 54/118 (45%), Gaps = 7/118 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--ELLPNYLVIDESMEGVLE 61
           +L +D S  +R + R      GF   E  S C+  E  E+  E+ P+ ++ D +M  +  
Sbjct: 5   VLAIDDSRTIRNLLRVSLEGAGF---EYHSACDGVEGVEQFSEVEPDVVITDINMPNMDG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           F  I  +R  P  T V +  L  E   +       AGA  +++KPF+  +L   +R L
Sbjct: 62  FGVIQTLRSGPSRTTVPIIVLTTESGPDLKARAREAGATGWIVKPFDDASLVSVLRRL 119


>gi|83859462|ref|ZP_00952983.1| two-component response regulator [Oceanicaulis alexandrii HTCC2633]
 gi|83852909|gb|EAP90762.1| two-component response regulator [Oceanicaulis alexandrii HTCC2633]
          Length = 128

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 56/114 (49%), Gaps = 4/114 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           +L+VD    + ++ ++L    GF  V EA+   EA E  +K+     ++ D +ME +   
Sbjct: 9   ILVVDDYKTMVRIIKNLLKQIGFENVDEASDGTEAFEKMKKKKY-GLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
           E +  VR            +  E   E +IA  +AG N++++KPFN  TL+  M
Sbjct: 68  ELLQKVRADESTKATPFIMVTAESKTENVIAAKKAGVNNYIVKPFNAGTLKAKM 121


>gi|160887918|ref|ZP_02068921.1| hypothetical protein BACUNI_00322 [Bacteroides uniformis ATCC 8492]
 gi|156862604|gb|EDO56035.1| hypothetical protein BACUNI_00322 [Bacteroides uniformis ATCC 8492]
          Length = 1360

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 6/110 (5%)

Query: 27   MVFEATSVCEAREFCEK--ELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVFVYYLL 81
            + F   S    RE  +K  EL+P+ +V D     M+G  E    V+     +D+ +  L 
Sbjct: 1133 LYFRIQSASNGREAWQKIPELMPDIIVSDVMMPEMDGN-ELCRWVKTDKRTSDIPMILLT 1191

Query: 82   MEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLD 131
                 E  + G   GA+ ++ KPFN E L   MR+L  + K +     +D
Sbjct: 1192 ARQAVEDKVEGLTIGADDYVTKPFNVEILILRMRKLIDLSKKRKAKSLID 1241


>gi|104782800|ref|YP_609298.1| chemotaxis protein CheY [Pseudomonas entomophila L48]
 gi|95111787|emb|CAK16511.1| chemotaxis protein CheY [Pseudomonas entomophila L48]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    E     ++LV D +M G+  
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGFTNTEEADDGTTALPMLENGHY-DFLVTDWNMPGMSG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 61  IDLLRKVRAHDRLKGMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 112


>gi|49077582|gb|AAT49695.1| PA1456 [synthetic construct]
          Length = 125

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 31/118 (26%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGF-----TNTAEADDGTTA--LPMLHSGNFDFLVTDWN 54

Query: 56  MEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 55  MPGMTGIDLLRAVRADERLKHLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 112


>gi|291288742|ref|YP_003505558.1| response regulator receiver protein [Denitrovibrio acetiphilus DSM
           12809]
 gi|290885902|gb|ADD69602.1| response regulator receiver protein [Denitrovibrio acetiphilus DSM
           12809]
          Length = 125

 Score = 41.6 bits (96), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 27/117 (23%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++ VD S  +R++ ++     GF  V EA +  E  +   K  + + ++ D +M  +  L
Sbjct: 7   IITVDDSSTMRRIIKNTLTKLGFTNVLEAANGVEGLDVLAKNDV-DMIITDWNMPEMDGL 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            F+  +R      +  +  +  E   E ++   R+G N++++KPF  +TL+  + +L
Sbjct: 66  TFVKTIRSKEEYKETPILMVTTEAAKEDILTALRSGVNNYVVKPFTPDTLQEKVNKL 122


>gi|159898682|ref|YP_001544929.1| GAF sensor-containing adenylate/guanylate cyclase [Herpetosiphon
           aurantiacus ATCC 23779]
 gi|159891721|gb|ABX04801.1| adenylate/guanylate cyclase with GAF sensor(s) [Herpetosiphon
           aurantiacus ATCC 23779]
          Length = 1020

 Score = 41.6 bits (96), Expect = 0.038,   Method: Composition-based stats.
 Identities = 30/123 (24%), Positives = 62/123 (50%), Gaps = 3/123 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+V+    + ++ + L  D G+ V  A S  EA +F  + + P+ +++D S+ G+  ++
Sbjct: 9   VLIVEDDLSISRMFQLLLRDAGYRVSLANSSEEALQFV-RVITPDIILLDISLPGMNGVD 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
              H+R  P    + +  +    D    +A   AGA+  L+KP     L   +R + ++Q
Sbjct: 68  LTRHLRSNPAIPFIPIIQITALGDLRTKVAALDAGADDILVKPIELSELLARLRVMLRLQ 127

Query: 122 KSK 124
           K++
Sbjct: 128 KNR 130


>gi|323140625|ref|ZP_08075549.1| transcriptional regulatory protein ResD [Phascolarctobacterium sp.
           YIT 12067]
 gi|322414889|gb|EFY05684.1| transcriptional regulatory protein ResD [Phascolarctobacterium sp.
           YIT 12067]
          Length = 234

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+ D    +R++ R  F   GF V EA     A    + E  P+ L++D  M  VL+ 
Sbjct: 7   KILIADDEAQIREILRIYFEKEGFEVIEAEDGAAAILKVQSEK-PDILLLDIMMP-VLDG 64

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           I   +Q+   +D+ +  +  + D +  IAG   GA+ ++ KPFN
Sbjct: 65  IEVCKQVRKMSDLPIIMVTAKDDDDDRIAGLEIGADDYITKPFN 108


>gi|94970296|ref|YP_592344.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Candidatus Koribacter versatilis Ellin345]
 gi|94552346|gb|ABF42270.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Candidatus Koribacter versatilis Ellin345]
          Length = 467

 Score = 41.6 bits (96), Expect = 0.039,   Method: Composition-based stats.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 5/130 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +LL+VD   +VR+  R +    GF  F A +  +A +  +   + + +++D  + G+  L
Sbjct: 14  NLLIVDDERVVREGCRDVAQTLGFSTFTAENAEQAYKILDSTSV-DVILLDLRLPGIGGL 72

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E +  ++Q    T V V      V  +  +   + GA  ++ KPFN + LR  +  +   
Sbjct: 73  EALRQIKQRRPETIVIVVTGYATV--QSAVQAMKHGAFDYVTKPFNMDELRILLDRVTGH 130

Query: 121 QKSKDENQFL 130
            K   EN+ L
Sbjct: 131 LKLTTENRML 140


>gi|311105923|ref|YP_003978776.1| chemotaxis protein CheY [Achromobacter xylosoxidans A8]
 gi|310760612|gb|ADP16061.1| chemotaxis regulatory protein CheY [Achromobacter xylosoxidans A8]
          Length = 129

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPN----YLVIDESME 57
            +L+VD    +R++ R+L  + GF      +V EA +     E L N    ++V D +M 
Sbjct: 7   KILVVDDFPTMRRIIRNLLKELGF-----ENVDEAEDGAIGLEKLRNGGFQFVVSDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  LE +  +R       + V  +  E   E ++A A+AGAN +++KPF   TL
Sbjct: 62  NLDGLEMLKQIRADAALASLPVLMVTAEAKKENIVAAAQAGANGYVVKPFTAATL 116


>gi|289582799|ref|YP_003481265.1| response regulator receiver protein [Natrialba magadii ATCC 43099]
 gi|289532352|gb|ADD06703.1| response regulator receiver protein [Natrialba magadii ATCC 43099]
          Length = 120

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 1/115 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD SH +R + R +      ++ EA++  EA +   KE  P+ +++D  M      
Sbjct: 4   GVLIVDDSHFMRNLLRQILEQDHRIIGEASNGAEAVKL-YKEHDPDIVMMDIVMPKCNGI 62

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            A      +  D  V         EKM    +AGA+ ++ KPF   ++R A+ ++
Sbjct: 63  KATAAIKKIDPDARVIMCTSVGQREKMKLAVKAGADGYVTKPFEEPSVRKALTDV 117


>gi|322421210|ref|YP_004200433.1| response regulator receiver protein [Geobacter sp. M18]
 gi|320127597|gb|ADW15157.1| response regulator receiver protein [Geobacter sp. M18]
          Length = 121

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 34/119 (28%), Positives = 60/119 (50%), Gaps = 6/119 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVF-EATSVCEAREFCEKELLPNYLVIDESM--EGVL 60
           +++VD S  +RK+ R +  + G+ +  EA+   EA     KE LP+ + +D  M  +  +
Sbjct: 5   VMIVDDSLFMRKMLRDILTEEGYEIADEASDGVEAVAK-YKECLPDLVTLDIVMPNKTGI 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           E +  +     G  V +   + +       A  +AGA +F+LKPFN E +   +RE+ Q
Sbjct: 64  EALQEIMAYDAGARVVMCSAIGQEALTT--AATQAGAKAFILKPFNPELVTRVLREVAQ 120


>gi|46578674|ref|YP_009482.1| sensory box histidine kinase/response regulator [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|46448086|gb|AAS94741.1| sensory box histidine kinase/response regulator [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|311232547|gb|ADP85401.1| multi-sensor signal transduction histidine kinase [Desulfovibrio
           vulgaris RCH1]
          Length = 657

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV- 59
           +S+LLVD    +RKV      D G+ V  A    EA R F E+   P+ ++ D  M G+ 
Sbjct: 3   ESILLVDDEEGIRKVLGITLADAGYRVTTAADGEEAMRRFAEER--PDIVLTDIKMPGMS 60

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            LE +  ++     ++V V  L    D E  I   +  A  F+ KP N + L  A+
Sbjct: 61  GLELLESIKSRD--SEVEVIMLTGHGDMELAIQSLKRDATDFITKPINDDVLDIAL 114


>gi|266625346|ref|ZP_06118281.1| DNA-binding response regulator [Clostridium hathewayi DSM 13479]
 gi|288862751|gb|EFC95049.1| DNA-binding response regulator [Clostridium hathewayi DSM 13479]
          Length = 237

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 37/143 (25%), Positives = 64/143 (44%), Gaps = 17/143 (11%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLE 61
           +LLV+    ++++   +    GF V  A ++ EARE  +    P+ LV+D  +     L 
Sbjct: 7   ILLVEDDKNIQRINHRILEREGFQVLCAGTLSEARELLQTH-TPDVLVLDIMLPDGSGLS 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETLRF- 112
           F   +R     T   V +L    +  ++I G  AG N ++ KP++        +  LRF 
Sbjct: 66  FCEKIRPT---TSAPVLFLTALDEKSEIIEGLVAGGNDYITKPYDVDEFVARVKAQLRFV 122

Query: 113 --AMRELPQMQKSKDENQFLDAI 133
               RE+ Q +  K +   LD +
Sbjct: 123 EITRREMEQTKILKRDPLVLDTV 145


>gi|161520232|ref|YP_001583659.1| two component LuxR family transcriptional regulator [Burkholderia
           multivorans ATCC 17616]
 gi|189353590|ref|YP_001949217.1| LuxR family two-component transcriptional regulator [Burkholderia
           multivorans ATCC 17616]
 gi|160344282|gb|ABX17367.1| two component transcriptional regulator, LuxR family [Burkholderia
           multivorans ATCC 17616]
 gi|189337612|dbj|BAG46681.1| LuxR family two-component transcriptional regulator [Burkholderia
           multivorans ATCC 17616]
          Length = 205

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 36/118 (30%), Positives = 49/118 (41%), Gaps = 11/118 (9%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK------ELLPNYLVIDE 54
           M +L L+D   ++R     LF   G     A +  +AR F +          P  L+ID 
Sbjct: 1   MRNLYLIDDDDVIRDALDALFRSRGLA---ARAFGDARAFLDAWREDAFARAPACLLIDV 57

Query: 55  SMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            M G+   E  A +R   LG    V +L    D    +   RAGA  FL KPF+   L
Sbjct: 58  RMPGMSGFELFAQLRDAGLGAHHAVVFLTGHGDIPMAVDALRAGAYDFLEKPFSDNRL 115


>gi|109947708|ref|YP_664936.1| CheY response regulator [Helicobacter acinonychis str. Sheeba]
 gi|109714929|emb|CAJ99937.1| CheY response regulator [Helicobacter acinonychis str. Sheeba]
          Length = 124

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 55/111 (49%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++  +  G+  + EA    EA E  +       L+ D +M  +  L
Sbjct: 3   LLVVDDSSTMRRIIKNTLSRLGYEDILEAEHGIEAWEKLDANADTKVLITDWNMPEMNGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 63  DLVKKVRADSRFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|32266324|ref|NP_860356.1| chemotaxis regulatory protein CheY [Helicobacter hepaticus ATCC
           51449]
 gi|32262374|gb|AAP77422.1| chemotaxis regulatory protein CheY [Helicobacter hepaticus ATCC
           51449]
          Length = 125

 Score = 41.6 bits (96), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++     G+  + EA    EA +  +       L+ D +M  +  L
Sbjct: 3   LLVVDDSSTMRRIIKNTLQRLGYEDILEAEHGVEAWQIMDTTEGIQVLITDWNMPEMNGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR     T + +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 63  DLVKKVRSDERYTSIPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|186686366|ref|YP_001869562.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
 gi|186468818|gb|ACC84619.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
          Length = 807

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 41/139 (29%), Positives = 59/139 (42%), Gaps = 20/139 (14%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--ELLPNYLVID---ESME 57
           ++L+VD     R V  +L    GF V EA++    +E  EK   L PN +V D     M+
Sbjct: 597 TILMVDDRWENRTVITNLLQPLGFNVVEASN---GKEGLEKAIALKPNLIVTDLLMPEMD 653

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G  E I H+R  P   DV +      V         +AG N+FL KP   + L   + + 
Sbjct: 654 G-FELIKHLRHTPEIQDVLIIVSSASVFEADRNRSLQAGGNAFLSKPIQVDELLHQLEQY 712

Query: 118 -----------PQMQKSKD 125
                      P  +K+KD
Sbjct: 713 LNLVWIYKQSQPDGEKAKD 731


>gi|83592734|ref|YP_426486.1| response regulator receiver domain-containing protein
           [Rhodospirillum rubrum ATCC 11170]
 gi|83575648|gb|ABC22199.1| Response regulator receiver domain protein (CheY) [Rhodospirillum
           rubrum ATCC 11170]
          Length = 123

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L VD S  +R++ +      G+ V +A    E      +++  + +V D +M  +  L
Sbjct: 5   TILSVDDSASIRQMVKLTLTGAGYTVVQAADGAEGLARA-RDMAVDLVVTDLNMPVMNGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           + I  +R++P    V + +L  E D         AGA  ++ KPF +E L   +R++
Sbjct: 64  DLIRELRKLPTYKGVPIIFLTTESDAAMKQEAKVAGATGWITKPFQQEQLVTVVRKV 120


>gi|330811444|ref|YP_004355906.1| two-component response regulator [Pseudomonas brassicacearum subsp.
           brassicacearum NFM421]
 gi|327379552|gb|AEA70902.1| putative two-component response regulator [Pseudomonas
           brassicacearum subsp. brassicacearum NFM421]
          Length = 441

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 53/119 (44%), Gaps = 9/119 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMV--FEATSVCEAREFCEKELLPNYLVIDESMEG 58
           +DS+++VD    +R       +  GF V  F     C AR     E  P  ++ D  M G
Sbjct: 2   LDSVMVVDDEGSIRSAVEQWLSLSGFQVQLFSRADECLARL---PEHFPGVILSDVRMPG 58

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           +  LE +A VR+     D+ V  L    D    +   R GA  FL KPF+ E L  ++R
Sbjct: 59  LSGLELLAEVRRR--DPDLPVILLTGHGDVPMAVEAMRDGAYDFLEKPFSPEALLGSLR 115


>gi|317477826|ref|ZP_07937013.1| hsp90-like protein [Bacteroides sp. 4_1_36]
 gi|316906025|gb|EFV27792.1| hsp90-like protein [Bacteroides sp. 4_1_36]
          Length = 1347

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 6/110 (5%)

Query: 27   MVFEATSVCEAREFCEK--ELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVFVYYLL 81
            + F   S    RE  +K  EL+P+ +V D     M+G  E    V+     +D+ +  L 
Sbjct: 1120 LYFRIQSASNGREAWQKISELMPDIIVSDVMMPEMDGN-ELCRWVKTDKRTSDIPMILLT 1178

Query: 82   MEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLD 131
                 E  + G   GA+ ++ KPFN E L   MR+L  + K +     +D
Sbjct: 1179 ARQAVEDKVEGLTIGADDYVTKPFNVEILILRMRKLIDLSKKRKAKSLID 1228


>gi|298249976|ref|ZP_06973780.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297547980|gb|EFH81847.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 224

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 40/118 (33%), Positives = 58/118 (49%), Gaps = 10/118 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFG---FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           +L+ D   +VRK  R L  + G    +V EA    EA    + EL P+ +++D  M G+ 
Sbjct: 10  ILVADDHLVVRKGLRLLLEEMGEGFVLVGEAVDGKEAIRLTD-ELQPDVVLMDIRMPGMD 68

Query: 60  -LEFIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            LE I  +    P    V V  L    D E ++ G +AGA  +LLK  + ETL  A+R
Sbjct: 69  GLEAIEQIHWSWP---HVAVVILTTYTDDEALLRGLQAGACGYLLKETSAETLFHAIR 123


>gi|270294829|ref|ZP_06201030.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|270274076|gb|EFA19937.1| conserved hypothetical protein [Bacteroides sp. D20]
          Length = 1336

 Score = 41.6 bits (96), Expect = 0.040,   Method: Composition-based stats.
 Identities = 31/110 (28%), Positives = 49/110 (44%), Gaps = 6/110 (5%)

Query: 27   MVFEATSVCEAREFCEK--ELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVFVYYLL 81
            + F   S    RE  +K  EL+P+ +V D     M+G  E    V+     +D+ +  L 
Sbjct: 1109 LYFRIQSASNGREAWQKISELMPDIIVSDVMMPEMDGN-ELCRWVKTDKRTSDIPMILLT 1167

Query: 82   MEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLD 131
                 E  + G   GA+ ++ KPFN E L   MR+L  + K +     +D
Sbjct: 1168 ARQAVEDKVEGLTIGADDYVTKPFNVEILILRMRKLIDLSKKRKAKSLID 1217


>gi|182412431|ref|YP_001817497.1| two component transcriptional regulator [Opitutus terrae PB90-1]
 gi|177839645|gb|ACB73897.1| two component transcriptional regulator, winged helix family
           [Opitutus terrae PB90-1]
          Length = 248

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 60/127 (47%), Gaps = 5/127 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           ++ +L+VD   +VR V        G+ V EA    +A E   +E  P  +V+D  M   G
Sbjct: 14  LERILIVDDDPMVRAVVGSCLVRQGYRVLEAADGEQAMERIVREK-PALVVLDIEMPRVG 72

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            L  ++ +R+    T V +      VD    + G   GA+ +L KPFN+E L   +R L 
Sbjct: 73  GLAVLSRLRESGNLTPVLIVSSRSHVD--DRVNGLSLGADDYLTKPFNQEELLARIRALL 130

Query: 119 QMQKSKD 125
           + Q + +
Sbjct: 131 RRQAATE 137


>gi|120603758|ref|YP_968158.1| multi-sensor signal transduction histidine kinase [Desulfovibrio
           vulgaris DP4]
 gi|120563987|gb|ABM29731.1| multi-sensor signal transduction histidine kinase [Desulfovibrio
           vulgaris DP4]
          Length = 657

 Score = 41.6 bits (96), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 54/116 (46%), Gaps = 7/116 (6%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV- 59
           +S+LLVD    +RKV      D G+ V  A    EA R F E+   P+ ++ D  M G+ 
Sbjct: 3   ESILLVDDEEGIRKVLGITLADAGYRVTTAADGEEAMRRFAEER--PDIVLTDIKMPGMS 60

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            LE +  ++     ++V V  L    D E  I   +  A  F+ KP N + L  A+
Sbjct: 61  GLELLESIKSRD--SEVEVIMLTGHGDMELAIQSLKRDATDFITKPINDDVLDIAL 114


>gi|262370701|ref|ZP_06064026.1| two-component system response regulator [Acinetobacter johnsonii
           SH046]
 gi|262314501|gb|EEY95543.1| two-component system response regulator [Acinetobacter johnsonii
           SH046]
          Length = 254

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEG 58
           ++ +L+VD    +R + +    D GF+V  A    +     ++EL  + +V+D    +E 
Sbjct: 20  VERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDATQMDRLLQRELF-SLIVLDFMLPVED 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            L     +RQ  + T + +  L         IAG  AGA+ +L KPFN        R  L
Sbjct: 79  GLSICRRLRQSNIDTPIIM--LTARGSDSDRIAGLEAGADDYLPKPFNPNELLARIRAVL 136

Query: 111 RFAMRELP 118
           R  +RE+P
Sbjct: 137 RRQVREVP 144


>gi|261344156|ref|ZP_05971800.1| chemotaxis protein CheY [Providencia rustigianii DSM 4541]
 gi|282567750|gb|EFB73285.1| chemotaxis protein CheY [Providencia rustigianii DSM 4541]
          Length = 130

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           S L+VD    +R++ R+L  + GF  + EA    +A E      + +++V D +M  +  
Sbjct: 7   SFLVVDDFSTMRRIVRNLLKELGFNKIDEAEDGVDALEKIRAGNI-DFVVADWNMPNMDG 65

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           LE +  +R       + V  +  E   E +IA A+AGA+ +++KPF    L
Sbjct: 66  LELLKTIRGDEALKHIPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAAIL 116


>gi|33592177|ref|NP_879821.1| chemotaxis protein CheY [Bordetella pertussis Tohama I]
 gi|33601530|ref|NP_889090.1| chemotaxis protein CheY [Bordetella bronchiseptica RB50]
 gi|33571822|emb|CAE41333.1| chemotaxis protein CheY [Bordetella pertussis Tohama I]
 gi|33575966|emb|CAE33045.1| chemotaxis protein CheY [Bordetella bronchiseptica RB50]
 gi|332381593|gb|AEE66440.1| chemotaxis protein CheY [Bordetella pertussis CS]
          Length = 129

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPN----YLVIDESME 57
            +L+VD    +R++ R+L  + GF      +V EA +     E L N    ++V D +M 
Sbjct: 7   KILVVDDFPTMRRIIRNLLKELGF-----ENVDEAEDGAIGLEKLRNGAFQFVVSDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  LE +  +R       + V  +  E   E ++A A+AGAN +++KPF   TL
Sbjct: 62  NLDGLEMLKQIRADAALKSLPVLMVTAEAKKENIVAAAQAGANGYVVKPFTAATL 116


>gi|31792171|ref|NP_854664.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium bovis AF2122/97]
 gi|121636908|ref|YP_977131.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium bovis BCG str. Pasteur 1173P2]
 gi|215426257|ref|ZP_03424176.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis T92]
 gi|215429841|ref|ZP_03427760.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis EAS054]
 gi|219556849|ref|ZP_03535925.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis T17]
 gi|224989380|ref|YP_002644067.1| mycobacterial persistence regulator [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|260185890|ref|ZP_05763364.1| mycobacterial persistence regulator [Mycobacterium tuberculosis
           CPHL_A]
 gi|260200008|ref|ZP_05767499.1| mycobacterial persistence regulator [Mycobacterium tuberculosis
           T46]
 gi|260204195|ref|ZP_05771686.1| mycobacterial persistence regulator [Mycobacterium tuberculosis
           K85]
 gi|260204198|ref|ZP_05771689.1| mycobacterial persistence regulator [Mycobacterium tuberculosis
           K85]
 gi|289442401|ref|ZP_06432145.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis T46]
 gi|289446562|ref|ZP_06436306.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis CPHL_A]
 gi|289568958|ref|ZP_06449185.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis T17]
 gi|289573617|ref|ZP_06453844.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis K85]
 gi|289573619|ref|ZP_06453846.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis K85]
 gi|289749508|ref|ZP_06508886.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis T92]
 gi|289753038|ref|ZP_06512416.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis EAS054]
 gi|81712139|sp|Q7U0X4|MPRA_MYCBO RecName: Full=Response regulator mprA; AltName: Full=Mycobacterial
           persistence regulator A
 gi|160012448|sp|A1KHB7|MPRA_MYCBP RecName: Full=Response regulator mprA; AltName: Full=Mycobacterial
           persistence regulator A
 gi|29468250|gb|AAO85468.1| MprA [Mycobacterium bovis BCG]
 gi|31617759|emb|CAD93868.1| MYCOBACTERIAL PERSISTENCE REGULATOR MRPA (TWO COMPONENT RESPONSE
           TRANSCRIPTIONAL REGULATORY PROTEIN) [Mycobacterium bovis
           AF2122/97]
 gi|121492555|emb|CAL71023.1| Mycobacterial persistence regulator mrpA [Mycobacterium bovis BCG
           str. Pasteur 1173P2]
 gi|224772493|dbj|BAH25299.1| mycobacterial persistence regulator [Mycobacterium bovis BCG str.
           Tokyo 172]
 gi|289415320|gb|EFD12560.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis T46]
 gi|289419520|gb|EFD16721.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis CPHL_A]
 gi|289538048|gb|EFD42626.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis K85]
 gi|289538050|gb|EFD42628.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis K85]
 gi|289542712|gb|EFD46360.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis T17]
 gi|289690095|gb|EFD57524.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis T92]
 gi|289693625|gb|EFD61054.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis EAS054]
          Length = 230

 Score = 41.6 bits (96), Expect = 0.041,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 57/124 (45%), Gaps = 5/124 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA +    +  P+ LV+D  M  +  LE
Sbjct: 5   ILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDR-PDALVLDVMMPRLDGLE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 64  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 121

Query: 122 KSKD 125
           K +D
Sbjct: 122 KPED 125


>gi|332533257|ref|ZP_08409124.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Pseudoalteromonas
           haloplanktis ANT/505]
 gi|332037336|gb|EGI73791.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Pseudoalteromonas
           haloplanktis ANT/505]
          Length = 120

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---E 57
           M  +L VD S  +R++        GF V EA    EA    +++   + ++ D +M   +
Sbjct: 1   MKRILAVDDSASMRQMVSFTLKTAGFDVTEAKDGSEALAIAKQQDF-DAVISDVNMPIMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+   I  +R +P      +  L  E   EK + G  AGA  +++KPFN + L   ++++
Sbjct: 60  GI-TLIRELRTLPSYKFTPLLMLTTESGLEKKVEGKAAGATGWIVKPFNPDQLLAVIKKV 118


>gi|226939099|ref|YP_002794170.1| PhoB [Laribacter hongkongensis HLHK9]
 gi|226714023|gb|ACO73161.1| PhoB [Laribacter hongkongensis HLHK9]
          Length = 229

 Score = 41.6 bits (96), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 36/135 (26%), Positives = 60/135 (44%), Gaps = 8/135 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++LLV+    ++++        G  V  A S  EA +   K  LP+ +++D  + G   +
Sbjct: 4   TILLVEDEPAIQELIAFNLAQSGHQVLRAAS-AEAAQTLVKNALPDLVLLDWMLPGQSGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM-----R 115
           EF   +R      +V +  L    D +  IAG   GA+ ++ KPF+   L+  +     R
Sbjct: 63  EFARRLRSDERTREVPIIMLTARSDEQDKIAGLETGADDYITKPFSPRELQARIKAVLRR 122

Query: 116 ELPQMQKSKDENQFL 130
             PQM     E Q L
Sbjct: 123 RAPQMTDDAVEVQGL 137


>gi|157373328|ref|YP_001471928.1| response regulator receiver protein [Shewanella sediminis HAW-EB3]
 gi|157315702|gb|ABV34800.1| response regulator receiver protein [Shewanella sediminis HAW-EB3]
          Length = 120

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 59/122 (48%), Gaps = 9/122 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY-LVIDES---- 55
           M  +L VD S  +R++        GF V EA++  EA +  +K     Y LVI +     
Sbjct: 1   MKRILAVDDSASMRQMVGFTLKTAGFDVTEASNGDEALKVAQKG---EYDLVISDVNMPV 57

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G L  I ++R +P      +  L  E   +K   G  AGA  +++KPFN + L   +R
Sbjct: 58  MDG-LTLIRNLRTLPAYKFTPLLMLTTESGTDKKQEGRSAGATGWIVKPFNPDQLLATVR 116

Query: 116 EL 117
           ++
Sbjct: 117 KV 118


>gi|157827084|ref|YP_001496148.1| response regulator PleD [Rickettsia bellii OSU 85-389]
 gi|157802388|gb|ABV79111.1| response regulator PleD [Rickettsia bellii OSU 85-389]
          Length = 457

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 62/127 (48%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHI-VRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYL--VIDESMEGV 59
           ++L+VD     ++ +   L N++ + VF+A+S  EA    +KE +   L  V+   M+G 
Sbjct: 4   NILIVDDIETNIKLLEAKLLNEY-YTVFKASSGKEALNILKKEKVDIVLLDVMMPEMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    ++  P  T + V  +    D +  + G  AGA+ FL KP N   L   ++ L +
Sbjct: 62  FEVCKKIKSDPETTHIPVVMVTALSDVDDRVKGLEAGADEFLTKPINDNALFIRIKSLSR 121

Query: 120 MQKSKDE 126
           M+   DE
Sbjct: 122 MKSLIDE 128


>gi|308274302|emb|CBX30901.1| hypothetical protein N47_E44130 [uncultured Desulfobacterium sp.]
          Length = 471

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 29/105 (27%), Positives = 55/105 (52%), Gaps = 1/105 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLPNYLVIDESMEGVL 60
           +++LLVD    +R++G  L N  GF VF A +  EA E + E + + + +++D SM G+ 
Sbjct: 347 ETILLVDDEEPLRRLGYELLNKQGFTVFVAENGEEALEIYRENKKIIDLVILDVSMPGMG 406

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
            ++       +  ++ V  +    D  K+    ++GA  F+ KP+
Sbjct: 407 GYLCFKELRKMNPNIKVIIVTGYSDNGKVKEIIKSGAAGFVGKPY 451


>gi|89093394|ref|ZP_01166343.1| PAS protein [Oceanospirillum sp. MED92]
 gi|89082373|gb|EAR61596.1| PAS protein [Oceanospirillum sp. MED92]
          Length = 961

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 37/134 (27%), Positives = 62/134 (46%), Gaps = 23/134 (17%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +LLV+ +H VRK+ R    + GFMV EATS  EA            L +   ++ +   +
Sbjct: 840 VLLVEDNHDVRKLVRSQLTEMGFMVIEATSGDEA------------LAMMTGLDNLAGVV 887

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGAN----------SFLLKPFNRETLRFA 113
           + V  MP  +  +     +++ + K  A    G +            L KPF  + L+ A
Sbjct: 888 SDVI-MPGASSGYEVINAVKLLYPKAFAVIMTGYSDTPPETDFEYQLLQKPFTADHLKSA 946

Query: 114 MRELPQMQKSKDEN 127
           + +L Q+QK K+E+
Sbjct: 947 ISKLSQLQKVKEES 960


>gi|120554891|ref|YP_959242.1| response regulator receiver protein [Marinobacter aquaeolei VT8]
 gi|120324740|gb|ABM19055.1| response regulator receiver protein [Marinobacter aquaeolei VT8]
          Length = 127

 Score = 41.2 bits (95), Expect = 0.043,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 58/118 (49%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTDEADD--GNTALPMLRSGKYDFLVTDWN 58

Query: 56  MEGVLEF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  F  +  VR      ++ V  +  E   ++++A A+AG N +++KPF    L+
Sbjct: 59  MPGMSGFDLLKAVRADENLKNLPVLMVTAEAKRDQIVAAAQAGVNGYVVKPFTAAVLK 116


>gi|134295170|ref|YP_001118905.1| two component sigma54 specific Fis family transcriptional regulator
           [Burkholderia vietnamiensis G4]
 gi|134138327|gb|ABO54070.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia vietnamiensis G4]
          Length = 475

 Score = 41.2 bits (95), Expect = 0.043,   Method: Composition-based stats.
 Identities = 33/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 39  GFSVDTATSLAEARTALGRAI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 97

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L A
Sbjct: 98  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQALRA 147


>gi|327188807|gb|EGE56001.1| response regulator receiver protein [Rhizobium etli CNPAF512]
          Length = 122

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R   +   ++ G+ V EA    E     +     + +V D     M+G 
Sbjct: 4   NILTVDDSASIRLTTKVTLSNAGYNVTEAADGAEGLATAKSGRF-DLIVTDLNMPVMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R++P    V + +L  E D +       AGA  +L KPF+ E L
Sbjct: 62  LTMIEELRKLPGQAGVPIIFLTTESDADLKARAKAAGATGWLTKPFDPENL 112


>gi|309791481|ref|ZP_07685985.1| signal transduction histidine kinase [Oscillochloris trichoides
           DG6]
 gi|308226478|gb|EFO80202.1| signal transduction histidine kinase [Oscillochloris trichoides
           DG6]
          Length = 495

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 24/93 (25%), Positives = 48/93 (51%), Gaps = 5/93 (5%)

Query: 45  LLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLL 102
           + P+ +++D  M  +   E    +R  P    + V  +    D E ++ G R+GA+ F+ 
Sbjct: 47  IAPDLILLDVMMPDMDGFEVCERIRADPAFATIPVVMVTALDDQESLLRGIRSGADDFVT 106

Query: 103 KPFNRETLRFAMRELPQMQKSK---DENQFLDA 132
           KPFNR  LR  +R + ++ + +   DE + +++
Sbjct: 107 KPFNRTELRARIRTITRLNRFRTLLDEQRIVNS 139


>gi|224438183|ref|ZP_03659118.1| chemotaxis regulatory protein CheY [Helicobacter cinaedi CCUG
           18818]
 gi|313144628|ref|ZP_07806821.1| chemotaxis regulatory protein CheY [Helicobacter cinaedi CCUG
           18818]
 gi|313129659|gb|EFR47276.1| chemotaxis regulatory protein CheY [Helicobacter cinaedi CCUG
           18818]
          Length = 125

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G+  + EA    EA +  +       L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLQRLGYEDILEAEHGVEAWQIMDTTEGIQVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L+ +  VR     T + +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LDLVKKVRSDERYTTIPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|254463094|ref|ZP_05076510.1| nitrogen regulation protein NtrX [Rhodobacterales bacterium
           HTCC2083]
 gi|206679683|gb|EDZ44170.1| nitrogen regulation protein NtrX [Rhodobacteraceae bacterium
           HTCC2083]
          Length = 470

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 37/135 (27%), Positives = 59/135 (43%), Gaps = 9/135 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID-----ES 55
           M  +L+VD    +R++   +  D GF    A +  E      KE  P  +V+D      S
Sbjct: 1   MGDILIVDDERDIRELVSDILEDEGFTTRLAGTSDECMAQVTKEQ-PALMVLDIWLKDSS 59

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G+       +  P   DV V  +    + E  +A  + GA  F+ KPFN + L   +R
Sbjct: 60  MDGIDILKVIKKDYP---DVPVVIISGHGNVEIAVAAIKQGAYDFIEKPFNIDQLLVVIR 116

Query: 116 ELPQMQKSKDENQFL 130
              +  + + ENQ L
Sbjct: 117 RAMETSRLRHENQSL 131


>gi|46581081|ref|YP_011889.1| sensor histidine kinase/response regulator [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120601629|ref|YP_966029.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfovibrio vulgaris DP4]
 gi|46450502|gb|AAS97149.1| sensor histidine kinase/response regulator [Desulfovibrio vulgaris
           str. Hildenborough]
 gi|120561858|gb|ABM27602.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfovibrio vulgaris DP4]
 gi|311234758|gb|ADP87612.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfovibrio vulgaris RCH1]
          Length = 487

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 2/109 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S  +R   +     + F VFEA+S   A    E+      ++ D  M G+  LE
Sbjct: 128 ILVVDDSTSMRTFLKDELRRYMFQVFEASSGATALRLLERNPDIAVVITDYLMPGMDGLE 187

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
               +R       V V  + ++ +    ++  + GAN FL KPF+RE L
Sbjct: 188 LTRRIRNRWGRETVAVIGVSVQSEMPLTVSFIKNGANDFLTKPFHREEL 236


>gi|34498960|ref|NP_903175.1| two-component response regulator [Chromobacterium violaceum ATCC
           12472]
 gi|34104809|gb|AAQ61166.1| probable two-component response regulator [Chromobacterium
           violaceum ATCC 12472]
          Length = 402

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 31/131 (23%), Positives = 65/131 (49%), Gaps = 8/131 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++LLV+ S   R        + G+    AT+  EA E+C  + +P+ +++D     M+G 
Sbjct: 19  TILLVEDSATNRYFIEQFIQELGYRCASATNGVEAVEYCRNQ-VPDLVLMDIIMPEMDG- 76

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR---E 116
           L+    +R++     V + +L    + E +++G +AG + +L KP + + L   +     
Sbjct: 77  LQATTELRRLFGEHWVPIIFLTSLNELESVVSGLKAGGDDYLAKPVSFDLLSAKIHVFLR 136

Query: 117 LPQMQKSKDEN 127
           + QMQ   +++
Sbjct: 137 IAQMQNQINQD 147


>gi|83312600|ref|YP_422864.1| FOG: CheY-like receiver [Magnetospirillum magneticum AMB-1]
 gi|82947441|dbj|BAE52305.1| FOG: CheY-like receiver [Magnetospirillum magneticum AMB-1]
          Length = 135

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 38/117 (32%), Positives = 59/117 (50%), Gaps = 8/117 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNY-LVI-DESMEGV 59
           ++L+VD    + ++ R+L    GF  V EAT    A +      + NY LVI D +ME +
Sbjct: 15  NVLIVDDYKTMLRIIRNLLKQLGFNNVDEATDGAMALQMLR---VGNYGLVISDWNMEPM 71

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
             L+ +  VR       V    +  E   E +IA   AG +++++KPFN ETL+  M
Sbjct: 72  TGLQLLREVRADAKLKPVPFIMVTAESKSENVIAAKEAGVSNYIVKPFNAETLKTKM 128


>gi|30023367|ref|NP_834998.1| sporulation initiation phosphotransferase F [Bacillus cereus ATCC
           14579]
 gi|30265360|ref|NP_847737.1| stage 0 sporulation protein F [Bacillus anthracis str. Ames]
 gi|42784511|ref|NP_981758.1| stage 0 sporulation protein F [Bacillus cereus ATCC 10987]
 gi|47530902|ref|YP_022251.1| stage 0 sporulation protein F [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47569761|ref|ZP_00240433.1| chemotaxis response regulator [Bacillus cereus G9241]
 gi|49188171|ref|YP_031424.1| stage 0 sporulation protein F [Bacillus anthracis str. Sterne]
 gi|49480418|ref|YP_039329.1| stage 0 sporulation protein F [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|52140225|ref|YP_086605.1| stage 0 sporulation protein F [Bacillus cereus E33L]
 gi|65317314|ref|ZP_00390273.1| COG0784: FOG: CheY-like receiver [Bacillus anthracis str. A2012]
 gi|165871254|ref|ZP_02215903.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0488]
 gi|167635771|ref|ZP_02394081.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0442]
 gi|167640394|ref|ZP_02398658.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0193]
 gi|170688173|ref|ZP_02879384.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0465]
 gi|177651946|ref|ZP_02934529.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0174]
 gi|190569101|ref|ZP_03022000.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           Tsiankovskii-I]
 gi|196036944|ref|ZP_03104324.1| sporulation initiation phosphotransferase F [Bacillus cereus W]
 gi|196041017|ref|ZP_03108314.1| sporulation initiation phosphotransferase F [Bacillus cereus
           NVH0597-99]
 gi|196045429|ref|ZP_03112660.1| sporulation initiation phosphotransferase F [Bacillus cereus
           03BB108]
 gi|206970192|ref|ZP_03231145.1| sporulation initiation phosphotransferase F [Bacillus cereus
           AH1134]
 gi|206975822|ref|ZP_03236733.1| sporulation initiation phosphotransferase F [Bacillus cereus
           H3081.97]
 gi|217962825|ref|YP_002341403.1| sporulation initiation phosphotransferase F [Bacillus cereus AH187]
 gi|218234868|ref|YP_002370113.1| sporulation initiation phosphotransferase F [Bacillus cereus B4264]
 gi|218906515|ref|YP_002454349.1| sporulation initiation phosphotransferase F [Bacillus cereus AH820]
 gi|222098808|ref|YP_002532866.1| stage 0 sporulation protein f [Bacillus cereus Q1]
 gi|225867318|ref|YP_002752696.1| sporulation initiation phosphotransferase F [Bacillus cereus
           03BB102]
 gi|227818099|ref|YP_002818108.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. CDC 684]
 gi|228903811|ref|ZP_04067927.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           IBL 4222]
 gi|228911175|ref|ZP_04074981.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           IBL 200]
 gi|228917945|ref|ZP_04081481.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228924072|ref|ZP_04087348.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228930345|ref|ZP_04093349.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228936621|ref|ZP_04099415.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228942483|ref|ZP_04105020.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228949057|ref|ZP_04111329.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228955584|ref|ZP_04117585.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228961600|ref|ZP_04123209.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228968465|ref|ZP_04129454.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228975415|ref|ZP_04135971.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228983200|ref|ZP_04143439.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           Bt407]
 gi|228988563|ref|ZP_04148650.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|229051007|ref|ZP_04194555.1| Sporulation initiation phosphotransferase F [Bacillus cereus AH676]
 gi|229072803|ref|ZP_04206002.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           F65185]
 gi|229076550|ref|ZP_04209510.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock4-18]
 gi|229082550|ref|ZP_04215013.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock4-2]
 gi|229094449|ref|ZP_04225521.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock3-42]
 gi|229099769|ref|ZP_04230694.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock3-29]
 gi|229105928|ref|ZP_04236552.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock3-28]
 gi|229112749|ref|ZP_04242282.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock1-15]
 gi|229118831|ref|ZP_04248180.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock1-3]
 gi|229124840|ref|ZP_04254018.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           95/8201]
 gi|229130585|ref|ZP_04259541.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           BDRD-Cer4]
 gi|229142079|ref|ZP_04270604.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           BDRD-ST26]
 gi|229147876|ref|ZP_04276217.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           BDRD-ST24]
 gi|229153499|ref|ZP_04281677.1| Sporulation initiation phosphotransferase F [Bacillus cereus m1550]
 gi|229158897|ref|ZP_04286954.1| Sporulation initiation phosphotransferase F [Bacillus cereus ATCC
           4342]
 gi|229181585|ref|ZP_04308910.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           172560W]
 gi|229187562|ref|ZP_04314702.1| Sporulation initiation phosphotransferase F [Bacillus cereus BGSC
           6E1]
 gi|229193589|ref|ZP_04320533.1| Sporulation initiation phosphotransferase F [Bacillus cereus ATCC
           10876]
 gi|229199461|ref|ZP_04326124.1| Sporulation initiation phosphotransferase F [Bacillus cereus m1293]
 gi|229603895|ref|YP_002869551.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0248]
 gi|254687222|ref|ZP_05151080.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. CNEVA-9066]
 gi|254735265|ref|ZP_05192974.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. Western North America USA6153]
 gi|254744468|ref|ZP_05202148.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. Kruger B]
 gi|254755806|ref|ZP_05207838.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. Vollum]
 gi|254762146|ref|ZP_05213992.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. Australia 94]
 gi|296505760|ref|YP_003667460.1| sporulation initiation phosphotransferase F [Bacillus thuringiensis
           BMB171]
 gi|300117850|ref|ZP_07055617.1| sporulation initiation phosphotransferase F [Bacillus cereus SJ1]
 gi|301056804|ref|YP_003795015.1| stage 0 sporulation protein F [Bacillus anthracis CI]
 gi|29898928|gb|AAP12199.1| Sporulation initiation phosphotransferase F [Bacillus cereus ATCC
           14579]
 gi|30260038|gb|AAP29223.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. Ames]
 gi|42740443|gb|AAS44366.1| stage 0 sporulation protein F [Bacillus cereus ATCC 10987]
 gi|47506050|gb|AAT34726.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. 'Ames Ancestor']
 gi|47553557|gb|EAL11936.1| chemotaxis response regulator [Bacillus cereus G9241]
 gi|49182098|gb|AAT57474.1| stage 0 sporulation protein F [Bacillus anthracis str. Sterne]
 gi|49331974|gb|AAT62620.1| stage 0 sporulation protein F [Bacillus thuringiensis serovar
           konkukian str. 97-27]
 gi|51973694|gb|AAU15244.1| stage 0 sporulation protein F [Bacillus cereus E33L]
 gi|164712921|gb|EDR18449.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0488]
 gi|167511614|gb|EDR86996.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0193]
 gi|167528880|gb|EDR91637.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0442]
 gi|170667866|gb|EDT18618.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0465]
 gi|172082650|gb|EDT67714.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0174]
 gi|190559769|gb|EDV13755.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           Tsiankovskii-I]
 gi|195990446|gb|EDX54434.1| sporulation initiation phosphotransferase F [Bacillus cereus W]
 gi|196023636|gb|EDX62312.1| sporulation initiation phosphotransferase F [Bacillus cereus
           03BB108]
 gi|196028185|gb|EDX66795.1| sporulation initiation phosphotransferase F [Bacillus cereus
           NVH0597-99]
 gi|206734769|gb|EDZ51938.1| sporulation initiation phosphotransferase F [Bacillus cereus
           AH1134]
 gi|206745916|gb|EDZ57312.1| sporulation initiation phosphotransferase F [Bacillus cereus
           H3081.97]
 gi|217063585|gb|ACJ77835.1| sporulation initiation phosphotransferase F [Bacillus cereus AH187]
 gi|218162825|gb|ACK62817.1| sporulation initiation phosphotransferase F [Bacillus cereus B4264]
 gi|218538011|gb|ACK90409.1| sporulation initiation phosphotransferase F [Bacillus cereus AH820]
 gi|221242867|gb|ACM15577.1| stage 0 sporulation protein F [Bacillus cereus Q1]
 gi|225786860|gb|ACO27077.1| sporulation initiation phosphotransferase F [Bacillus cereus
           03BB102]
 gi|227007058|gb|ACP16801.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. CDC 684]
 gi|228584037|gb|EEK42192.1| Sporulation initiation phosphotransferase F [Bacillus cereus m1293]
 gi|228589894|gb|EEK47769.1| Sporulation initiation phosphotransferase F [Bacillus cereus ATCC
           10876]
 gi|228595929|gb|EEK53609.1| Sporulation initiation phosphotransferase F [Bacillus cereus BGSC
           6E1]
 gi|228601781|gb|EEK59277.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           172560W]
 gi|228624508|gb|EEK81278.1| Sporulation initiation phosphotransferase F [Bacillus cereus ATCC
           4342]
 gi|228630103|gb|EEK86754.1| Sporulation initiation phosphotransferase F [Bacillus cereus m1550]
 gi|228635526|gb|EEK92015.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           BDRD-ST24]
 gi|228641368|gb|EEK97674.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           BDRD-ST26]
 gi|228652924|gb|EEL08806.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           BDRD-Cer4]
 gi|228658631|gb|EEL14293.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           95/8201]
 gi|228664632|gb|EEL20125.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock1-3]
 gi|228670730|gb|EEL26041.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock1-15]
 gi|228677502|gb|EEL31755.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock3-28]
 gi|228683658|gb|EEL37611.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock3-29]
 gi|228688986|gb|EEL42813.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock3-42]
 gi|228700982|gb|EEL53505.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock4-2]
 gi|228706583|gb|EEL58796.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock4-18]
 gi|228710294|gb|EEL62269.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           F65185]
 gi|228722316|gb|EEL73713.1| Sporulation initiation phosphotransferase F [Bacillus cereus AH676]
 gi|228771180|gb|EEM19659.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar tochigiensis BGSC 4Y1]
 gi|228776528|gb|EEM24856.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           Bt407]
 gi|228784397|gb|EEM32420.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar thuringiensis str. T01001]
 gi|228791245|gb|EEM38858.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar sotto str. T04001]
 gi|228798082|gb|EEM45086.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar pakistani str. T13001]
 gi|228804087|gb|EEM50705.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar kurstaki str. T03a001]
 gi|228810630|gb|EEM56979.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar monterrey BGSC 4AJ1]
 gi|228817225|gb|EEM63313.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar berliner ATCC 10792]
 gi|228823056|gb|EEM68894.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar andalousiensis BGSC 4AW1]
 gi|228829331|gb|EEM74964.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar pondicheriensis BGSC 4BA1]
 gi|228835562|gb|EEM80927.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar huazhongensis BGSC 4BD1]
 gi|228841742|gb|EEM86853.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar pulsiensis BGSC 4CC1]
 gi|228848538|gb|EEM93386.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           IBL 200]
 gi|228855838|gb|EEN00382.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           IBL 4222]
 gi|229268303|gb|ACQ49940.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0248]
 gi|296326812|gb|ADH09740.1| sporulation initiation phosphotransferase F [Bacillus thuringiensis
           BMB171]
 gi|298724714|gb|EFI65389.1| sporulation initiation phosphotransferase F [Bacillus cereus SJ1]
 gi|300378973|gb|ADK07877.1| stage 0 sporulation protein F [Bacillus cereus biovar anthracis
           str. CI]
 gi|324329286|gb|ADY24546.1| stage 0 sporulation protein F [Bacillus thuringiensis serovar
           finitimus YBT-020]
 gi|326943134|gb|AEA19030.1| sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar chinensis CT-43]
          Length = 122

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 61/116 (52%), Gaps = 7/116 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +  +A +  +K+  P+ +V+D  + G+  +
Sbjct: 4   KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKD-NPDLVVLDMKIPGMDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETLRFAMR 115
           E + HV+++     V +     E+D   MI  A+  GA     KPF+ + +R A+R
Sbjct: 63  EILKHVKEIDESIKVILMTAYGELD---MIQEAKDLGALMHFAKPFDIDEIRQAVR 115


>gi|332559683|ref|ZP_08414005.1| response regulator receiver protein [Rhodobacter sphaeroides WS8N]
 gi|332277395|gb|EGJ22710.1| response regulator receiver protein [Rhodobacter sphaeroides WS8N]
          Length = 418

 Score = 41.2 bits (95), Expect = 0.044,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 65/136 (47%), Gaps = 11/136 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S   R++       +G+ V EA +  EA   C+   + + ++ D  M G+  LE
Sbjct: 16  VLIVDDSRAQRRLVALSLARWGYRVSEAATASEALALCQGGDV-DIVLSDWMMPGMSGLE 74

Query: 62  FIAHVRQMPLGTDVFVYYLLM--EVDFEKMIAGARAGANSFLLKPFN----RETLRFAMR 115
               +R +P   + + Y++L+       +++ G   GA+ +L+KP      R  LR   R
Sbjct: 75  LCRRIRALP--GEAYCYFILLTSRSGTGEVVDGLDCGADDYLVKPAAPDELRARLRAGER 132

Query: 116 ELPQMQKSKDENQFLD 131
            L    +  D+NQ L+
Sbjct: 133 VLSMQAELVDKNQLLE 148


>gi|254517113|ref|ZP_05129171.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase [gamma proteobacterium NOR5-3]
 gi|219674618|gb|EED30986.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase [gamma proteobacterium NOR5-3]
          Length = 609

 Score = 41.2 bits (95), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 47/105 (44%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+ D    VR + R      G +V EA    EA +   +E  P+ + +D  M G+  LE
Sbjct: 14  ILVADDDMNVRLLSRQCLESEGMIVVEAADGHEALDAFVRER-PDLVFLDVEMPGMTGLE 72

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
               +R MP G  V +  +    D + +  G  AGA  +  KP N
Sbjct: 73  VCRRIRAMPQGESVPIMIVTGSDDRKSIDDGFDAGATQYKTKPVN 117


>gi|262373678|ref|ZP_06066956.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acinetobacter junii SH205]
 gi|262311431|gb|EEY92517.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acinetobacter junii SH205]
          Length = 254

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEG 58
           ++ +L+VD    +R + +    D GF+V  A    +     ++EL  + +V+D    +E 
Sbjct: 20  VERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDATQMDRLLQRELF-SLIVLDFMLPVED 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            L     +RQ  + T + +  L         IAG  AGA+ +L KPFN        R  L
Sbjct: 79  GLSICRRLRQSNIDTPIIM--LTARGSDSDRIAGLEAGADDYLPKPFNPNELLARIRAVL 136

Query: 111 RFAMRELP 118
           R  +RE+P
Sbjct: 137 RRQVREVP 144


>gi|262375130|ref|ZP_06068364.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acinetobacter lwoffii SH145]
 gi|262310143|gb|EEY91272.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acinetobacter lwoffii SH145]
          Length = 254

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEG 58
           ++ +L+VD    +R + +    D GF+V  A    +     ++EL  + +V+D    +E 
Sbjct: 20  VERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDATQMDRLLQRELF-SLIVLDFMLPVED 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            L     +RQ  + T + +  L         IAG  AGA+ +L KPFN        R  L
Sbjct: 79  GLSICRRLRQSNIDTPIIM--LTARGSDSDRIAGLEAGADDYLPKPFNPNELLARIRAVL 136

Query: 111 RFAMRELP 118
           R  +RE+P
Sbjct: 137 RRQVREVP 144


>gi|257465706|ref|ZP_05630077.1| two-component response regulator [Actinobacillus minor 202]
 gi|257451366|gb|EEV25409.1| two-component response regulator [Actinobacillus minor 202]
          Length = 239

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 30/126 (23%), Positives = 61/126 (48%), Gaps = 2/126 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+   + R   +++F   G+ VFEA    +  E   K+ + + +++D ++ G    
Sbjct: 6   QVLIVEDEAVTRNTLKNIFEAEGYNVFEAIDGTQMHEILAKQTI-HLVIMDINLPGKNGL 64

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
           +   R++   T+V + +L    +    I G   GA+ ++ KPFN   L    R L     
Sbjct: 65  ML-ARELRETTEVALMFLTGRDNEIDKILGLEIGADDYITKPFNPRELTIRARNLLSRTM 123

Query: 123 SKDENQ 128
           S+D+++
Sbjct: 124 SEDKDK 129


>gi|226953701|ref|ZP_03824165.1| osmolarity response regulator [Acinetobacter sp. ATCC 27244]
 gi|294651821|ref|ZP_06729115.1| transcriptional regulatory protein OmpR [Acinetobacter haemolyticus
           ATCC 19194]
 gi|226835573|gb|EEH67956.1| osmolarity response regulator [Acinetobacter sp. ATCC 27244]
 gi|292822285|gb|EFF81194.1| transcriptional regulatory protein OmpR [Acinetobacter haemolyticus
           ATCC 19194]
          Length = 254

 Score = 41.2 bits (95), Expect = 0.045,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEG 58
           ++ +L+VD    +R + +    D GF+V  A    +     ++EL  + +V+D    +E 
Sbjct: 20  VERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDATQMDRLLQRELF-SLIVLDFMLPVED 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            L     +RQ  + T + +  L         IAG  AGA+ +L KPFN        R  L
Sbjct: 79  GLSICRRLRQSNIDTPIIM--LTARGSDSDRIAGLEAGADDYLPKPFNPNELLARIRAVL 136

Query: 111 RFAMRELP 118
           R  +RE+P
Sbjct: 137 RRQVREVP 144


>gi|307154214|ref|YP_003889598.1| response regulator receiver protein [Cyanothece sp. PCC 7822]
 gi|306984442|gb|ADN16323.1| response regulator receiver protein [Cyanothece sp. PCC 7822]
          Length = 140

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 32/116 (27%), Positives = 53/116 (45%), Gaps = 3/116 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+++    VR+    L    GF VF   +   A  + E  L P+ ++ D  M  + 
Sbjct: 1   MKKILVIEDELSVRENLVELLEAEGFQVFSTDNGILALLWAEDNL-PDLIICDVMMPEID 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
             E +  +RQ+P+   +   +L    D   +  G   GA+ +L KPF RE L  A+
Sbjct: 60  GYEVLEGLRQIPMRASIPFIFLTAMADKADIRYGMELGADDYLTKPFTREELLRAI 115


>gi|170708042|ref|ZP_02898490.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0389]
 gi|170127015|gb|EDS95894.1| sporulation initiation phosphotransferase F [Bacillus anthracis
           str. A0389]
          Length = 122

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 61/116 (52%), Gaps = 7/116 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +  +A +  +K+  P+ +V+D  + G+  +
Sbjct: 4   KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKD-NPDLVVLDMKIPGMDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETLRFAMR 115
           E + HV+++     V +     E+D   MI  A+  GA     KPF+ + +R A+R
Sbjct: 63  EILKHVKEIDESIKVILMTAYGELD---MIQEAKDLGALMHFAKPFDIDEIRQAVR 115


>gi|183598606|ref|ZP_02960099.1| hypothetical protein PROSTU_02004 [Providencia stuartii ATCC 25827]
 gi|188020783|gb|EDU58823.1| hypothetical protein PROSTU_02004 [Providencia stuartii ATCC 25827]
          Length = 130

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           S L+VD    +R++ R+L  + GF  + EA    +A E      + +++V D +M  +  
Sbjct: 7   SFLVVDDFSTMRRIVRNLLKELGFNKIEEAEDGVDALEKIRAGHI-DFVVADWNMPNMDG 65

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           LE +  +R       + V  +  E   E +IA A+AGA+ +++KPF    L
Sbjct: 66  LELLKTIRGDEALKHIPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAAIL 116


>gi|169632218|ref|YP_001705954.1| osmolarity response regulator [Acinetobacter baumannii SDF]
 gi|169794452|ref|YP_001712245.1| osmolarity response regulator [Acinetobacter baumannii AYE]
 gi|184159742|ref|YP_001848081.1| osmolarity response regulator [Acinetobacter baumannii ACICU]
 gi|213158975|ref|YP_002320973.1| two-component system response regulator protein [Acinetobacter
           baumannii AB0057]
 gi|215482041|ref|YP_002324223.1| Transcriptional regulatory protein ompR [Acinetobacter baumannii
           AB307-0294]
 gi|260550801|ref|ZP_05825008.1| two-component system response regulator protein [Acinetobacter sp.
           RUH2624]
 gi|260556885|ref|ZP_05829102.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acinetobacter baumannii ATCC 19606]
 gi|262280372|ref|ZP_06058156.1| two-component system response regulator protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|293610675|ref|ZP_06692975.1| two component transcriptional regulator [Acinetobacter sp. SH024]
 gi|299768511|ref|YP_003730537.1| osmolarity response regulator [Acinetobacter sp. DR1]
 gi|301346029|ref|ZP_07226770.1| osmolarity response regulator [Acinetobacter baumannii AB056]
 gi|301512909|ref|ZP_07238146.1| osmolarity response regulator [Acinetobacter baumannii AB058]
 gi|301595102|ref|ZP_07240110.1| osmolarity response regulator [Acinetobacter baumannii AB059]
 gi|332850218|ref|ZP_08432581.1| transcriptional regulatory protein OmpR [Acinetobacter baumannii
           6013150]
 gi|332868815|ref|ZP_08438420.1| transcriptional regulatory protein OmpR [Acinetobacter baumannii
           6013113]
 gi|332874244|ref|ZP_08442164.1| transcriptional regulatory protein OmpR [Acinetobacter baumannii
           6014059]
 gi|169147379|emb|CAM85240.1| two-component response regulator [Acinetobacter baumannii AYE]
 gi|169151010|emb|CAO99647.1| two-component response regulator [Acinetobacter baumannii]
 gi|183211336|gb|ACC58734.1| Response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Acinetobacter baumannii
           ACICU]
 gi|193078590|gb|ABO13619.2| two-component response regulator [Acinetobacter baumannii ATCC
           17978]
 gi|213058135|gb|ACJ43037.1| two-component system response regulator protein [Acinetobacter
           baumannii AB0057]
 gi|213986795|gb|ACJ57094.1| Transcriptional regulatory protein ompR [Acinetobacter baumannii
           AB307-0294]
 gi|260406111|gb|EEW99596.1| two-component system response regulator protein [Acinetobacter sp.
           RUH2624]
 gi|260409491|gb|EEX02792.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acinetobacter baumannii ATCC 19606]
 gi|262258150|gb|EEY76884.1| two-component system response regulator protein [Acinetobacter
           calcoaceticus RUH2202]
 gi|292827019|gb|EFF85384.1| two component transcriptional regulator [Acinetobacter sp. SH024]
 gi|298698599|gb|ADI89164.1| osmolarity response regulator [Acinetobacter sp. DR1]
 gi|322509655|gb|ADX05109.1| ompR [Acinetobacter baumannii 1656-2]
 gi|323519675|gb|ADX94056.1| osmolarity response regulator [Acinetobacter baumannii TCDC-AB0715]
 gi|332730862|gb|EGJ62170.1| transcriptional regulatory protein OmpR [Acinetobacter baumannii
           6013150]
 gi|332733129|gb|EGJ64327.1| transcriptional regulatory protein OmpR [Acinetobacter baumannii
           6013113]
 gi|332737528|gb|EGJ68435.1| transcriptional regulatory protein OmpR [Acinetobacter baumannii
           6014059]
          Length = 254

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEG 58
           ++ +L+VD    +R + +    D GF+V  A    +     ++EL  + +V+D    +E 
Sbjct: 20  VERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDASQMDRLLQRELF-SLIVLDFMLPVED 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            L     +RQ  + T + +  L         IAG  AGA+ +L KPFN        R  L
Sbjct: 79  GLSICRRLRQSNIDTPIIM--LTARGSDSDRIAGLEAGADDYLPKPFNPNELLARIRAVL 136

Query: 111 RFAMRELP 118
           R  +RE+P
Sbjct: 137 RRQVREVP 144


>gi|170722829|ref|YP_001750517.1| response regulator receiver protein [Pseudomonas putida W619]
 gi|169760832|gb|ACA74148.1| response regulator receiver protein [Pseudomonas putida W619]
          Length = 128

 Score = 41.2 bits (95), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    E     ++LV D +M G+  
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGFTNTEEADDGTTALPMLESGHY-DFLVTDWNMPGMSG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 65  IDLLRKVRAHDRLKAMPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQVLK 116


>gi|50086362|ref|YP_047872.1| osmolarity response regulator [Acinetobacter sp. ADP1]
 gi|49532338|emb|CAG70050.1| two-component response regulator [Acinetobacter sp. ADP1]
          Length = 254

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 59/128 (46%), Gaps = 13/128 (10%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID--ESMEG 58
           ++ +L+VD    +R + +    D GF+V  A    +     ++EL  + +V+D    +E 
Sbjct: 20  VERILVVDDDVRLRTLLQRFLEDKGFVVKTAHDATQMDRLLQRELF-SLIVLDFMLPVED 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            L     +RQ  + T + +  L         IAG  AGA+ +L KPFN        R  L
Sbjct: 79  GLSICRRLRQSNIDTPIIM--LTARGSDSDRIAGLEAGADDYLPKPFNPNELLARIRAVL 136

Query: 111 RFAMRELP 118
           R  +RE+P
Sbjct: 137 RRQVREVP 144


>gi|332706171|ref|ZP_08426240.1| two component transcriptional regulator, LuxR family [Lyngbya
           majuscula 3L]
 gi|332355008|gb|EGJ34479.1| two component transcriptional regulator, LuxR family [Lyngbya
           majuscula 3L]
          Length = 249

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 33/126 (26%), Positives = 61/126 (48%), Gaps = 3/126 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    VR+  +    +FGF V  A++  +A +  ++   P  ++ D  M  V   +
Sbjct: 26  LLLVDDEPGVREAVKEYLAEFGFTVQVASNANDAWQMLQQNT-PELVISDIMMPKVDGYQ 84

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F+  +R  P    + V +L         I G +AG +++L KPF+ + L   ++ L + +
Sbjct: 85  FLQQLRDDPRFKALPVVFLTARGMTSDRIQGYQAGCDAYLPKPFDPDELVAIVQNLLERR 144

Query: 122 KSKDEN 127
            +  E+
Sbjct: 145 AASSED 150


>gi|304391317|ref|ZP_07373261.1| protein PetR [Ahrensia sp. R2A130]
 gi|303296673|gb|EFL91029.1| protein PetR [Ahrensia sp. R2A130]
          Length = 246

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 61/130 (46%), Gaps = 15/130 (11%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+VD    +R++      + GF V  A+   EAR   +  L  + L++D  M G    +
Sbjct: 27  ILVVDDDSRIRELLTRYLAEQGFRVSSASDASEARRQLQG-LSFDLLIVDVMMPGERGTD 85

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RETL--------RF 112
           F   +R+     DV V  L    + +  IAG  AGA+ +L KPF+ RE L        R 
Sbjct: 86  FTRSIRE---DLDVPVMMLTALGETDSRIAGLEAGADDYLAKPFSPRELLLRINAILKRV 142

Query: 113 AMRELPQMQK 122
              ELP +++
Sbjct: 143 QTEELPGIEQ 152


>gi|219847289|ref|YP_002461722.1| LuxR family two component transcriptional regulator [Chloroflexus
           aggregans DSM 9485]
 gi|219541548|gb|ACL23286.1| two component transcriptional regulator, LuxR family [Chloroflexus
           aggregans DSM 9485]
          Length = 217

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 38/118 (32%), Positives = 62/118 (52%), Gaps = 9/118 (7%)

Query: 3   SLLLVDSSHIVRKVGR---HLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           ++LL+D   +VR+  R    L +D   +V EA S  E  E   +ELLP+ +++D  M G+
Sbjct: 5   TVLLIDDHRVVRQGLRDFLELQSDIE-VVGEAASGEEGIELA-RELLPDVVLMDLVMPGI 62

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
             +E    ++ +   + V V  L    D +K+    +AGA S+LLK  + E L  A+R
Sbjct: 63  DGVETTRRIKAVSPSSQVIV--LTSFADDDKVFPAIKAGAISYLLKDISPEELAHAIR 118


>gi|219850153|ref|YP_002464586.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219544412|gb|ACL26150.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 231

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 2/115 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD    +R++ R      GF V +A     A E   +   P+ +++D  M  VL+ 
Sbjct: 5   TILIVDDEARLRELVRRYLEQAGFRVVQAADGVTALEQA-RAWTPDVVILD-IMLPVLDG 62

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +A  R++   +D ++  L    +    + G   GA+ +L KPF    L   +R L
Sbjct: 63  LAVCRRLRTFSDAYILMLTARAEESDRVTGLETGADDYLTKPFAPRELVARVRAL 117


>gi|222054627|ref|YP_002536989.1| Fis family transcriptional regulator [Geobacter sp. FRC-32]
 gi|221563916|gb|ACM19888.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Geobacter sp. FRC-32]
          Length = 454

 Score = 41.2 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 31/129 (24%), Positives = 61/129 (47%), Gaps = 5/129 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +LL+D    +R+V  +   + G+ V  A    E       E  P  ++ D  M G+  F 
Sbjct: 5   ILLIDDDTSLRRVLEYNLQEEGYEVITAVD-GETGLALFNEHSPPLVITDLKMPGITGFQ 63

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            ++ +++    T V V      +D    I   + GA+ ++ KPFNR+ L+  +++  +++
Sbjct: 64  VLSTIKERSPATLVIVITAFGAID--TAIEAMKLGAHDYITKPFNRDQLKLVVKKALELR 121

Query: 122 KSKDENQFL 130
              +EN+ L
Sbjct: 122 GLTEENRLL 130


>gi|315922180|ref|ZP_07918420.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. D2]
 gi|313696055|gb|EFS32890.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. D2]
          Length = 1322

 Score = 41.2 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 6/111 (5%)

Query: 26   FMVFEATSVCEAREFC-EKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLM 82
            + V+EA++  EA     EKE+  + +V D  M G+   E    +++    + +F+  L  
Sbjct: 1097 YQVWEASNGEEAEAIANEKEV--DIIVSDVMMPGMDGFELCLRLKENMKTSHIFIILLTA 1154

Query: 83   EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDAI 133
                E  +AG ++GA+ +L KPFN + L+  ++ L  +Q+ K +  FL  I
Sbjct: 1155 RTGDENELAGYQSGADCYLTKPFNMDILKNRIQHLLALQQ-KRKQIFLSGI 1204


>gi|260173915|ref|ZP_05760327.1| two-component system sensor histidine kinase/response regulator,
            hybrid ('one component system') [Bacteroides sp. D2]
          Length = 1308

 Score = 41.2 bits (95), Expect = 0.047,   Method: Composition-based stats.
 Identities = 32/111 (28%), Positives = 58/111 (52%), Gaps = 6/111 (5%)

Query: 26   FMVFEATSVCEAREFC-EKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLM 82
            + V+EA++  EA     EKE+  + +V D  M G+   E    +++    + +F+  L  
Sbjct: 1083 YQVWEASNGEEAEAIANEKEV--DIIVSDVMMPGMDGFELCLRLKENMKTSHIFIILLTA 1140

Query: 83   EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDAI 133
                E  +AG ++GA+ +L KPFN + L+  ++ L  +Q+ K +  FL  I
Sbjct: 1141 RTGDENELAGYQSGADCYLTKPFNMDILKNRIQHLLALQQ-KRKQIFLSGI 1190


>gi|75765162|ref|ZP_00744427.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
 gi|74487350|gb|EAO51301.1| Sporulation initiation phosphotransferase F [Bacillus thuringiensis
           serovar israelensis ATCC 35646]
          Length = 125

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 61/116 (52%), Gaps = 7/116 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +  +A +  +K+  P+ +V+D  + G+  +
Sbjct: 7   KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKD-NPDLVVLDMKIPGMDGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETLRFAMR 115
           E + HV+++     V +     E+D   MI  A+  GA     KPF+ + +R A+R
Sbjct: 66  EILKHVKEIDESIKVILMTAYGELD---MIQEAKDLGALMHFAKPFDIDEIRQAVR 118


>gi|46201206|ref|ZP_00055549.2| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
          Length = 122

 Score = 41.2 bits (95), Expect = 0.047,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 58/121 (47%), Gaps = 10/121 (8%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNY-LVID----ESM 56
           ++L+VD    + ++ R+L    GF  V EAT    A +      + NY LVI     E M
Sbjct: 2   NVLIVDDYKTMLRIIRNLLKQLGFNNVDEATDGAMALQMLR---VGNYGLVISDWNMEPM 58

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
            G L+ +  VR       V    +  E   E +IA   AG +++++KPFN ETL+  M  
Sbjct: 59  TG-LQLLREVRADAKLKPVPFIMVTAESKSENVIAAKEAGVSNYIVKPFNAETLKTKMTS 117

Query: 117 L 117
           +
Sbjct: 118 V 118


>gi|226944869|ref|YP_002799942.1| Response regulator CheY [Azotobacter vinelandii DJ]
 gi|226719796|gb|ACO78967.1| Response regulator CheY [Azotobacter vinelandii DJ]
          Length = 148

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 34/111 (30%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           S+L+VD    +R++ R L  + GF  V EA    +A           ++V D +M  +  
Sbjct: 26  SILVVDDFPTMRRIVRSLLKELGFNNVDEAEDGQDALNKLRGGSF-EFVVSDWNMPNLDG 84

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           LE +  +R       + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 85  LEMLKQIRSDDGLKHLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 135


>gi|186686259|ref|YP_001869455.1| two component transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186468711|gb|ACC84512.1| two component transcriptional regulator, winged helix family
           [Nostoc punctiforme PCC 73102]
          Length = 236

 Score = 41.2 bits (95), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 34/141 (24%), Positives = 65/141 (46%), Gaps = 12/141 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           MD L++ D   I   +   L  +  F       +   R F E+   P+ +++D  + G+ 
Sbjct: 1   MDILIVEDEPEIAHLIQLSLEKEGFFCRISRDGINALRMFQEQP--PDLIILDLMIPGLD 58

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            LE  A +RQ P   D ++  L  + +    + G   GA+ +++KPF+        R  L
Sbjct: 59  GLEVCARIRQKPGTKDPYILMLTAKGEEIDRVIGLSTGADDYMVKPFSPRELIARVRALL 118

Query: 111 RFAMRELPQMQKSKDENQFLD 131
           R ++R+  Q Q ++ ++  +D
Sbjct: 119 RRSLRQGGQNQVNRTQHFIVD 139


>gi|313683102|ref|YP_004060840.1| response regulator receiver protein [Sulfuricurvum kujiense DSM
           16994]
 gi|313155962|gb|ADR34640.1| response regulator receiver protein [Sulfuricurvum kujiense DSM
           16994]
          Length = 124

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 27/111 (24%), Positives = 54/111 (48%), Gaps = 3/111 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LL+VD S  +R++ ++  +  G+  VFE     +      +    N L+ D +M  +  L
Sbjct: 3   LLVVDDSSTMRRIIKNTLSRLGYEDVFEGEDGLQGWNILNQNPDINMLITDWNMPEMNGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VR      D+ +  +  E    +++   +AG N++++KPF  + L+
Sbjct: 63  ELVKKVRADSRFIDLPIIMVTTEGGKVEVVTALKAGVNNYIVKPFTPQVLK 113


>gi|94270842|ref|ZP_01291836.1| PAS:Response regulator receiver [delta proteobacterium MLMS-1]
 gi|93450644|gb|EAT01749.1| PAS:Response regulator receiver [delta proteobacterium MLMS-1]
          Length = 650

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 32/107 (29%), Positives = 50/107 (46%), Gaps = 6/107 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+ +     R +   +  + G  V E      A E  +K   P   ++D  M G+  LE
Sbjct: 3   ILIAEDDSTSRNMLAAILREAGHEVTETFDGAGAWEELQKPDAPRLAILDWMMPGMDGLE 62

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFN 106
            +  VR +   TD   Y +++    EK  +IAG  AGAN +L KPF+
Sbjct: 63  VVHRVRGVE--TDQPPYLIMLTAKGEKADIIAGLDAGANDYLAKPFD 107


>gi|291279767|ref|YP_003496602.1| two-component response regulator [Deferribacter desulfuricans SSM1]
 gi|290754469|dbj|BAI80846.1| two-component response regulator [Deferribacter desulfuricans SSM1]
          Length = 212

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 35/126 (27%), Positives = 60/126 (47%), Gaps = 10/126 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M+ +L++D    +    + LF D  F VF  +   +A E  E E  P  L++D  M  + 
Sbjct: 1   MNKILILDDDEQLLGNLKELFEDNDFTVFTCSDPGKALEILEYES-PKILLVDYLMPQID 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEV--DFEKMIAGARAGANSFLLKPFNRETLRFA-MR 115
            + FI  +R+    TD  +  +LM     ++  +   + GAN F+ KPF  E L    M+
Sbjct: 60  GINFIKKIRE----TDKLIRIILMTAFPTYDLAVDAIKNGANDFVSKPFKFEELMVKIMK 115

Query: 116 ELPQMQ 121
            L +++
Sbjct: 116 SLEELK 121


>gi|237653888|ref|YP_002890202.1| response regulator receiver modulated diguanylate cyclase [Thauera
           sp. MZ1T]
 gi|237625135|gb|ACR01825.1| response regulator receiver modulated diguanylate cyclase [Thauera
           sp. MZ1T]
          Length = 642

 Score = 41.2 bits (95), Expect = 0.049,   Method: Composition-based stats.
 Identities = 24/69 (34%), Positives = 36/69 (52%), Gaps = 1/69 (1%)

Query: 47  PNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           P  LV D S EG    +  +R M LG  V+V  +L   D  +++A + AG + FL++P  
Sbjct: 370 PQLLVADWSEEGE-RVVRGLRDMRLGRGVYVICMLGSDDEARLLAASGAGVDDFLVRPLR 428

Query: 107 RETLRFAMR 115
           R  L   +R
Sbjct: 429 RAALTVRLR 437


>gi|254474373|ref|ZP_05087759.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Ruegeria sp. R11]
 gi|214028616|gb|EEB69451.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Ruegeria sp. R11]
          Length = 470

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 59/134 (44%), Gaps = 7/134 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE----LLPNYLVIDESM 56
           M  +L+VD    +R++   +  D G+   +A S  E      +E    L+ +  + D  M
Sbjct: 1   MSDILIVDDERDIRELVSDILEDEGYATRKAGSSEECMAALNEEAPALLILDIWLKDSQM 60

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +G+       R MP   D+ V  +    + E  +A  + GA  F+ KPFN + L   +R 
Sbjct: 61  DGIDILKVVKRDMP---DIPVVIISGHGNIEIAVAAIKQGAYDFIEKPFNIDQLLVVIRR 117

Query: 117 LPQMQKSKDENQFL 130
             +  + + EN  L
Sbjct: 118 AMETSQLRRENSDL 131


>gi|134288509|ref|YP_001110672.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
 gi|134133159|gb|ABO59869.1| response regulator receiver protein [Burkholderia vietnamiensis G4]
          Length = 145

 Score = 41.2 bits (95), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 56/115 (48%), Gaps = 16/115 (13%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFE-------ATSVCEAREFCEKELLPNYLVIDESME 57
           L+VD    +R++ R L  + G+  F+       A ++ + R F       +++V D +M 
Sbjct: 10  LVVDDFPTMRRIVRTLLKEVGYSNFDEAENGVAAMTMLQTRNF-------DFVVTDWNMP 62

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  LE +  +R       + V  +  E   E ++A ARAGA+ +++KPF   TL
Sbjct: 63  RMDGLELLTAIRSSVELRHLPVLMVTAEAKKENILAAARAGASGYIVKPFTAATL 117


>gi|253571356|ref|ZP_04848763.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 1_1_6]
 gi|251839309|gb|EES67393.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 1_1_6]
          Length = 1345

 Score = 41.2 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 57/118 (48%), Gaps = 6/118 (5%)

Query: 3    SLLLVDSS-HIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +LL++D    ++  +G    NDF  +  +     E  E    E+ PN ++ D  M GV  
Sbjct: 1091 TLLVIDDELEMLWFIGEIFSNDFNVVTLQEP---ERVEQVLNEVYPNVIICDIMMPGVGG 1147

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            +E    ++ +   + + +  +    + E+ +A   AGA  ++ KPFN E LR ++ ++
Sbjct: 1148 IELTKRIKSVKETSHIPIIMVSGRHEMEQQMAALSAGAEMYITKPFNAEYLRISVCQM 1205


>gi|288573148|ref|ZP_06391505.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase [Dethiosulfovibrio
           peptidovorans DSM 11002]
 gi|288568889|gb|EFC90446.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase [Dethiosulfovibrio
           peptidovorans DSM 11002]
          Length = 593

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 63/129 (48%), Gaps = 2/129 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M S+++VD +  VR+       DFG +V + +S  +A E  E + +P+ +++D  M G+ 
Sbjct: 1   MASIMVVDDNVSVRESLALCLEDFGHVVVKHSSGEDALEALETD-VPDLMLLDIMMPGIS 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF-NRETLRFAMRELPQ 119
                 R +P   D+ V  +  + D   ++   R G   +L+KP  + E LR A+ +   
Sbjct: 60  GLDVLERVVPRFPDLPVIMVSGDGDVADVVKAIRLGTWDYLMKPVTDVEMLRHAVDQALA 119

Query: 120 MQKSKDENQ 128
               K EN+
Sbjct: 120 KASLKRENR 128


>gi|118480370|ref|YP_897521.1| stage 0 sporulation protein F [Bacillus thuringiensis str. Al
           Hakam]
 gi|118419595|gb|ABK88014.1| stage 0 sporulation protein F [Bacillus thuringiensis str. Al
           Hakam]
          Length = 125

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 61/116 (52%), Gaps = 7/116 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +  +A +  +K+  P+ +V+D  + G+  +
Sbjct: 7   KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKD-NPDLVVLDMKIPGMDGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETLRFAMR 115
           E + HV+++     V +     E+D   MI  A+  GA     KPF+ + +R A+R
Sbjct: 66  EILKHVKEIDESIKVILMTAYGELD---MIQEAKDLGALMHFAKPFDIDEIRQAVR 118


>gi|73539435|ref|YP_299802.1| response regulator receiver [Ralstonia eutropha JMP134]
 gi|72122772|gb|AAZ64958.1| Response regulator receiver [Ralstonia eutropha JMP134]
          Length = 128

 Score = 41.2 bits (95), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 51/109 (46%), Gaps = 2/109 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    +R++ R+L  + GF   E      A     K+    +++ D +M  +  L 
Sbjct: 7   ILVVDDFPTMRRIIRNLLKELGFNNVEEAEDGAAGLEKAKDGSFQFVISDWNMPNMDGLS 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R         V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 67  MLQAIRADAAIGKTPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 115


>gi|221640705|ref|YP_002526967.1| response regulator receiver protein [Rhodobacter sphaeroides KD131]
 gi|221161486|gb|ACM02466.1| Response regulator receiver protein [Rhodobacter sphaeroides KD131]
          Length = 418

 Score = 41.2 bits (95), Expect = 0.050,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 65/136 (47%), Gaps = 11/136 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S   R++       +G+ V EA +  EA   C+   + + ++ D  M G+  LE
Sbjct: 16  VLIVDDSRAQRRLVALSLARWGYRVSEAATASEALALCQGGDV-DIVLSDWMMPGMSGLE 74

Query: 62  FIAHVRQMPLGTDVFVYYLLM--EVDFEKMIAGARAGANSFLLKPFN----RETLRFAMR 115
               +R +P   + + Y++L+       +++ G   GA+ +L+KP      R  LR   R
Sbjct: 75  LCRRIRALP--GEAYCYFILLTSRSGTGEVVDGLDCGADDYLVKPAAPDELRARLRAGER 132

Query: 116 ELPQMQKSKDENQFLD 131
            L    +  D+NQ L+
Sbjct: 133 VLSMQAELVDKNQLLE 148


>gi|29349194|ref|NP_812697.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides thetaiotaomicron VPI-5482]
 gi|29341102|gb|AAO78891.1| two-component system sensor histidine kinase/response regulator,
            hybrid (one-component system) [Bacteroides
            thetaiotaomicron VPI-5482]
          Length = 1345

 Score = 41.2 bits (95), Expect = 0.051,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 57/118 (48%), Gaps = 6/118 (5%)

Query: 3    SLLLVDSS-HIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +LL++D    ++  +G    NDF  +  +     E  E    E+ PN ++ D  M GV  
Sbjct: 1091 TLLVIDDELEMLWFIGEIFSNDFNVVTLQEP---ERVEQVLNEVYPNVIICDIMMPGVGG 1147

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            +E    ++ +   + + +  +    + E+ +A   AGA  ++ KPFN E LR ++ ++
Sbjct: 1148 IELTKRIKSVKETSHIPIIMVSGRHEMEQQMAALSAGAEMYITKPFNAEYLRISVCQM 1205


>gi|313673530|ref|YP_004051641.1| two component transcriptional regulator, winged helix family
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940286|gb|ADR19478.1| two component transcriptional regulator, winged helix family
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 222

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 28/129 (21%), Positives = 66/129 (51%), Gaps = 3/129 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M+ +L+V+    +R++        G+ V E+ +  +A  F E E+ P+ +++D  M G+ 
Sbjct: 1   MNKILIVEDEDALRELIAFNLTKAGYDVIESENANDALIFIE-EITPDLIILDIMMPGLK 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             + +  +++ P  +++ V  +        ++ G   GA+ ++ KPF+ + L   ++ L 
Sbjct: 60  GTQLLQLLKRSPKFSNIPVIIISARSSESDIVEGLELGADDYITKPFSMKVLIAKIKILL 119

Query: 119 QMQKSKDEN 127
           + ++ K EN
Sbjct: 120 RKKQEKTEN 128


>gi|226315075|ref|YP_002774971.1| sporulation initiation phosphotransferase F [Brevibacillus brevis
           NBRC 100599]
 gi|226098025|dbj|BAH46467.1| sporulation initiation phosphotransferase F [Brevibacillus brevis
           NBRC 100599]
          Length = 124

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 29/116 (25%), Positives = 58/116 (50%), Gaps = 5/116 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +    G+  F+A +   A E  EKE  P+ +++D  + G+  +
Sbjct: 8   KVLVVDDQYGIRILLYEVLGKEGYKTFQAANGKMALEIVEKE-SPDLVILDMKIPGMDGI 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           E + H++++     V +     E+D  K     + GA +   KPF+ + LR A+ +
Sbjct: 67  EILKHIKKINQEIKVIMMTAYGELDMIK--EATQLGALTHFTKPFDIDELRMAVHQ 120


>gi|226327767|ref|ZP_03803285.1| hypothetical protein PROPEN_01640 [Proteus penneri ATCC 35198]
 gi|225203471|gb|EEG85825.1| hypothetical protein PROPEN_01640 [Proteus penneri ATCC 35198]
          Length = 129

 Score = 41.2 bits (95), Expect = 0.051,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 12/113 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESMEGV 59
           L+VD    +R++ R+L  + GF     T+V EA +  +     +    ++++ D +M  +
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGF-----TNVEEAEDGADALAKLRNSAVDFVITDWNMPNM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             LE + ++R         V  +  E   E +IA A+AGA+ +++KPF    L
Sbjct: 64  DGLELLKNIRSDAGLAATPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAAIL 116


>gi|203288010|ref|YP_002223025.1| chemotaxis response regulator [Borrelia recurrentis A1]
 gi|201085230|gb|ACH94804.1| chemotaxis response regulator [Borrelia recurrentis A1]
          Length = 124

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 55/112 (49%), Gaps = 5/112 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA----REFCEKELLPNYLVIDESMEGV 59
           +L++D +  +R+   ++    GF V EA    E     +E   +      LVI +     
Sbjct: 5   ILVIDDNRAIRQSVAYILEQNGFAVAEAQDGLEGVSKFKEAVGQSDKDFDLVITDINMPN 64

Query: 60  LEFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L+ I  ++++  LG+ V +  L  E +  K+  G +AGA  +L+KPFN  TL
Sbjct: 65  LDGIGVIKEIRELGSFVPILVLTTESEQSKVDEGRKAGATGWLVKPFNPNTL 116


>gi|114327579|ref|YP_744736.1| phosphate regulon transcriptional regulatory protein phoB
           [Granulibacter bethesdensis CGDNIH1]
 gi|114315753|gb|ABI61813.1| phosphate regulon transcriptional regulatory protein phoB
           [Granulibacter bethesdensis CGDNIH1]
          Length = 249

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 58/117 (49%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+V+    +  + R+     GF V EA+   EA      E+ P+ +++D  + G+  +
Sbjct: 23  TVLIVEDEAALATMLRYNLEKQGFRVEEASDGQEALHRL-SEVQPDLVLLDWMLPGLSGI 81

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E    +R+ P   D+ +  +   V+ +  +     GA+ ++ KPFN + L+  +R L
Sbjct: 82  EVCRQIRRKPGTRDLPIIMVTARVEDQDAVRALNTGADDYITKPFNMQALQARIRAL 138


>gi|71906778|ref|YP_284365.1| response regulator receiver [Dechloromonas aromatica RCB]
 gi|71846399|gb|AAZ45895.1| Response regulator receiver [Dechloromonas aromatica RCB]
          Length = 121

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 53/112 (47%), Gaps = 2/112 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M ++ LVD S  +     ++    G+   +A S  EA    +  +  + L+ D +M G+ 
Sbjct: 1   MKTIFLVDDSATILLSISNILAKAGYATEKAASAEEAIRKLQSGIKIDLLITDLNMPGMN 60

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            ++ I  VR+MP    V + +L  E    + +    AGA+ +++KP   + L
Sbjct: 61  GIDLIKEVRKMPAYKFVPILFLTTESQQSRKMEAKAAGASGWIVKPATADEL 112


>gi|146277826|ref|YP_001167985.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556067|gb|ABP70680.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 122

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L VD S  VR++ R      G+ V EA    +A E    +   + ++ D++M  +  +
Sbjct: 4   TILAVDDSPSVRQMVRLTLIGAGYTVVEAVDGQDALEKAGSQRF-DAILTDQNMPRLDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            FI  +R +P G  V + +L  E           AGA  +++KPF++  L
Sbjct: 63  GFIRKLRTLPEGKGVPIVFLSTESQDTLRAQAKEAGAIGWMIKPFDQAQL 112


>gi|303248204|ref|ZP_07334468.1| multi-sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
 gi|302490468|gb|EFL50377.1| multi-sensor hybrid histidine kinase [Desulfovibrio fructosovorans
           JJ]
          Length = 820

 Score = 41.2 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 36/127 (28%), Positives = 61/127 (48%), Gaps = 7/127 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD    VR+    LF D G++V  A +  EA         P  + +D  M G+ 
Sbjct: 624 MRHILVVDDDTAVRRFLETLFTDAGYIVATAANGAEALSLA-ANWQPECITMDMRMPGMG 682

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E I  +RQ P  + + V  + +    E+    A +GA++ L+KP ++E L   +R L 
Sbjct: 683 GKECIRRLRQNPATSHIPVVVVSVVSSRER----AESGADAALVKPVDQEALLATVRGLL 738

Query: 119 QMQKSKD 125
           + Q  ++
Sbjct: 739 EGQDPEN 745


>gi|266620057|ref|ZP_06112992.1| two-component response regulator [Clostridium hathewayi DSM 13479]
 gi|288868360|gb|EFD00659.1| two-component response regulator [Clostridium hathewayi DSM 13479]
          Length = 505

 Score = 41.2 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 34/130 (26%), Positives = 64/130 (49%), Gaps = 7/130 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLF--NDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           +LL++D   IVR+  + +F   ++GF V       E      + L P+ +++D  +  + 
Sbjct: 2   NLLIIDDEQIVREGLKTIFPWAEYGFTVCGEAKNGEEGVSLIRSLNPDLVLLDIRLPKLD 61

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE +  VR+   G  + +     + D+ K     R G  S+LLKP + E L  A+++  
Sbjct: 62  GLEVLKTVREEGFGGQIIILSGYADFDYAK--TAIRLGVCSYLLKPIDEEELLHAVKQAK 119

Query: 119 Q-MQKSKDEN 127
           + ++K K E+
Sbjct: 120 ETLEKEKRES 129


>gi|217966686|ref|YP_002352192.1| putative PAS/PAC sensor protein [Dictyoglomus turgidum DSM 6724]
 gi|217335785|gb|ACK41578.1| putative PAS/PAC sensor protein [Dictyoglomus turgidum DSM 6724]
          Length = 306

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 50/109 (45%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+V+ S    +  R +  D+ F  F A S  EA E   K   P  ++ D  M G+   E
Sbjct: 9   ILIVEDSPTQAEYLRKILRDYNFSSFVALSGEEAIEIL-KSKTPKLIISDILMPGIDGFE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
               V+      D+ V  L    D + +I      A++F++KPFN++ L
Sbjct: 68  LCKIVKSSEKWKDIIVLLLTTLSDPKDIIKALDVDADAFIIKPFNKKYL 116


>gi|254434207|ref|ZP_05047715.1| response regulator receiver domain protein [Nitrosococcus oceani
            AFC27]
 gi|207090540|gb|EDZ67811.1| response regulator receiver domain protein [Nitrosococcus oceani
            AFC27]
          Length = 1240

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
            +L+VD    +R   R++    G+ + EA +  +A EFC K+ +P+ +++D  M  +  F 
Sbjct: 926  VLIVDDDRTMRMALRNVLEKGGYWIDEAVNGNQALEFC-KQQMPDLVLMDAVMPVLDGFN 984

Query: 63   -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
              A +R +P      V  +    D   + +   AGA  ++ KP +   LR
Sbjct: 985  ACAQIRDLPDSKHTPVLIITALDDDHSIESAFSAGATDYIPKPVHFSVLR 1034


>gi|206581136|ref|YP_002238903.1| response regulator [Klebsiella pneumoniae 342]
 gi|206570194|gb|ACI11970.1| response regulator [Klebsiella pneumoniae 342]
          Length = 404

 Score = 41.2 bits (95), Expect = 0.052,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEGV 59
           +L+V+ S + R++   +   +G++V EA +   A    E +  P  LVI +     M G 
Sbjct: 6   VLIVEDSLVYRRLLSRMLTQWGYIVSEAENGVAALAILENQ--PVSLVISDWEMPEMNG- 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L     VR+   G  V++  L    D   +  G  AGA+ FL KP  +  LR
Sbjct: 63  LTLCREVRRRQFGHYVYLILLTAREDPGDLTQGFAAGADDFLSKPVEQSELR 114


>gi|90422416|ref|YP_530786.1| response regulator receiver domain-containing protein
           [Rhodopseudomonas palustris BisB18]
 gi|90104430|gb|ABD86467.1| response regulator receiver domain protein (CheY-like)
           [Rhodopseudomonas palustris BisB18]
          Length = 131

 Score = 41.2 bits (95), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           ++L+VD  + + ++ R+L    GF   +  S   A     +      ++ D +ME +   
Sbjct: 8   TVLVVDDYNTMIRIIRNLLKQLGFQDIDDASDGSAALAKMRTKKYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR  P L    F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 68  DLLKEVRADPNLAMTPFIM-ITAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|21231353|ref|NP_637270.1| chemotaxis protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66768594|ref|YP_243356.1| chemotaxis protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|188991594|ref|YP_001903604.1| chemotaxis response regulator [Xanthomonas campestris pv.
           campestris str. B100]
 gi|325917850|ref|ZP_08180028.1| response regulator with CheY-like receiver, AAA-type ATPase, and
           DNA-binding domains [Xanthomonas vesicatoria ATCC 35937]
 gi|21113014|gb|AAM41194.1| chemotaxis protein [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573926|gb|AAY49336.1| chemotaxis protein [Xanthomonas campestris pv. campestris str.
           8004]
 gi|167733354|emb|CAP51555.1| chemotaxis response regulator [Xanthomonas campestris pv.
           campestris]
 gi|325535934|gb|EGD07752.1| response regulator with CheY-like receiver, AAA-type ATPase, and
           DNA-binding domains [Xanthomonas vesicatoria ATCC 35937]
          Length = 126

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 57/114 (50%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE----FCEKELLP-NYLVIDESMEG 58
           +L+VD    +R++ ++L  D GF     T+  EA +           P +++V D +M G
Sbjct: 3   ILIVDDFSTMRRIVKNLLADLGF-----TNTAEAEDGNSALAALRAGPFDFVVTDWNMPG 57

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  ++ + ++R       + V  +  E   E++I  A+ G N +++KPF  +TL
Sbjct: 58  MTGIDLLRNIRADAKLKHLPVMMVTAEAKREQIIEAAQCGVNGYIIKPFTAQTL 111


>gi|21242621|ref|NP_642203.1| response regulator [Xanthomonas axonopodis pv. citri str. 306]
 gi|21108085|gb|AAM36739.1| response regulator [Xanthomonas axonopodis pv. citri str. 306]
          Length = 378

 Score = 41.2 bits (95), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|295132377|ref|YP_003583053.1| two-component system response regulator [Zunongwangia profunda
           SM-A87]
 gi|294980392|gb|ADF50857.1| two-component system response regulator [Zunongwangia profunda
           SM-A87]
          Length = 227

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 59/116 (50%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+ D   I+  VG +L  + G+ V  A +  EA +  +K+  P+ +++D  M G+  +E
Sbjct: 9   LLVDDEPDILEIVGYNLSAE-GYQVITADNGAEAVKVAKKKS-PHLIILDVMMPGMDGIE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               +R++P   D  + +L    +    +AG  AGA+ ++ KP   + L   ++ L
Sbjct: 67  ACEQMRKIPELEDTIITFLTARGEDYSQMAGFDAGADDYITKPIKPKVLVSKVKAL 122


>gi|242277862|ref|YP_002989991.1| Fis family transcriptional regulator [Desulfovibrio salexigens DSM
           2638]
 gi|242120756|gb|ACS78452.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Desulfovibrio salexigens DSM 2638]
          Length = 447

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 55/112 (49%), Gaps = 7/112 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK---ELLPNYLVIDESMEGV 59
           ++L+V+   I R    H+  + G MV   +S  EA +   K   EL+   L++   M G+
Sbjct: 6   NILIVEDEAIARDNLTHVMTEAGHMVVAVSSGTEALQKIGKQEFELVLTDLMLP-GMNGI 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            E + H++++   T V V      VD    +   + GA+S++ KP N + LR
Sbjct: 65  -ELLEHIKEIQPSTQVIVITGHASVD--TAVIAMQKGAHSYIAKPLNLDELR 113


>gi|21231302|ref|NP_637219.1| response regulator [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66768646|ref|YP_243408.1| response regulator rpfG [Xanthomonas campestris pv. campestris str.
           8004]
 gi|81305382|sp|Q4UU85|RPFG_XANC8 RecName: Full=Response regulator rpfG
 gi|7688439|emb|CAB89843.1| response regulator [Xanthomonas campestris]
 gi|21112956|gb|AAM41143.1| response regulator [Xanthomonas campestris pv. campestris str. ATCC
           33913]
 gi|66573978|gb|AAY49388.1| response regulator rpfG [Xanthomonas campestris pv. campestris str.
           8004]
          Length = 378

 Score = 41.2 bits (95), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALSWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|322378641|ref|ZP_08053077.1| Chemotaxis protein CheY [Helicobacter suis HS1]
 gi|322379893|ref|ZP_08054179.1| chemotaxis protein CheY [Helicobacter suis HS5]
 gi|321147688|gb|EFX42302.1| chemotaxis protein CheY [Helicobacter suis HS5]
 gi|321148948|gb|EFX43412.1| Chemotaxis protein CheY [Helicobacter suis HS1]
          Length = 145

 Score = 41.2 bits (95), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD S  +R++ R+     G+  + EA    EA    +       L+ D +M  +  
Sbjct: 23  KILIVDDSSTMRRIIRNTLQRLGYEDILEAEHGVEAWGKLDSNDTTGVLITDWNMPEMNG 82

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L+ +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 83  LDLVKKVRSDGRFKDLPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 134


>gi|261821142|ref|YP_003259248.1| response regulator receiver protein [Pectobacterium wasabiae
           WPP163]
 gi|261605155|gb|ACX87641.1| response regulator receiver protein [Pectobacterium wasabiae
           WPP163]
          Length = 129

 Score = 41.2 bits (95), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALNKLRASAF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLQTIRADGALSSLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|255533889|ref|YP_003094261.1| response regulator receiver [Pedobacter heparinus DSM 2366]
 gi|255346873|gb|ACU06199.1| response regulator receiver [Pedobacter heparinus DSM 2366]
          Length = 1374

 Score = 41.2 bits (95), Expect = 0.055,   Method: Composition-based stats.
 Identities = 40/140 (28%), Positives = 66/140 (47%), Gaps = 12/140 (8%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            S+LLV+    +R + R++  +  ++V+EA +  EA  F  K L P+ ++ D  M  +  L
Sbjct: 1118 SILLVEDEPELRYLIRNVLKE-QYVVYEAGTGVEALAFLYKTL-PDLIISDVMMPDMNGL 1175

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            E    V+Q P    +    L      +    G   GA++++ KPF    L   +R+L   
Sbjct: 1176 ELCRTVKQTPAMAQIPFVILSARGSEDNKAEGYELGADAYIPKPFQINYLLVRIRKLLDD 1235

Query: 121  QKS-----KDE---NQFLDA 132
            Q       KD+   NQF+DA
Sbjct: 1236 QARMESLIKDQHITNQFMDA 1255


>gi|77164777|ref|YP_343302.1| hybrid signal transduction histidine kinase and diguanylate
            cyclase/phosphodiesterase [Nitrosococcus oceani ATCC
            19707]
 gi|76883091|gb|ABA57772.1| response regulator receiver modulated diguanylate
            cyclase/phosphodiesterase [Nitrosococcus oceani ATCC
            19707]
          Length = 1499

 Score = 41.2 bits (95), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
            +L+VD    +R   R++    G+ + EA +  +A EFC K+ +P+ +++D  M  +  F 
Sbjct: 926  VLIVDDDRTMRMALRNVLEKGGYWIDEAVNGNQALEFC-KQQMPDLVLMDAVMPVLDGFN 984

Query: 63   -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
              A +R +P      V  +    D   + +   AGA  ++ KP +   LR
Sbjct: 985  ACAQIRDLPDSKHTPVLIITALDDDHSIESAFSAGATDYIPKPVHFSVLR 1034


>gi|288935841|ref|YP_003439900.1| response regulator receiver modulated serine phosphatase
           [Klebsiella variicola At-22]
 gi|290509868|ref|ZP_06549239.1| response regulator [Klebsiella sp. 1_1_55]
 gi|288890550|gb|ADC58868.1| response regulator receiver modulated serine phosphatase
           [Klebsiella variicola At-22]
 gi|289779262|gb|EFD87259.1| response regulator [Klebsiella sp. 1_1_55]
          Length = 404

 Score = 40.8 bits (94), Expect = 0.055,   Method: Composition-based stats.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 7/112 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEGV 59
           +L+V+ S + R++   +   +G++V EA +   A    E +  P  LVI +     M G 
Sbjct: 6   VLIVEDSLVYRRLLSRMLTQWGYIVSEAENGVAALAILENQ--PVSLVISDWEMPEMNG- 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L     VR+   G  V++  L    D   +  G  AGA+ FL KP  +  LR
Sbjct: 63  LTLCREVRRRQFGHYVYLILLTAREDPGDLTQGFAAGADDFLSKPVEQSELR 114


>gi|261404172|ref|YP_003240413.1| signal transduction histidine kinase, LytS [Paenibacillus sp.
           Y412MC10]
 gi|261280635|gb|ACX62606.1| signal transduction histidine kinase, LytS [Paenibacillus sp.
           Y412MC10]
          Length = 979

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 65/128 (50%), Gaps = 8/128 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           + +LL+VD   +  +V R +  D  + V  A S  EA ++         +++D+ + G +
Sbjct: 645 LGTLLIVDDDVMHAEVMRDMLGD-AYKVRIAYSAQEALDYYRNHPEIAMMIMDDIIPGDM 703

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFE-----KMIAGARAGANSFLLKPFNRETLRFAMR 115
           + +  +RQ+ +   +    +LM +  E     +MI  A  GAN +LLKPF++ETL   + 
Sbjct: 704 DSLELLRQIRIQASLMDLPILMMISSEYPRHVEMIFAA--GANDYLLKPFSKETLMARLN 761

Query: 116 ELPQMQKS 123
              Q ++S
Sbjct: 762 AAEQTKQS 769


>gi|34557035|ref|NP_906850.1| response regulator [Wolinella succinogenes DSM 1740]
 gi|34482750|emb|CAE09750.1| RESPONSE REGULATOR [Wolinella succinogenes]
          Length = 125

 Score = 40.8 bits (94), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++  +  G+  V E  +  E  +  +       L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLSRLGYNDVLEGENGVEGWDQMDANADIKVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LELVKKVRADKRFVDIPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|269961638|ref|ZP_06176000.1| chemotaxis protein CheY [Vibrio harveyi 1DA3]
 gi|269965685|ref|ZP_06179798.1| chemotaxis protein CheY [Vibrio alginolyticus 40B]
 gi|269829753|gb|EEZ83989.1| chemotaxis protein CheY [Vibrio alginolyticus 40B]
 gi|269833679|gb|EEZ87776.1| chemotaxis protein CheY [Vibrio harveyi 1DA3]
          Length = 111

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 28/102 (27%), Positives = 52/102 (50%), Gaps = 4/102 (3%)

Query: 13  VRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQM 69
           +R++ ++L  D GF    EA     A    +K    +++V D +M G+  ++ + H+R  
Sbjct: 1   MRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGDF-DFVVTDWNMPGMQGIDLLKHIRAD 59

Query: 70  PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
                + V  +  E   E++I  A+AG N +++KPF   TL+
Sbjct: 60  AELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAATLK 101


>gi|222081273|ref|YP_002540636.1| two-component response regulator protein [Agrobacterium radiobacter
           K84]
 gi|221725952|gb|ACM29041.1| two-component response regulator protein [Agrobacterium radiobacter
           K84]
          Length = 241

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 5/128 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    +R++    F D G+ V  A++  E R   ++E   + +++D  + G  + +
Sbjct: 11  VLVVDDDPRIRQMLTRYFEDEGYAVSTASNGLEMRACLQQENF-DAILLDWVLPGGKDGL 69

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RET---LRFAMRELPQ 119
              R++   +DV +  L    D    I G   GA+ ++ KPF+ RE    L+  +R    
Sbjct: 70  DLAREIRAQSDVPIIMLTGRDDVVDRIVGIEVGADDYIAKPFHLREVHARLKSILRRRQP 129

Query: 120 MQKSKDEN 127
             +S D+N
Sbjct: 130 AIRSPDKN 137


>gi|160888170|ref|ZP_02069173.1| hypothetical protein BACUNI_00578 [Bacteroides uniformis ATCC 8492]
 gi|270297069|ref|ZP_06203268.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|317478932|ref|ZP_07938079.1| response regulator receiver domain-containing protein [Bacteroides
           sp. 4_1_36]
 gi|156862305|gb|EDO55736.1| hypothetical protein BACUNI_00578 [Bacteroides uniformis ATCC 8492]
 gi|270273056|gb|EFA18919.1| conserved hypothetical protein [Bacteroides sp. D20]
 gi|316904909|gb|EFV26716.1| response regulator receiver domain-containing protein [Bacteroides
           sp. 4_1_36]
          Length = 375

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 47/93 (50%), Gaps = 3/93 (3%)

Query: 20  LFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV 77
           L  +  F +  A++  +A E  EKE  P+ +++D  M  +   E   H++  P   D+ +
Sbjct: 28  LLTNEKFAIATASNGRQALEQVEKEN-PDLVLLDVMMPDMSGFEVAQHLKSNPNTADIPI 86

Query: 78  YYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +L        ++ G + GAN F+ KPFN+E L
Sbjct: 87  IFLTALNSTADIVKGFQVGANDFISKPFNKEEL 119


>gi|152977522|ref|YP_001377039.1| response regulator receiver protein [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152026274|gb|ABS24044.1| response regulator receiver protein [Bacillus cytotoxicus NVH
           391-98]
          Length = 122

 Score = 40.8 bits (94), Expect = 0.056,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 61/116 (52%), Gaps = 7/116 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +  +A +  +K+  P+ +++D  + G+  +
Sbjct: 4   KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKD-NPDLVILDMKIPGMDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETLRFAMR 115
           E + HV+++     V +     E+D   MI  A+  GA     KPF+ + +R A+R
Sbjct: 63  EILKHVKEINADIKVILMTAYGELD---MIQEAKDLGALMHFAKPFDIDEIRQAVR 115


>gi|119953355|ref|YP_945564.1| chemotaxis protein CheY [Borrelia turicatae 91E135]
 gi|119862126|gb|AAX17894.1| chemotaxis protein CheY [Borrelia turicatae 91E135]
          Length = 124

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 64/125 (51%), Gaps = 14/125 (11%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEA-------TSVCEAREFCEKELLPNYLVIDESM 56
           +L++D +  +R+   ++    GF V EA       +   EA    +K+   + ++ D +M
Sbjct: 5   ILVIDDNRAIRQSVAYILEQNGFGVSEAQDGLEGVSKFKEAVGQSDKDF--DLIITDINM 62

Query: 57  EGVLEFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
              L+ I  ++Q+   G+ V +  L  E +  K+  G +AGA  +L+KPFN +TL   MR
Sbjct: 63  PN-LDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAGATGWLVKPFNPDTL---MR 118

Query: 116 ELPQM 120
            + ++
Sbjct: 119 TISKI 123


>gi|325925184|ref|ZP_08186597.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Xanthomonas perforans 91-118]
 gi|325544438|gb|EGD15808.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Xanthomonas perforans 91-118]
          Length = 351

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 2   NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 60

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 61  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 120

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 121 QLRQQSE 127


>gi|293604991|ref|ZP_06687387.1| chemotaxis response regulator CheY [Achromobacter piechaudii ATCC
           43553]
 gi|292816596|gb|EFF75681.1| chemotaxis response regulator CheY [Achromobacter piechaudii ATCC
           43553]
          Length = 129

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPN----YLVIDESMEG 58
           +L+VD    +R++ R+L  + GF      +V EA +     E L N    ++V D +M  
Sbjct: 8   ILVVDDFPTMRRIIRNLLKELGF-----ENVDEAEDGAIGLEKLRNGGFQFVVSDWNMPN 62

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  LE +  +R       + V  +  E   E ++A A+AGAN +++KPF   TL
Sbjct: 63  LDGLEMLKQIRADASLASLPVLMVTAEAKKENIVAAAQAGANGYVVKPFTAATL 116


>gi|283956516|ref|ZP_06373996.1| chemotaxis regulatory protein [Campylobacter jejuni subsp. jejuni
           1336]
 gi|283792236|gb|EFC31025.1| chemotaxis regulatory protein [Campylobacter jejuni subsp. jejuni
           1336]
          Length = 128

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD S  +R++ ++     G   V EA    EA +   K      L+ D +M  +  L
Sbjct: 1   MLVVDDSSTMRRIIKNTLTRLGHDDVLEAEHGVEAWDLLTKNEDVKVLITDWNMPEMNGL 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+  + ++
Sbjct: 61  ELVKKVRAEKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEDV 117


>gi|212709477|ref|ZP_03317605.1| hypothetical protein PROVALCAL_00519 [Providencia alcalifaciens DSM
           30120]
 gi|212687815|gb|EEB47343.1| hypothetical protein PROVALCAL_00519 [Providencia alcalifaciens DSM
           30120]
          Length = 144

 Score = 40.8 bits (94), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 56/111 (50%), Gaps = 4/111 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           S L+VD    +R++ R+L  + GF  + EA    +A E      + +++V D +M  +  
Sbjct: 21  SFLVVDDFSTMRRIVRNLLKELGFNKIEEAEDGVDALEKIRAGSI-DFVVADWNMPNMDG 79

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           LE +  +R       + V  +  E   E +IA A+AGA+ +++KPF    L
Sbjct: 80  LELLKTIRGDDALKHIPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAAIL 130


>gi|308397855|ref|ZP_07492623.2| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu012]
 gi|308366785|gb|EFP55636.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu012]
          Length = 228

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 57/124 (45%), Gaps = 5/124 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA +    +  P+ LV+D  M  +  LE
Sbjct: 3   ILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDR-PDALVLDVMMPRLDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 62  VCRQLRGT--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 119

Query: 122 KSKD 125
           K +D
Sbjct: 120 KPED 123


>gi|299136567|ref|ZP_07029750.1| response regulator receiver modulated diguanylate cyclase
           [Acidobacterium sp. MP5ACTX8]
 gi|298601082|gb|EFI57237.1| response regulator receiver modulated diguanylate cyclase
           [Acidobacterium sp. MP5ACTX8]
          Length = 313

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+ D   + R++ + +    G+ ++  A  +  + E C  +  P   VID  M  +   
Sbjct: 3   ILVADDDPVSRRLMQSMLERGGYEVIVAADGLAASLELCRPDG-PRLAVIDWMMPELDGP 61

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E    VR       VF+  L  +   E  +AG  AGA+ +L KP N E LR
Sbjct: 62  EVCRRVRSRQDAPYVFILLLTSKQSNEDTVAGLEAGADDYLTKPCNAEELR 112


>gi|289668828|ref|ZP_06489903.1| two-component system response regulator RpfG [Xanthomonas
           campestris pv. musacearum NCPPB4381]
          Length = 380

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|325916713|ref|ZP_08178970.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Xanthomonas vesicatoria ATCC 35937]
 gi|325537062|gb|EGD08801.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Xanthomonas vesicatoria ATCC 35937]
          Length = 378

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|182414649|ref|YP_001819715.1| response regulator receiver protein [Opitutus terrae PB90-1]
 gi|177841863|gb|ACB76115.1| response regulator receiver protein [Opitutus terrae PB90-1]
          Length = 260

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 45/92 (48%), Gaps = 2/92 (2%)

Query: 26  FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLME 83
           + V EA    +A E   K   P+   ID  M G+  LE I  +RQ P    + +  +   
Sbjct: 166 WSVIEAEDGLKALELLRKNPAPDICFIDLQMPGMDGLELIRQIRQDPQLHALRIAVVSGL 225

Query: 84  VDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            D +K++A +    +S+LLKP +   +R A+R
Sbjct: 226 RDRDKIVALSHLHIDSYLLKPLDSGKVRTALR 257



 Score = 35.0 bits (79), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 3/127 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFN-DFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           +L+V+   I R   R +   +  + + EA    +A +   +   P   ++D  M   G +
Sbjct: 5   ILIVEDEAIERTALREILGAESSWKIHEAIDGQKALDLLRRGFRPQLCIVDLQMPKIGGV 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           EF+  +R  P    + V       D   ++A A+   + +LLKPF  E +   +R +   
Sbjct: 65  EFLRRIRDDPDLRGLRVVIASGNRDRATILALAKLAIDGYLLKPFETERILSVLRPILAT 124

Query: 121 QKSKDEN 127
               DE+
Sbjct: 125 IPDPDED 131


>gi|150395461|ref|YP_001325928.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
 gi|150026976|gb|ABR59093.1| response regulator receiver protein [Sinorhizobium medicae WSM419]
          Length = 121

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R +     N+ GF   +A    E  E  +    P+ +V D +M  +    
Sbjct: 5   VLTVDDSRTIRNMLLATLNNAGFETIQAEDGVEGLEKLDTAN-PDVIVTDINMPRLDGFG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           FI  VR+      V +  L  E D EK     +AGA  +++KPF+
Sbjct: 64  FIEGVRKNDRYRAVPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|78358756|ref|YP_390205.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
 gi|78221161|gb|ABB40510.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfovibrio desulfuricans subsp. desulfuricans
           str. G20]
          Length = 401

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 48/113 (42%), Gaps = 2/113 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S++LVD    +      L  D G+ V  A S   A +       P+ L+ D  M  V++ 
Sbjct: 14  SVMLVDDEPGILATMGPLVADMGYQVVTAQSGEAALQLAHDSRPPHVLLTDVRMP-VMDG 72

Query: 63  IAHVRQMPLG-TDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
           +A +R       D  V  L    D +  +   R GA  FL KP N + L FA+
Sbjct: 73  MALLRAFKTAWPDTEVLMLTGHGDMQLAVESLRQGAGDFLTKPVNADVLEFAL 125


>gi|86151116|ref|ZP_01069332.1| chemotaxis protein CheY [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315124595|ref|YP_004066599.1| chemotaxis regulatory protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|85842286|gb|EAQ59532.1| chemotaxis protein CheY [Campylobacter jejuni subsp. jejuni 260.94]
 gi|315018317|gb|ADT66410.1| chemotaxis regulatory protein [Campylobacter jejuni subsp. jejuni
           ICDCCJ07001]
 gi|315058559|gb|ADT72888.1| Chemotaxis regulator CheY [Campylobacter jejuni subsp. jejuni S3]
          Length = 128

 Score = 40.8 bits (94), Expect = 0.058,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 56/117 (47%), Gaps = 3/117 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD S  +R++ ++     G   V EA    EA +   K      L+ D +M  +  L
Sbjct: 1   MLVVDDSSTMRRIIKNTLTRLGHDDVLEAEHGVEAWDLLTKNEDVKVLITDWNMPEMNGL 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+  + ++
Sbjct: 61  ELVKKVRAEKKYEDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEDV 117


>gi|126463630|ref|YP_001044744.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|126105294|gb|ABN77972.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
          Length = 418

 Score = 40.8 bits (94), Expect = 0.058,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 65/136 (47%), Gaps = 11/136 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S   R++       +G+ V EA +  EA   C+   + + ++ D  M G+  LE
Sbjct: 16  VLIVDDSRAQRRLVALSLARWGYRVSEAATASEALALCKGGDV-DIVLSDWMMPGMSGLE 74

Query: 62  FIAHVRQMPLGTDVFVYYLLM--EVDFEKMIAGARAGANSFLLKPFN----RETLRFAMR 115
               +R +P   + + Y++L+       +++ G   GA+ +L+KP      R  LR   R
Sbjct: 75  LCRRIRALP--GEAYCYFILLTSRSGTGEVVDGLDCGADDYLVKPAAPDELRARLRAGER 132

Query: 116 ELPQMQKSKDENQFLD 131
            L    +  D+NQ L+
Sbjct: 133 VLSMQAELVDKNQLLE 148


>gi|304383610|ref|ZP_07366069.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           marshii DSM 16973]
 gi|304335134|gb|EFM01405.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           marshii DSM 16973]
          Length = 901

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 24/82 (29%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 43  KELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF 100
           KEL+P+ ++ D  M     LE    VR   +   V +  +  ++     +AG +AGA+++
Sbjct: 685 KELVPDLIITDLMMPHTDGLEVCRQVRDDEIINHVPIIVVTAKITEADRVAGLQAGADAY 744

Query: 101 LLKPFNRETLRFAMRELPQMQK 122
           L KPFN + LR  + +L + ++
Sbjct: 745 LAKPFNSDELRTRVEKLLEQRR 766


>gi|163856418|ref|YP_001630716.1| chemotaxis protein CheY [Bordetella petrii DSM 12804]
 gi|163260146|emb|CAP42447.1| chemotaxis protein CheY [Bordetella petrii]
          Length = 129

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPN----YLVIDESME 57
            +L+VD    +R++ R+L  + GF      +V EA +     E L N    ++V D +M 
Sbjct: 7   KILVVDDFPTMRRIIRNLLKELGF-----ENVDEAEDGAIGLEKLRNGSFQFVVSDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  LE +  +R       + V  +  E   E ++A A+AGAN +++KPF   TL
Sbjct: 62  NLDGLEMLKQIRADGALKSLPVLMVTAEAKKENIVAAAQAGANGYVVKPFTAATL 116


>gi|85717165|ref|ZP_01048123.1| response regulator receiver [Nitrobacter sp. Nb-311A]
 gi|85695998|gb|EAQ33898.1| response regulator receiver [Nitrobacter sp. Nb-311A]
          Length = 131

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           S+L+VD  + + ++ R+L    GF   +  S   A     +      ++ D +ME +   
Sbjct: 8   SVLVVDDYNTMIRIIRNLLKQLGFENIDDASDGSAALNKMRTKKYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR  P L    F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 68  DLLKEVRADPNLAMTPFIM-VTAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|289663372|ref|ZP_06484953.1| two-component system response regulator RpfG [Xanthomonas
           campestris pv. vasculorum NCPPB702]
          Length = 380

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|188575995|ref|YP_001912924.1| Two-component system response regulator RpfG [Xanthomonas oryzae
           pv. oryzae PXO99A]
 gi|188520447|gb|ACD58392.1| Two-component system response regulator RpfG [Xanthomonas oryzae
           pv. oryzae PXO99A]
          Length = 353

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 4   NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 62

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 63  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 122

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 123 QLRQQSE 129


>gi|116249451|ref|YP_765292.1| putative NodW-like nodulation transcriptional regulatory protein
           [Rhizobium leguminosarum bv. viciae 3841]
 gi|115254101|emb|CAK12498.1| putative NodW-like nodulation transcriptional regulatory protein
           [Rhizobium leguminosarum bv. viciae 3841]
          Length = 230

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 9/111 (8%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELL--PNYLVIDESMEGV-- 59
           +++VD    VR+    L    GF   ++TS    RE  + ++L  P  L++D  M G   
Sbjct: 27  VIIVDDDASVREALSELIQSAGF---QSTSFASTRELLDADILDSPGCLILDVRMPGASG 83

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L   +H+ +   G    + +L    D    +   +AGA  FL KP   +TL
Sbjct: 84  LHLQSHLAEN--GISKPIIFLTGHGDIPMTVQAMKAGAVDFLTKPVRDQTL 132


>gi|108763354|ref|YP_634168.1| putative chemotaxis protein CheY [Myxococcus xanthus DK 1622]
 gi|108467234|gb|ABF92419.1| putative chemotaxis protein CheY [Myxococcus xanthus DK 1622]
          Length = 128

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 54/119 (45%), Gaps = 7/119 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-DESMEGV-- 59
           ++LLVD S  VR + +    +      EA       +     L+P  LVI D +M G+  
Sbjct: 7   NVLLVDDSPTVRNIVKIYLMNLKVSTVEADDATRGLQILR--LVPVSLVIADINMPGMDG 64

Query: 60  LEFIAHVRQ--MPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           + F+  VR   MP    V +  L  E + +    G  AGAN+F+ KP +   L   +R+
Sbjct: 65  ITFVKEVRASAMPQVRSVPILLLTAEKNVDLRQRGTEAGANAFIQKPVSHHELTETVRQ 123


>gi|83815858|ref|YP_444228.1| sensor histidine kinase [Salinibacter ruber DSM 13855]
 gi|83757252|gb|ABC45365.1| sensor histidine kinase with multiple PAS and a response regulator
           receiver domain [Salinibacter ruber DSM 13855]
          Length = 802

 Score = 40.8 bits (94), Expect = 0.059,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 63/133 (47%), Gaps = 7/133 (5%)

Query: 3   SLLLVDSSHIVRKVGR-HLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           ++L++D + +V  + R HL  ++   V EA    E      + LLP+ ++ D  M  V  
Sbjct: 534 TVLVIDDNSVVCTLVRTHLEPEY--RVEEAHDGAEGYTLA-RTLLPDLVISDVMMPEVDG 590

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    ++Q P    V V +L    D E  + G   GA+++L KPF  E L   +  L  
Sbjct: 591 FELCRKIKQDPDIDHVPVVFLTARADLEDKVEGLDVGADAYLTKPFEPEALIARIENLIA 650

Query: 120 MQKSKDENQFLDA 132
            +++  E+ F DA
Sbjct: 651 TRRTLRES-FQDA 662


>gi|119776626|ref|YP_929366.1| response regulator receiver protein [Shewanella amazonensis SB2B]
 gi|119769126|gb|ABM01697.1| response regulator receiver protein [Shewanella amazonensis SB2B]
          Length = 120

 Score = 40.8 bits (94), Expect = 0.059,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 55/122 (45%), Gaps = 9/122 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY-LVIDES---- 55
           M  +L VD S  +R++        GF V EA   C   E  +      Y LVI +     
Sbjct: 1   MKKILAVDDSASMRQMVGFTLKTAGFDVTEA---CNGDEALKAAQAGQYDLVISDVNMPV 57

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G+   I ++R +P      +  L  E   +K   G  AGA  +++KPFN E L   +R
Sbjct: 58  MDGI-TLIRNLRTLPAYKFTPLLMLTTESGGDKKQEGRAAGATGWIVKPFNPEQLLATVR 116

Query: 116 EL 117
           ++
Sbjct: 117 KV 118


>gi|294666713|ref|ZP_06731949.1| two-component system response regulator RpfG [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
 gi|292603538|gb|EFF46953.1| two-component system response regulator RpfG [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 10535]
          Length = 378

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|161525334|ref|YP_001580346.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Burkholderia multivorans ATCC 17616]
 gi|189349929|ref|YP_001945557.1| sigma-54-dependent DNA-binding transcriptional regulator
           [Burkholderia multivorans ATCC 17616]
 gi|221201357|ref|ZP_03574396.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia multivorans CGD2M]
 gi|221208837|ref|ZP_03581835.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia multivorans CGD2]
 gi|221214081|ref|ZP_03587054.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia multivorans CGD1]
 gi|160342763|gb|ABX15849.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia multivorans ATCC 17616]
 gi|189333951|dbj|BAG43021.1| sigma54-dependent DNA-binding transcriptional regulator
           [Burkholderia multivorans ATCC 17616]
 gi|221166258|gb|EED98731.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia multivorans CGD1]
 gi|221171293|gb|EEE03742.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia multivorans CGD2]
 gi|221178625|gb|EEE11033.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia multivorans CGD2M]
          Length = 461

 Score = 40.8 bits (94), Expect = 0.060,   Method: Composition-based stats.
 Identities = 32/108 (29%), Positives = 50/108 (46%), Gaps = 3/108 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL 130
               E  I G R G   +LLKP N   LR  +  +P+  +  DE Q L
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVQSL 131


>gi|92118626|ref|YP_578355.1| response regulator receiver domain-containing protein [Nitrobacter
           hamburgensis X14]
 gi|91801520|gb|ABE63895.1| response regulator receiver domain protein (CheY-like) [Nitrobacter
           hamburgensis X14]
          Length = 131

 Score = 40.8 bits (94), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           S+L+VD  + + ++ R+L    GF   +  S   A     +      ++ D +ME +   
Sbjct: 8   SVLVVDDYNTMIRIIRNLLKQLGFENIDDASDGSAALNKMRTKKYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR  P L    F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 68  DLLKEVRADPNLAMTRFIM-ITAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|322382234|ref|ZP_08056147.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
 gi|321153815|gb|EFX46183.1| two-component response regulator-like protein [Paenibacillus larvae
           subsp. larvae B-3650]
          Length = 133

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 34/133 (25%), Positives = 64/133 (48%), Gaps = 9/133 (6%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           + +L+VD  + +R +   +FN+ G+  F+A +   A E   KE  P+ +++D  + G+  
Sbjct: 8   NKVLIVDDQNGIRVLLMEVFNNEGYETFQAPNGKTALEIVRKE-APDLVLLDMKIPGMDG 66

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+ + H++ +     V +     E+D  K       GA     KPF+ + +R A+    Q
Sbjct: 67  LDILKHIKNIDSSIKVIMMTAYGELDMIK--EATELGAIMHFTKPFDIDEMRQAV----Q 120

Query: 120 MQKSKDENQFLDA 132
            Q S+   Q L +
Sbjct: 121 QQLSESTGQSLGS 133


>gi|291279589|ref|YP_003496424.1| two-component system, chemotaxis family, response regulator CheY
           [Deferribacter desulfuricans SSM1]
 gi|290754291|dbj|BAI80668.1| two-component system, chemotaxis family, response regulator CheY
           [Deferribacter desulfuricans SSM1]
          Length = 122

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 60/118 (50%), Gaps = 5/118 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGV 59
            +L++D +  +R++        GF V +A++  EA    EK+   N ++ D +M   +G+
Sbjct: 4   KILVIDDAVTMRQLVSATLKSAGFDVVDASNGKEALMKLEKDRF-NLIITDLNMPIMDGI 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             FI  V++ P    + +  L  E   +K   G +AGA ++++KPF    L   ++++
Sbjct: 63  -TFIKEVKKNPKYRLIPIIMLTTESGADKKEEGRKAGAKAWIVKPFKPNDLLTVVKKI 119


>gi|84624382|ref|YP_451754.1| response regulator [Xanthomonas oryzae pv. oryzae MAFF 311018]
 gi|84368322|dbj|BAE69480.1| response regulator [Xanthomonas oryzae pv. oryzae MAFF 311018]
          Length = 378

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|255320447|ref|ZP_05361628.1| nitrogen regulation protein NR [Acinetobacter radioresistens SK82]
 gi|262378343|ref|ZP_06071500.1| nitrogen regulation protein NR(I) [Acinetobacter radioresistens
           SH164]
 gi|255302419|gb|EET81655.1| nitrogen regulation protein NR [Acinetobacter radioresistens SK82]
 gi|262299628|gb|EEY87540.1| nitrogen regulation protein NR(I) [Acinetobacter radioresistens
           SH164]
          Length = 491

 Score = 40.8 bits (94), Expect = 0.061,   Method: Composition-based stats.
 Identities = 35/136 (25%), Positives = 64/136 (47%), Gaps = 10/136 (7%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELL--PNYLVIDESMEGV 59
           + + ++D    +R V    F + GF   E TS  EA+   ++ +L  P+ ++ D  M G+
Sbjct: 4   NKIWVIDDDRTMRWVLEKTFKEEGF---EVTSFEEAQSALDQLMLAPPDVILTDIRMPGI 60

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RETLRFAMRE 116
             L F++ V+Q     D+ V  +    D E  ++  + GA  +L KPF+  E L    R 
Sbjct: 61  DGLTFLSKVKQS--NPDLPVIIMTAHSDLESAVSSYQTGAFEYLPKPFDIDEALALVQRA 118

Query: 117 LPQMQKSKDENQFLDA 132
           +  + K + +   + A
Sbjct: 119 ILHISKLQQQESRVTA 134


>gi|146329398|ref|YP_001209977.1| chemotaxis protein ChpA [Dichelobacter nodosus VCS1703A]
 gi|146232868|gb|ABQ13846.1| chemotaxis protein ChpA [Dichelobacter nodosus VCS1703A]
          Length = 2554

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 51/110 (46%), Gaps = 5/110 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
            +L+VD S  +RKV   L     ++V  A    +A E    E +P+ +++D     M+G  
Sbjct: 2433 VLVVDDSVTMRKVSTRLLERNDYVVQTAKDGLDAIEVL-NEFMPDVILLDIEMPRMDG-F 2490

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            EF AHVRQ  +  DV +  +      +      + G   +L KP+  + L
Sbjct: 2491 EFAAHVRQNAMYNDVPIIMVTSRTGDKHRERADKIGVQGYLGKPYREDVL 2540


>gi|86605678|ref|YP_474441.1| response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86554220|gb|ABC99178.1| response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 374

 Score = 40.8 bits (94), Expect = 0.061,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 50/117 (42%), Gaps = 3/117 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M ++L+VD    +R V +      G+ V  A+   E  E     L P  ++ D  M  + 
Sbjct: 1   MTAILIVDDDPTIRLVLKRSLERQGYTVEMASGGLEGLEKAHL-LTPGLIICDWMMPDMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            LE    ++  P  +  F   L    + E  I G  AGA+ FL KP +   LR  +R
Sbjct: 60  GLEVCRRIKADPKFSTTFFILLTARTEVEDRIQGLDAGADEFLSKPIDPNELRARVR 116


>gi|332885685|gb|EGK05931.1| hypothetical protein HMPREF9456_02195 [Dysgonomonas mossii DSM
           22836]
          Length = 120

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 62/120 (51%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFN-DFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M  +L++D    + KV  + F  D+  + FE  +  +A ++ E+  +P+ +++D  M  +
Sbjct: 1   MQRILIIDDKEAIAKVIANYFREDYECIYFE--NPLKAIQWLEQNSMPDLIILDLRMPFM 58

Query: 60  L--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              EF+A++++  L   + V  L  E +    I     GA  F+LKPFN   L+  ++++
Sbjct: 59  TGEEFLAYIKKNELFKSIPVVILSSEDNSINRIRLLENGAEDFILKPFNPMELKVRLKKI 118


>gi|330505442|ref|YP_004382311.1| two-component system sensor histidine kinase/response regulator
           [Pseudomonas mendocina NK-01]
 gi|328919728|gb|AEB60559.1| two-component system sensor histidine kinase/response regulator,
           putative [Pseudomonas mendocina NK-01]
          Length = 122

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 59/120 (49%), Gaps = 9/120 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPNYLVIDE----SME 57
           ++L+VD S  +R+V        G+ V E    C+ ++   K +    +L+I +    +M+
Sbjct: 4   TVLIVDDSASIRQVVSITLKGAGYDVIEG---CDGKDALTKLDGRKVHLIISDVNMPNMD 60

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+  F+ +V+Q+P      V  L  E    K   G  AGA ++++KPF    +  A+ +L
Sbjct: 61  GI-TFLKNVKQLPAYKFTPVIMLTTEAGEAKKDEGRAAGAKAWVVKPFQPAQMLNAVSKL 119


>gi|226951682|ref|ZP_03822146.1| type IV pili response regulator PilH [Acinetobacter sp. ATCC 27244]
 gi|294651363|ref|ZP_06728682.1| twitching motility regulator PilH [Acinetobacter haemolyticus ATCC
           19194]
 gi|226837598|gb|EEH69981.1| type IV pili response regulator PilH [Acinetobacter sp. ATCC 27244]
 gi|292822765|gb|EFF81649.1| twitching motility regulator PilH [Acinetobacter haemolyticus ATCC
           19194]
          Length = 120

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 56/120 (46%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD S       R +    G+ V EAT+  +     + EL P+ +++D  M G+ 
Sbjct: 1   MARILIVDDSPTETFRFREILTKHGYEVLEATNGADGVTMAQAEL-PDLVLMDVVMPGMN 59

Query: 61  EFIAHVRQMPLGTD---VFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            F A  RQ+    D   + V  +  +      + G R GA+ +L KP + + L   +++L
Sbjct: 60  GFQA-TRQISKAKDTQHIPVVIVSTKDQATDRVWGKRQGASDYLTKPVDEQQLIDVIKQL 118


>gi|166712011|ref|ZP_02243218.1| chemotaxis protein [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 130

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 57/115 (49%), Gaps = 14/115 (12%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP------NYLVIDESME 57
           +L+VD    +R++ ++L  D GF     T+  EA E     L        +++V D +M 
Sbjct: 7   ILIVDDFSTMRRIVKNLLGDLGF-----TNTAEA-EDGNSALAALRAGQFDFVVTDWNMP 60

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           G+  ++ + ++R       + V  +  E   E++I  A+ G N +++KPF  +TL
Sbjct: 61  GMTGIDLLRNIRADAKLKHLPVMMVTAEAKREQIIEAAQCGVNGYIIKPFTAQTL 115


>gi|58582494|ref|YP_201510.1| response regulator [Xanthomonas oryzae pv. oryzae KACC10331]
 gi|58427088|gb|AAW76125.1| response regulator [Xanthomonas oryzae pv. oryzae KACC10331]
          Length = 419

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 70  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 128

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 129 GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 188

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 189 QLRQQSE 195


>gi|34497033|ref|NP_901248.1| sensory box/GGDEF family protein [Chromobacterium violaceum ATCC
           12472]
 gi|34102890|gb|AAQ59254.1| probable sensory box/GGDEF family protein [Chromobacterium
           violaceum ATCC 12472]
          Length = 712

 Score = 40.8 bits (94), Expect = 0.063,   Method: Compositional matrix adjust.
 Identities = 32/110 (29%), Positives = 55/110 (50%), Gaps = 5/110 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD +     +   L +  G+ V  A S  EA +   K   P+ +++D SM G ++ +
Sbjct: 7   ILVVDDTMTALMMLVALLSTQGYQVSSAQSGAEALDLALKHP-PDLILLDFSMPG-MDGL 64

Query: 64  AHVRQM---PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           A  R++   P   D+ + +L    D +  + G  AGA  F++KPF R  L
Sbjct: 65  AVCRELKLNPRTRDIPILFLSSVSDSQTKVDGFAAGAVDFIIKPFERSEL 114


>gi|47059697|gb|AAQ16277.2| chlamyopsin-5 [Chlamydomonas reinhardtii]
          Length = 1425

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV--L 60
           +L VD   + + V ++L    G+ + +A    EA +   E+E LP+ +++D  M G+   
Sbjct: 706 VLSVDDDPVNQLVIQNLLAPVGYEILQAMDGQEALKVLTEEERLPDVILLDVMMPGMSGY 765

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRE 108
           E    +R+M   + + V  +  +   E ++ G  AG+N +++KPF R+
Sbjct: 766 EVCRKLREMYPLSCIPVIMISAKSKEEHIVEGLAAGSNDYVVKPFGRQ 813


>gi|297585449|ref|YP_003701229.1| response regulator receiver protein [Bacillus selenitireducens
           MLS10]
 gi|297143906|gb|ADI00664.1| response regulator receiver protein [Bacillus selenitireducens
           MLS10]
          Length = 119

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 60/117 (51%), Gaps = 5/117 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD    +R +   +F + GF    A++  +A +    E  P+ +++D  + G+  L
Sbjct: 4   KILIVDDQFGIRTLLTEVFQEDGFDTCNASNGKDAIQLTYSEK-PDLILLDMKIPGMDGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           + + ++R+   G DV +     E D  +M      GA +++ KPF+ + +R  +REL
Sbjct: 63  DILRYLREEDNGVDVIIMTAYGEAD--RMKEAKALGALAYIAKPFDIDYVRERVREL 117


>gi|78047473|ref|YP_363648.1| two-component system response regulator RpfG [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|294624917|ref|ZP_06703572.1| two-component system response regulator RpfG [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
 gi|78035903|emb|CAJ23594.1| two-component system response regulator RpfG [Xanthomonas
           campestris pv. vesicatoria str. 85-10]
 gi|292600796|gb|EFF44878.1| two-component system response regulator RpfG [Xanthomonas fuscans
           subsp. aurantifolii str. ICPB 11122]
          Length = 378

 Score = 40.8 bits (94), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|293373752|ref|ZP_06620098.1| response regulator receiver domain protein [Bacteroides ovatus SD CMC
            3f]
 gi|292631242|gb|EFF49874.1| response regulator receiver domain protein [Bacteroides ovatus SD CMC
            3f]
          Length = 1323

 Score = 40.8 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 2    DSLLLVDS----SHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
            ++LL+V+      H +R+   HL+             C A E+      P+ ++ D  M 
Sbjct: 1052 NTLLIVEDHETLRHYLRQTFEHLYRVIDVADGHEAIACLANEY------PDIILSDVMMP 1105

Query: 58   GVL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            G+   E    V++ P  + + V  L  + + E ++ G + GA+ ++ KPF+ E L+  ++
Sbjct: 1106 GIRGDELCRMVKENPDTSGIPVVLLTAKANHEAIVEGLKKGADDYIPKPFSTEILKLKVQ 1165

Query: 116  EL 117
             L
Sbjct: 1166 GL 1167


>gi|237721944|ref|ZP_04552425.1| two-component system sensor histidine kinase/response regulator
            hybrid [Bacteroides sp. 2_2_4]
 gi|229448813|gb|EEO54604.1| two-component system sensor histidine kinase/response regulator
            hybrid [Bacteroides sp. 2_2_4]
          Length = 1323

 Score = 40.8 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 2    DSLLLVDS----SHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
            ++LL+V+      H +R+   HL+             C A E+      P+ ++ D  M 
Sbjct: 1052 NTLLIVEDHETLRHYLRQTFEHLYRVIDVADGHEAIACLANEY------PDIILSDVMMP 1105

Query: 58   GVL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            G+   E    V++ P  + + V  L  + + E ++ G + GA+ ++ KPF+ E L+  ++
Sbjct: 1106 GIRGDELCRMVKENPDTSGIPVVLLTAKANHEAIVEGLKKGADDYIPKPFSTEILKLKVQ 1165

Query: 116  EL 117
             L
Sbjct: 1166 GL 1167


>gi|218781480|ref|YP_002432798.1| PAS modulated sigma54 specific transcriptional regulator, Fis
           family [Desulfatibacillum alkenivorans AK-01]
 gi|218762864|gb|ACL05330.1| PAS modulated sigma54 specific transcriptional regulator, Fis
           family [Desulfatibacillum alkenivorans AK-01]
          Length = 765

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 51/105 (48%), Gaps = 5/105 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L++D    + K   H F D GF+ ++A       +    E  P+ +++D +M G+  L
Sbjct: 9   SVLIIDDDEAICKALGHYFEDLGFIAYQADEGLGGLDVL-LECRPDAVLVDLAMPGMGGL 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
           EF+A  R++   T + V  +      E  +  +R GA  ++ KP 
Sbjct: 68  EFLARAREIAPETPMIV--VSGTGHLEDAVEASRLGAVDYITKPI 110


>gi|182677361|ref|YP_001831507.1| multi-sensor hybrid histidine kinase [Beijerinckia indica subsp.
           indica ATCC 9039]
 gi|182633244|gb|ACB94018.1| multi-sensor hybrid histidine kinase [Beijerinckia indica subsp.
           indica ATCC 9039]
          Length = 1013

 Score = 40.8 bits (94), Expect = 0.065,   Method: Composition-based stats.
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 13/113 (11%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++LLVD  + VR+V  ++  D G+ V EA S   A E  E+    + L++D +M G+  +
Sbjct: 878 TILLVDDDNAVREVAANILTDLGYAVIEAGSGSAALERLEEMPQIDLLLVDFAMPGMNGV 937

Query: 61  EFIAHVRQ-MPLGTDVFV--YYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E    VR+ +P    +FV  Y  L E+           G +  + KPF R+ L
Sbjct: 938 ELARVVRERLPNLPILFVTGYADLAEIK--------NVGEDRIVQKPFERQGL 982


>gi|172035733|ref|YP_001802234.1| two component transcriptional regulator [Cyanothece sp. ATCC 51142]
 gi|171697187|gb|ACB50168.1| two component transcriptional regulator [Cyanothece sp. ATCC 51142]
          Length = 225

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 52/95 (54%), Gaps = 10/95 (10%)

Query: 43  KELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF 100
           +E  P+ +++D  + G+  L+    +RQ   G+ V +  L  + D    +AG  AGA+ +
Sbjct: 44  RESNPDLILLDWMLPGISGLDICKRLRQT--GSKVPIILLTAKDDISDRVAGLDAGADDY 101

Query: 101 LLKPFNRETLRFAMRELPQMQKSKDEN----QFLD 131
           ++KPFN E L   +R    ++++ +E+    QFLD
Sbjct: 102 IVKPFNLEELLARVR--ANLRRNHEEDPDLLQFLD 134


>gi|89072515|ref|ZP_01159087.1| putative aerobic respiration control protein FexA [Photobacterium
           sp. SKA34]
 gi|89051619|gb|EAR57072.1| putative aerobic respiration control protein FexA [Photobacterium
           sp. SKA34]
          Length = 239

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 4/115 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-DESMEGVLEF 62
           +L+V+  H+ R   + +F   G+ VFEA    E  +   +   P +LVI D ++ G    
Sbjct: 6   ILIVEDEHVTRNTLKSIFEAEGYTVFEANDGAEMHQMLSEN--PVHLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +   R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L
Sbjct: 64  LL-ARELREQGDMALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL 117


>gi|15608121|ref|NP_215496.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis H37Rv]
 gi|15840406|ref|NP_335443.1| DNA-binding response regulator [Mycobacterium tuberculosis CDC1551]
 gi|148660762|ref|YP_001282285.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis H37Ra]
 gi|148822190|ref|YP_001286944.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis F11]
 gi|167968048|ref|ZP_02550325.1| mycobacterial persistence regulator mprA (two component response
           transcriptional regulatory protein) [Mycobacterium
           tuberculosis H37Ra]
 gi|215402797|ref|ZP_03414978.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis 02_1987]
 gi|215410580|ref|ZP_03419388.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis 94_M4241A]
 gi|215445129|ref|ZP_03431881.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis T85]
 gi|218752651|ref|ZP_03531447.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis GM 1503]
 gi|253799991|ref|YP_003032992.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis KZN 1435]
 gi|254363900|ref|ZP_04979946.1| mycobacterial persistence regulator mprA (two component response
           transcriptional regulatory protein) [Mycobacterium
           tuberculosis str. Haarlem]
 gi|254549965|ref|ZP_05140412.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis '98-R604 INH-RIF-EM']
 gi|289555237|ref|ZP_06444447.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis KZN 605]
 gi|289744717|ref|ZP_06504095.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis 02_1987]
 gi|289757064|ref|ZP_06516442.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis T85]
 gi|289761115|ref|ZP_06520493.1| mycobacterial persistence regulator mprA (two component response
           transcriptional regulatory protein) [Mycobacterium
           tuberculosis GM 1503]
 gi|294996473|ref|ZP_06802164.1| persistence regulator MprA [Mycobacterium tuberculosis 210]
 gi|297633506|ref|ZP_06951286.1| persistence regulator MprA [Mycobacterium tuberculosis KZN 4207]
 gi|297730491|ref|ZP_06959609.1| persistence regulator MprA [Mycobacterium tuberculosis KZN R506]
 gi|298524475|ref|ZP_07011884.1| mycobacterial persistence regulator mprA (two component response
           transcriptional regulatory protein) [Mycobacterium
           tuberculosis 94_M4241A]
 gi|306775116|ref|ZP_07413453.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu001]
 gi|306781969|ref|ZP_07420306.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu002]
 gi|306783676|ref|ZP_07421998.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu003]
 gi|306788030|ref|ZP_07426352.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu004]
 gi|306792364|ref|ZP_07430666.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu005]
 gi|306796766|ref|ZP_07435068.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu006]
 gi|306802653|ref|ZP_07439321.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu008]
 gi|306806833|ref|ZP_07443501.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu007]
 gi|306967031|ref|ZP_07479692.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu009]
 gi|306971221|ref|ZP_07483882.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu010]
 gi|307078952|ref|ZP_07488122.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu011]
 gi|313657820|ref|ZP_07814700.1| persistence regulator MprA [Mycobacterium tuberculosis KZN V2475]
 gi|81816332|sp|O53894|MPRA_MYCTU RecName: Full=Response regulator mprA; AltName: Full=Mycobacterial
           persistence regulator A
 gi|160012482|sp|A5U123|MPRA_MYCTA RecName: Full=Response regulator mprA; AltName: Full=Mycobacterial
           persistence regulator A
 gi|2916942|emb|CAA17580.1| MYCOBACTERIAL PERSISTENCE REGULATOR MRPA (TWO COMPONENT RESPONSE
           TRANSCRIPTIONAL REGULATORY PROTEIN) [Mycobacterium
           tuberculosis H37Rv]
 gi|13880575|gb|AAK45257.1| DNA-binding response regulator [Mycobacterium tuberculosis CDC1551]
 gi|134149414|gb|EBA41459.1| mycobacterial persistence regulator mprA (two component response
           transcriptional regulatory protein) [Mycobacterium
           tuberculosis str. Haarlem]
 gi|148504914|gb|ABQ72723.1| mycobacterial persistence regulator MrpA [Mycobacterium
           tuberculosis H37Ra]
 gi|148720717|gb|ABR05342.1| mycobacterial persistence regulator mprA (two component response
           transcriptional regulatory protein) [Mycobacterium
           tuberculosis F11]
 gi|253321494|gb|ACT26097.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis KZN 1435]
 gi|289439869|gb|EFD22362.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis KZN 605]
 gi|289685245|gb|EFD52733.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis 02_1987]
 gi|289708621|gb|EFD72637.1| mycobacterial persistence regulator mprA (two component response
           transcriptional regulatory protein) [Mycobacterium
           tuberculosis GM 1503]
 gi|289712628|gb|EFD76640.1| two component response transcriptional regulatory protein MprA
           [Mycobacterium tuberculosis T85]
 gi|298494269|gb|EFI29563.1| mycobacterial persistence regulator mprA (two component response
           transcriptional regulatory protein) [Mycobacterium
           tuberculosis 94_M4241A]
 gi|308216323|gb|EFO75722.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu001]
 gi|308325360|gb|EFP14211.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu002]
 gi|308331519|gb|EFP20370.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu003]
 gi|308335324|gb|EFP24175.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu004]
 gi|308339132|gb|EFP27983.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu005]
 gi|308342803|gb|EFP31654.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu006]
 gi|308346656|gb|EFP35507.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu007]
 gi|308350571|gb|EFP39422.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu008]
 gi|308355261|gb|EFP44112.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu009]
 gi|308359215|gb|EFP48066.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu010]
 gi|308363126|gb|EFP51977.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis SUMu011]
 gi|323720547|gb|EGB29628.1| myco persistence regulator mprA [Mycobacterium tuberculosis
           CDC1551A]
 gi|326904793|gb|EGE51726.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis W-148]
 gi|328459733|gb|AEB05156.1| mycobacterial persistence regulator mprA [Mycobacterium
           tuberculosis KZN 4207]
          Length = 230

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 57/124 (45%), Gaps = 5/124 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA +    +  P+ LV+D  M  +  LE
Sbjct: 5   ILVVDDDRAVRESLRRSLSFNGYSVELAHDGVEALDMIASDR-PDALVLDVMMPRLDGLE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 64  VCRQLRGT--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 121

Query: 122 KSKD 125
           K +D
Sbjct: 122 KPED 125


>gi|311069837|ref|YP_003974760.1| two-component response regulator [Bacillus atrophaeus 1942]
 gi|310870354|gb|ADP33829.1| two-component response regulator [Bacillus atrophaeus 1942]
          Length = 239

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 30/107 (28%), Positives = 57/107 (53%), Gaps = 7/107 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           S+L+VD  + +  + + + +  GF  V  A S  EA    +KE + + LV+D  M+G+  
Sbjct: 5   SILIVDDENAIVDMVKRVLDKEGFQNVMTAGSAEEAIPIVKKEKI-DLLVLDVMMDGMSG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            E  A +R+    +D  +++L  +      ++G  +GA+ ++ KPFN
Sbjct: 64  FEACAAIREY---SDAPIFFLTAKTSDTDKLSGFASGADDYITKPFN 107


>gi|254462390|ref|ZP_05075806.1| response regulator [Rhodobacterales bacterium HTCC2083]
 gi|206678979|gb|EDZ43466.1| response regulator [Rhodobacteraceae bacterium HTCC2083]
          Length = 428

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (47%), Gaps = 12/128 (9%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L+VD S + RK+        G+ V EA S   A   C  E  P+ ++ D     M+G L
Sbjct: 22  VLIVDDSRLQRKIISASLLRRGYDVREADSGVSALTVC-AEWPPDVVLSDWMMPEMDG-L 79

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEK--MIAGARAGANSFLLKPFNRETLR---FAMR 115
           EF    + +P   + + Y++L+     K  +  G + GA+ FL KP N   LR    A  
Sbjct: 80  EFCQKFKALP--REGYGYFILLTSKSAKDEVAQGLQCGADDFLTKPVNGLELRARLAAGE 137

Query: 116 ELPQMQKS 123
            + QMQ++
Sbjct: 138 RIIQMQRA 145


>gi|254432325|ref|ZP_05046028.1| DNA-binding response regulator [Cyanobium sp. PCC 7001]
 gi|197626778|gb|EDY39337.1| DNA-binding response regulator [Cyanobium sp. PCC 7001]
          Length = 253

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 2/114 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           +++L+VD    +R++     +  G+ V  A+   EA E C +E  P+ +V+D  M   L+
Sbjct: 14  ETILVVDDEASIRRILETRLSMIGYQVVTASDGMEALE-CFRESHPDLVVLDVMMPK-LD 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
                +++   +DV +  L    D    I G   GA+ +++KPF+ + L   +R
Sbjct: 72  GYGVCQELRKESDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIR 125


>gi|170079454|ref|YP_001736092.1| sensory box/GGDEF family protein [Synechococcus sp. PCC 7002]
 gi|169887123|gb|ACB00837.1| sensory box/GGDEF family protein [Synechococcus sp. PCC 7002]
          Length = 610

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 23/107 (21%), Positives = 56/107 (52%), Gaps = 3/107 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           + ++L+++  +++RK+ R +  + G++V EA    E      KE  P+ ++ D  M  + 
Sbjct: 24  ITTILVIEDDYVIRKLTRKILTNAGYIVIEAND-GEKGIQAAKEYHPDLIICDVMMPHLS 82

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
             + +A ++Q      +   +L  + + +++  G  +GA+ +L+KP 
Sbjct: 83  GYDVLARLQQQEATEMIPFIFLTAQAEGQQLRQGMASGADDYLMKPI 129


>gi|159487203|ref|XP_001701623.1| chlamyopsin-5 sensory rhodopsin [Chlamydomonas reinhardtii]
 gi|158280842|gb|EDP06598.1| chlamyopsin-5 sensory rhodopsin [Chlamydomonas reinhardtii]
          Length = 1441

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 29/108 (26%), Positives = 57/108 (52%), Gaps = 3/108 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV--L 60
           +L VD   + + V ++L    G+ + +A    EA +   E+E LP+ +++D  M G+   
Sbjct: 722 VLSVDDDPVNQLVIQNLLAPVGYEILQAMDGQEALKVLTEEERLPDVILLDVMMPGMSGY 781

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRE 108
           E    +R+M   + + V  +  +   E ++ G  AG+N +++KPF R+
Sbjct: 782 EVCRKLREMYPLSCIPVIMISAKSKEEHIVEGLAAGSNDYVVKPFGRQ 829


>gi|153868803|ref|ZP_01998544.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
 gi|152074620|gb|EDN71457.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
          Length = 326

 Score = 40.8 bits (94), Expect = 0.065,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 63/128 (49%), Gaps = 6/128 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L+VD +     V   +  + G++   ATS  EA  +  KE  P  +++D     M+G 
Sbjct: 6   TILIVDDNPTNLGVLGSIIAENGYLPGFATSGIEALAYL-KEKHPKLILLDIMMPDMDG- 63

Query: 60  LEFIAHVRQ-MPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            E    +RQ   L  ++ + +L  + + E +I G   GA  ++ KPFN+  L   +    
Sbjct: 64  FEVCRRLRQNATLAANIPIIFLTAKTEKEDVITGLELGAVDYVTKPFNKNELLTRINTHL 123

Query: 119 QMQKSKDE 126
           ++Q +K+E
Sbjct: 124 ELQATKEE 131


>gi|326794390|ref|YP_004312210.1| response regulator receiver protein [Marinomonas mediterranea
           MMB-1]
 gi|326545154|gb|ADZ90374.1| response regulator receiver protein [Marinomonas mediterranea
           MMB-1]
          Length = 121

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 50/110 (45%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +LL+VD S  VR++        G+ V  A    EA + C      ++++ D++M  +  L
Sbjct: 4   NLLVVDDSPSVRQMVEATLKGGGYQVKTAKDGREALDICRTTKF-DFVLTDQNMPNMDGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             I  +R M     V +  L  E        G  AGA  +++KPF+ + L
Sbjct: 63  TLIKSLRAMSAYARVPLIVLTTEASDAMKAKGKAAGATGWMVKPFDPKKL 112


>gi|17229228|ref|NP_485776.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17130826|dbj|BAB73435.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 231

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 64/135 (47%), Gaps = 8/135 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    +R+  +    + GF V  A++  E  +  ++   P+ ++ D  M  V   +
Sbjct: 5   LLLVDDEPGLREAVKDYLQESGFSVQVASNAREGWDLMQQST-PDLVISDVMMPQVDGYQ 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL-----RFAMRE 116
           F+  +R+ P    + V +L  +      I G +AG +++L KPF+ + L        +R 
Sbjct: 64  FLKQLREDPRFQSLPVVFLTAKGMTSDRIQGYQAGVDAYLPKPFDPDELVAIVENLLIRR 123

Query: 117 LPQMQKSKDENQFLD 131
             + QK+ +E +  D
Sbjct: 124 NSKPQKTTEEGETPD 138


>gi|325922145|ref|ZP_08183935.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Xanthomonas gardneri ATCC 19865]
 gi|325547380|gb|EGD18444.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Xanthomonas gardneri ATCC 19865]
          Length = 378

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCANLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|317403774|gb|EFV84255.1| chemotaxis protein CheY [Achromobacter xylosoxidans C54]
          Length = 129

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPN----YLVIDESME 57
            +L+VD    +R++ R+L  + GF      +V EA +     E L N    ++V D +M 
Sbjct: 7   KILVVDDFPTMRRIIRNLLKELGF-----ENVDEAEDGAIGLEKLRNGGFQFVVSDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  LE +  +R       + V  +  E   E ++A A+AGAN +++KPF   TL
Sbjct: 62  NLDGLEMLKQIRADASLASLPVLMVTAEAKKENIVAAAQAGANGYVVKPFTAATL 116


>gi|303248643|ref|ZP_07334898.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Desulfovibrio fructosovorans JJ]
 gi|302489993|gb|EFL49917.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Desulfovibrio fructosovorans JJ]
          Length = 359

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 4/125 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L +D   I  +V   L  + G       S  EAR+  +  +  + +++D  M     F 
Sbjct: 7   ILAIDDERINLRVIGGLLRNLGHEPVLTESFTEARQHLDATI--DLVLLDVMMPETDGFT 64

Query: 64  A--HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R++P   DV +  +      +  +    AGAN F+ KP +   LR  M  L +M+
Sbjct: 65  VAKKIREIPEVADVPIIMVTALTSKQDRLKAVEAGANDFISKPIDLTELRVRMGSLLKMK 124

Query: 122 KSKDE 126
           +S+DE
Sbjct: 125 ESQDE 129


>gi|166711949|ref|ZP_02243156.1| response regulator [Xanthomonas oryzae pv. oryzicola BLS256]
          Length = 378

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALAWCEAGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|148653918|ref|YP_001281011.1| osmolarity response regulator [Psychrobacter sp. PRwf-1]
 gi|148573002|gb|ABQ95061.1| two component transcriptional regulator, winged helix family
           [Psychrobacter sp. PRwf-1]
          Length = 248

 Score = 40.8 bits (94), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 9/123 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    +R + +    D GF+V  A    +  +  ++EL  + +V+D  + G     
Sbjct: 16  ILVVDDDARLRSLLQRFLEDDGFVVRTAHDGSQMDKLMQRELF-SLVVLDLMLPGEDGIA 74

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETLRFAMR 115
              R     +D+ +  L  +      IAG  AGA+ +L KPFN        +  LR   R
Sbjct: 75  ICKRLREENSDIPIIMLTAKGSDSDRIAGLEAGADDYLPKPFNPKELLARIKAVLRRHSR 134

Query: 116 ELP 118
           ELP
Sbjct: 135 ELP 137


>gi|261408948|ref|YP_003245189.1| integral membrane sensor hybrid histidine kinase [Paenibacillus sp.
           Y412MC10]
 gi|261285411|gb|ACX67382.1| integral membrane sensor hybrid histidine kinase [Paenibacillus sp.
           Y412MC10]
          Length = 1049

 Score = 40.8 bits (94), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 67/132 (50%), Gaps = 5/132 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK---ELLPNYLVIDESMEGVL 60
           LL+VD   +  KV  HL  D G+ +   T   EA +  E+   +L+ + +++ + M G  
Sbjct: 721 LLIVDDDPVNLKVIHHLLADEGYRIVTVTRAEEALQLLEQGEWDLIISDVMMPQ-MSG-Y 778

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +RQ  + +++ +  L      E +  G  +GAN +L+KP +   L+  +R L ++
Sbjct: 779 ELSRTIRQRYMLSELPILLLTARNRPEDIHMGFISGANDYLIKPVDHLELKTRVRALLEL 838

Query: 121 QKSKDENQFLDA 132
           ++S  E   ++A
Sbjct: 839 KRSIKERLHMEA 850


>gi|299144991|ref|ZP_07038059.1| putative two-component system sensor histidine kinase/response
            regulator hybrid [Bacteroides sp. 3_1_23]
 gi|298515482|gb|EFI39363.1| putative two-component system sensor histidine kinase/response
            regulator hybrid [Bacteroides sp. 3_1_23]
          Length = 1323

 Score = 40.8 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 2    DSLLLVDS----SHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
            ++LL+V+      H +R+   HL+             C A E+      P+ ++ D  M 
Sbjct: 1052 NTLLIVEDHETLRHYLRQTFEHLYRVIDVADGHEAIACLANEY------PDIILSDVMMP 1105

Query: 58   GVL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            G+   E    V++ P  + + V  L  + + E ++ G + GA+ ++ KPF+ E L+  ++
Sbjct: 1106 GIRGDELCRMVKENPDTSGIPVVLLTAKANHEAIVEGLKKGADDYIPKPFSTEILKLKVQ 1165

Query: 116  EL 117
             L
Sbjct: 1166 GL 1167


>gi|298482580|ref|ZP_07000765.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. D22]
 gi|298271287|gb|EFI12863.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. D22]
          Length = 1322

 Score = 40.8 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 2    DSLLLVDS----SHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
            ++LL+V+      H +R+   HL+             C A E+      P+ ++ D  M 
Sbjct: 1051 NTLLIVEDHETLRHYLRQTFEHLYRVIDVADGHEAIACLANEY------PDIILSDVMMP 1104

Query: 58   GVL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            G+   E    V++ P  + + V  L  + + E ++ G + GA+ ++ KPF+ E L+  ++
Sbjct: 1105 GIRGDELCRMVKENPDTSGIPVVLLTAKANHEAIVEGLKKGADDYIPKPFSTEILKLKVQ 1164

Query: 116  EL 117
             L
Sbjct: 1165 GL 1166


>gi|160884751|ref|ZP_02065754.1| hypothetical protein BACOVA_02740 [Bacteroides ovatus ATCC 8483]
 gi|156109786|gb|EDO11531.1| hypothetical protein BACOVA_02740 [Bacteroides ovatus ATCC 8483]
          Length = 1323

 Score = 40.8 bits (94), Expect = 0.067,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 2    DSLLLVDS----SHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
            ++LL+V+      H +R+   HL+             C A E+      P+ ++ D  M 
Sbjct: 1052 NTLLIVEDHETLRHYLRQTFEHLYRVIDVADGHEAIACLANEY------PDIILSDVMMP 1105

Query: 58   GVL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            G+   E    V++ P  + + V  L  + + E ++ G + GA+ ++ KPF+ E L+  ++
Sbjct: 1106 GIRGDELCRMVKENPDTSGIPVVLLTAKANHEAIVEGLKKGADDYIPKPFSTEILKLKVQ 1165

Query: 116  EL 117
             L
Sbjct: 1166 GL 1167


>gi|288958803|ref|YP_003449144.1| two-component response regulator [Azospirillum sp. B510]
 gi|288911111|dbj|BAI72600.1| two-component response regulator [Azospirillum sp. B510]
          Length = 121

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 58/116 (50%), Gaps = 14/116 (12%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESMEG 58
           +L+VD    +R++ R+L    G+     T + EA +        +E     ++ D +ME 
Sbjct: 3   ILVVDDYATMRRIVRNLLTQIGY-----TDIDEAGDGVSALAKLRESKFGLIISDWNMEP 57

Query: 59  V--LEFIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           +  L+ +  +R    L    F+  +  E   E +IA  +AG N++++KPFN +TL+
Sbjct: 58  MTGLQLLKEIRADAKLAATPFIM-VTAESKTENVIAAKQAGVNNYIVKPFNADTLK 112


>gi|54307752|ref|YP_128772.1| two-component response regulator [Photobacterium profundum SS9]
 gi|90413158|ref|ZP_01221154.1| putative aerobic respiration control protein FexA [Photobacterium
           profundum 3TCK]
 gi|46912175|emb|CAG18970.1| putative aerobic respiration control protein FexA [Photobacterium
           profundum SS9]
 gi|90325849|gb|EAS42301.1| putative aerobic respiration control protein FexA [Photobacterium
           profundum 3TCK]
          Length = 239

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 4/115 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-DESMEGVLEF 62
           +L+V+  H+ R   + +F   G+ VFEA    E  +   +   P +LVI D ++ G    
Sbjct: 6   ILIVEDEHVTRNTLKSIFEAEGYTVFEANDGAEMHQMLSEH--PVHLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +   R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L
Sbjct: 64  LL-ARELREQGDMALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL 117


>gi|332284008|ref|YP_004415919.1| chemotaxis response regulator [Pusillimonas sp. T7-7]
 gi|330427961|gb|AEC19295.1| chemotaxis response regulator [Pusillimonas sp. T7-7]
          Length = 129

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 57/114 (50%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPN----YLVIDESMEG 58
           +L+VD    +R++ ++L  D GF      +V EA +     E L N    ++V D +M  
Sbjct: 8   ILVVDDFPTMRRIIKNLLKDLGF-----ENVDEAEDGAMGLEKLRNGSFDFVVSDWNMPN 62

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  L  + H+R       + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 63  MDGLVMLQHIRADAALAKLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|240169348|ref|ZP_04748007.1| mycobacterial persistence regulator [Mycobacterium kansasii ATCC
           12478]
          Length = 228

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 38/124 (30%), Positives = 56/124 (45%), Gaps = 5/124 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    VR+  R   +  G+ V  A    EA +    +  P+ LV+D  M  +  LE
Sbjct: 3   ILVVDDDRAVRESLRRSLSFNGYSVELAHDGLEALDMIASDR-PDALVLDVMMPRLDGLE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R    G D+ +  L       + +AG  AGA+ +L KPF  E L   MR L +  
Sbjct: 62  VCRQLRST--GDDLPILVLTARDSVSERVAGLDAGADDYLPKPFALEELLARMRALLRRT 119

Query: 122 KSKD 125
           K  D
Sbjct: 120 KPDD 123


>gi|224372199|ref|YP_002606571.1| chemotaxis response regulator [Nautilia profundicola AmH]
 gi|223588330|gb|ACM92066.1| chemotaxis response regulator [Nautilia profundicola AmH]
          Length = 125

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 26/112 (23%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD S  +R++  +     G+  V +A    EA E  +       ++ D +M  +  
Sbjct: 2   KILVVDDSSTMRRIIVNTLARLGYKDVVQAADGVEAWEVMQANPDIGVVITDWNMPNMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE +  +R      D+ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LELVKKIRAEEKYKDIPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|146344360|ref|YP_001202216.1| putative two-component regulator sensor histidine kinase fused
            response regulator protein [Pseudomonas fluorescens
            SBW25]
 gi|146188172|emb|CAM96503.1| putative two-component regulator sensor histidine kinase fused
            response regulator protein [Pseudomonas fluorescens
            SBW25]
          Length = 1946

 Score = 40.8 bits (94), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 5/127 (3%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            ++L+VD S   R     +F  FG+ V  A     A         P+ +++D  M  +   
Sbjct: 1821 TVLVVDDSRSYRSQLERIFTGFGYTVITAVDGQNALHKLGLIDKPDLMLVDVEMPNMNGF 1880

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            EF   +R+ P   D  +  +      E+     RAG   +LLKP +  +L+ A+ ++ + 
Sbjct: 1881 EFTEAIRRKPEFDDTPIIMITTRTGLEE--KAMRAGVTKYLLKPCDAPSLQQAIAQI-KA 1937

Query: 121  QKSKDEN 127
            QKS +E+
Sbjct: 1938 QKSMEES 1944


>gi|302671340|ref|YP_003831300.1| response regulator domain-containing protein [Butyrivibrio
           proteoclasticus B316]
 gi|302395813|gb|ADL34718.1| response regulator domain-containing protein [Butyrivibrio
           proteoclasticus B316]
          Length = 117

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 58/119 (48%), Gaps = 8/119 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVID---ESM 56
           M S+L+VD S + RK+ R+L +  GF +V EA    E  E   K L P+ +V+D     M
Sbjct: 1   MKSVLIVDDSRVSRKMIRNLISHSGFEVVGEAIDGREGLELYVK-LSPDVVVMDITIPEM 59

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            G+   +      P   D  V  +  E   ++     +AGA + + KP+  E + +A+R
Sbjct: 60  NGLDSLMKIKEHDP---DARVILIAEEGQDQEKEEARKAGAVALVTKPYTDEDILYAIR 115


>gi|237717067|ref|ZP_04547548.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262405835|ref|ZP_06082385.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|294647796|ref|ZP_06725348.1| response regulator receiver domain protein [Bacteroides ovatus SD CC
            2a]
 gi|294806190|ref|ZP_06765037.1| response regulator receiver domain protein [Bacteroides xylanisolvens
            SD CC 1b]
 gi|229443050|gb|EEO48841.1| conserved hypothetical protein [Bacteroides sp. D1]
 gi|262356710|gb|EEZ05800.1| conserved hypothetical protein [Bacteroides sp. 2_1_22]
 gi|292636704|gb|EFF55170.1| response regulator receiver domain protein [Bacteroides ovatus SD CC
            2a]
 gi|294446446|gb|EFG15066.1| response regulator receiver domain protein [Bacteroides xylanisolvens
            SD CC 1b]
          Length = 1323

 Score = 40.8 bits (94), Expect = 0.069,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 57/122 (46%), Gaps = 12/122 (9%)

Query: 2    DSLLLVDS----SHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
            ++LL+V+      H +R+   HL+             C A E+      P+ ++ D  M 
Sbjct: 1052 NTLLIVEDHETLRHYLRQTFEHLYRVIDVADGHEAIACLANEY------PDIILSDVMMP 1105

Query: 58   GVL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            G+   E    V++ P  + + V  L  + + E ++ G + GA+ ++ KPF+ E L+  ++
Sbjct: 1106 GIRGDELCRMVKENPDTSGIPVVLLTAKANHEAIVEGLKKGADDYIPKPFSTEILKLKVQ 1165

Query: 116  EL 117
             L
Sbjct: 1166 GL 1167


>gi|255603920|ref|XP_002538134.1| two-component system sensor histidine kinase/response regulator,
           putative [Ricinus communis]
 gi|223513636|gb|EEF24248.1| two-component system sensor histidine kinase/response regulator,
           putative [Ricinus communis]
          Length = 122

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 31/119 (26%), Positives = 56/119 (47%), Gaps = 7/119 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SMEG 58
           ++L+VD S  +R+V        G+ V EA    +A      + +  +L+I +    +M+G
Sbjct: 4   TILVVDDSASLRQVVSIALKGAGYEVIEANDGKDALSKLNGQKI--HLIISDVNMPNMDG 61

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +  F+   +Q+P      V  L  E    K   G  AGA ++++KPF    +  A+ +L
Sbjct: 62  I-SFVKAAKQLPAYKFTPVIMLTTEAGESKKAEGQAAGAKAWVVKPFQPAQMLTAVSKL 119


>gi|90580600|ref|ZP_01236405.1| putative aerobic respiration control protein FexA [Vibrio angustum
           S14]
 gi|90438258|gb|EAS63444.1| putative aerobic respiration control protein FexA [Photobacterium
           angustum S14]
          Length = 239

 Score = 40.8 bits (94), Expect = 0.069,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 4/115 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-DESMEGVLEF 62
           +L+V+  H+ R   + +F   G+ VFEA    E  +   +   P +LVI D ++ G    
Sbjct: 6   ILIVEDEHVTRNTLKSIFEAEGYTVFEANDGAEMHQMLSEN--PVHLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +   R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L
Sbjct: 64  LL-ARELREQGDMALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL 117


>gi|323698082|ref|ZP_08109994.1| response regulator receiver protein [Desulfovibrio sp. ND132]
 gi|323458014|gb|EGB13879.1| response regulator receiver protein [Desulfovibrio desulfuricans
           ND132]
          Length = 126

 Score = 40.8 bits (94), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 56/110 (50%), Gaps = 4/110 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +RK+ +++    GF  + EA     A E   K+ + +++V D +M  +  +
Sbjct: 9   VLVVDDFSTMRKIIKNILRQLGFNNIVEADDGSTAWEVLNKDNI-DFIVSDWNMPTMSGI 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E +  VR     +D+    +  E   E +I   +A  +++++KPF  ETL
Sbjct: 68  ELLRKVRASEEYSDIPFLMVTAEAQQENIIEAVQAKVSNYIVKPFTPETL 117


>gi|297538092|ref|YP_003673861.1| response regulator receiver protein [Methylotenera sp. 301]
 gi|297257439|gb|ADI29284.1| response regulator receiver protein [Methylotenera sp. 301]
          Length = 132

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 55/113 (48%), Gaps = 12/113 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESMEGV 59
           L+VD    +R++ R+L  + G+     T+V EA +        K     ++V D +M  +
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGY-----TNVDEAEDGAVGLSKLKGGGFEFVVSDWNMPNM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             L  +  +R  P    + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 64  DGLTMLQQIRADPELKHLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|108758279|ref|YP_629448.1| sigma-54 dependent DNA-binding response regulator [Myxococcus
           xanthus DK 1622]
 gi|108462159|gb|ABF87344.1| sigma-54 dependent DNA-binding response regulator [Myxococcus
           xanthus DK 1622]
          Length = 450

 Score = 40.8 bits (94), Expect = 0.071,   Method: Composition-based stats.
 Identities = 40/134 (29%), Positives = 62/134 (46%), Gaps = 7/134 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPNYLVIDESMEGV--L 60
           +L+VD    V +  R L +D GF   EA S  EA +  +  E  P  +++D  M G   L
Sbjct: 7   ILIVDDDSGVLRALRGLLSDEGFTPVEARSAAEASQLLDAPEGPPAMMLLDLRMPGETGL 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E +A   ++P      V  L  E    + +   R GA  F+ KP + E L  A+R    +
Sbjct: 67  ELLA---RLPRPFPAPVVVLSGEASPAEAVQALRLGATDFVEKPPSPERLLTAVRNALAL 123

Query: 121 QKSKDENQ-FLDAI 133
              ++E +  LDA+
Sbjct: 124 GSLQEERERLLDAL 137


>gi|330959571|gb|EGH59831.1| putative two-component regulator sensor histidine kinase fused
            response regulator protein [Pseudomonas syringae pv.
            maculicola str. ES4326]
          Length = 1945

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 58/127 (45%), Gaps = 5/127 (3%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            ++L+VD S   R     +F  FG+ V  A     A         P+ +++D  M  +   
Sbjct: 1820 TVLVVDDSRSYRSQLERIFTGFGYTVITAVDGQNALHKLGLIDKPDLMLVDVEMPNMNGF 1879

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            EF   +R+ P   D  +  +      E+     RAG   +LLKP +  +L+ A+ ++ + 
Sbjct: 1880 EFTEAIRRKPEFDDTPIIMITTRTGLEE--KAMRAGVTKYLLKPSDAPSLQQAVAQI-KA 1936

Query: 121  QKSKDEN 127
            QKS +E+
Sbjct: 1937 QKSMEES 1943


>gi|188527190|ref|YP_001909877.1| response regulator [Helicobacter pylori Shi470]
 gi|188143430|gb|ACD47847.1| response regulator [Helicobacter pylori Shi470]
 gi|261837813|gb|ACX97579.1| modulator of the flagellar rotation direction [Helicobacter pylori
           51]
 gi|261839228|gb|ACX98993.1| chemotaxis regulatory protein CheY [Helicobacter pylori 52]
 gi|297379601|gb|ADI34488.1| Chemotaxis protein cheY [Helicobacter pylori v225d]
 gi|308061731|gb|ADO03619.1| response regulator [Helicobacter pylori Cuz20]
 gi|308063242|gb|ADO05129.1| response regulator [Helicobacter pylori Sat464]
 gi|317177192|dbj|BAJ54981.1| response regulator [Helicobacter pylori F16]
 gi|317179226|dbj|BAJ57014.1| response regulator [Helicobacter pylori F30]
 gi|317181722|dbj|BAJ59506.1| response regulator [Helicobacter pylori F57]
          Length = 124

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 54/112 (48%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++  +  G+  V EA    EA E          L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLSRLGYEDVLEAEHGVEAWEKLNANADTKVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           L+ +  VR      ++ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 62  LDLVIKVRADERFKEIPIIMITTEGGKAEVITALKAGVNNYIVKPFTPQVLK 113


>gi|157145330|ref|YP_001452649.1| chemotaxis regulatory protein CheY [Citrobacter koseri ATCC
           BAA-895]
 gi|157082535|gb|ABV12213.1| hypothetical protein CKO_01070 [Citrobacter koseri ATCC BAA-895]
          Length = 129

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +     ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQASGF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R       + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRADGAMASLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|153871117|ref|ZP_02000368.1| two-component response regulator [Beggiatoa sp. PS]
 gi|152072416|gb|EDN69631.1| two-component response regulator [Beggiatoa sp. PS]
          Length = 295

 Score = 40.8 bits (94), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 34/110 (30%), Positives = 54/110 (49%), Gaps = 7/110 (6%)

Query: 1   MDSLLLVDSSHIVRK-VGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESM 56
           M  +L+VD +   RK + RHL  + G+   EA +   A E   KE LP  +++D     M
Sbjct: 1   MSKVLIVDDNLKTRKMLRRHLLKN-GYETLEAENGHVALESV-KENLPEVVLLDVMMPDM 58

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            G+ E    +RQ P    V++  L      E+ + G   GA+ ++ KPF+
Sbjct: 59  TGI-EVCQKLRQTPHYELVYIIMLTALTSSEQKVEGLDQGADDYITKPFD 107


>gi|329890416|ref|ZP_08268759.1| mutant NtrC-like activator [Brevundimonas diminuta ATCC 11568]
 gi|328845717|gb|EGF95281.1| mutant NtrC-like activator [Brevundimonas diminuta ATCC 11568]
          Length = 489

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 4/122 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD     R++ + + +  G+ V  A S  EA +   K    + +++D  M G+  +
Sbjct: 4   TVLVVDDDPTQRRLIQAVLDREGYAVVHAESGGEAIDRLTKGGGADVVLLDLVMPGLSGM 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E +A +R   + T V V  L      E ++   +AGA  F +KP   + L   +R   QM
Sbjct: 64  EALAEMRTAGVATPVIV--LTANGGIETVVKAMQAGAQDFFVKPVGPDRLLVGVRNALQM 121

Query: 121 QK 122
            +
Sbjct: 122 TQ 123


>gi|253700456|ref|YP_003021645.1| response regulator receiver protein [Geobacter sp. M21]
 gi|251775306|gb|ACT17887.1| response regulator receiver protein [Geobacter sp. M21]
          Length = 123

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGV 59
           ++L++D S +V  +        G+ V  AT+  EA  F   +  P+ +++D  M   +G 
Sbjct: 4   TILIIDDSEVVLTMAMDALVQAGYEVLTATNGIEANRFIFSKKRPDLIIMDIMMPMLDGN 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
            +    +++  +  D+ +  L  + + E     A AGAN ++LKPF+ E L   +++
Sbjct: 64  -KKAKLLKENEVSKDIPILLLSSKSEKEMRELAAEAGANGYILKPFSAEELTAKVKK 119


>gi|163783037|ref|ZP_02178032.1| chemotaxis protein CheY [Hydrogenivirga sp. 128-5-R1-1]
 gi|159881717|gb|EDP75226.1| chemotaxis protein CheY [Hydrogenivirga sp. 128-5-R1-1]
          Length = 127

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 59/118 (50%), Gaps = 4/118 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ R + N  G+  + EA +  +A    +KE   +++V D +M  +  
Sbjct: 9   KILVVDDMSTMRRIIRTILNQLGYSNIEEAENGKQALAKLKKEKF-DFVVTDWNMPEMDG 67

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           L  +  +R       + V  +  E   E ++   +AG N++++KPF  E L+  M ++
Sbjct: 68  LSLVKAIRSDDELKHIPVLMVTAEAKKENVMEALKAGVNNYIVKPFTPEVLKEKMEKV 125


>gi|197118765|ref|YP_002139192.1| chemotaxis protein CheY [Geobacter bemidjiensis Bem]
 gi|197088125|gb|ACH39396.1| chemotaxis protein CheY [Geobacter bemidjiensis Bem]
          Length = 123

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 29/117 (24%), Positives = 58/117 (49%), Gaps = 4/117 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGV 59
           ++L++D S +V  +        G+ V  AT+  EA  F   +  P+ +++D  M   +G 
Sbjct: 4   TILIIDDSEVVLTMAMDALVQAGYEVLTATNGIEANRFIFSKKRPDLIIMDIMMPMLDGN 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
            +    +++  +  D+ +  L  + + E     A AGAN ++LKPF+ E L   +++
Sbjct: 64  -KKAKLLKENEVSKDIPILLLSSKSENEMRELAAEAGANGYILKPFSAEELTAKVKK 119


>gi|84502326|ref|ZP_01000474.1| response regulator [Oceanicola batsensis HTCC2597]
 gi|84389686|gb|EAQ02405.1| response regulator [Oceanicola batsensis HTCC2597]
          Length = 313

 Score = 40.4 bits (93), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESM----EG 58
           +L VD S I ++  R   +D G+  V    S  EA E          L++ + M    +G
Sbjct: 7   ILSVDDSDIAQEYIRAALSDIGYEDVVSFLSSNEALEALSAGTARADLILLDVMMPEIDG 66

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
           V E  A +R +    D  +  L    D + +     AGAN ++ KPFNR  L+  MR   
Sbjct: 67  V-ELCARIRALTDWADTPIIMLTSRTDMDTLQHAFMAGANDYVTKPFNRVELQARMRSCL 125

Query: 119 QMQKSKD 125
           +++   D
Sbjct: 126 RLKSEMD 132


>gi|159481444|ref|XP_001698789.1| chlamyopsin-6 [Chlamydomonas reinhardtii]
 gi|158273500|gb|EDO99289.1| chlamyopsin-6 [Chlamydomonas reinhardtii]
          Length = 1223

 Score = 40.4 bits (93), Expect = 0.073,   Method: Composition-based stats.
 Identities = 32/113 (28%), Positives = 57/113 (50%), Gaps = 4/113 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREF-CEKELLPNYLVIDESMEGV 59
           M ++L VD   I + V   +  D G+         EA E+ C  + +P+ +++D  M  +
Sbjct: 579 MMNVLSVDDEDINQIVLEEILTDSGYAFARCMDGAEALEWLCASDTMPDLILLDCMMPVM 638

Query: 60  L--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN-RET 109
              EF A +R++  G  + V  +  + D E ++ G R+G+N FL+   + RET
Sbjct: 639 SGHEFCATLRKVIPGNVLPVIMVSAKSDEENIVEGLRSGSNDFLVNNVDGRET 691


>gi|298241349|ref|ZP_06965156.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
 gi|297554403|gb|EFH88267.1| two component transcriptional regulator, LuxR family [Ktedonobacter
           racemifer DSM 44963]
          Length = 225

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 36/116 (31%), Positives = 57/116 (49%), Gaps = 9/116 (7%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           D L++ +  H++ ++ R  F   G    +A    EA    E  L P+ +++D  M G+  
Sbjct: 15  DHLVVREGLHMMLEIARGGFTWLG----DAADGAEAVRVVEA-LQPDVVLMDLRMPGMDG 69

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           LE I  +++      V +     E D   M+ G RAGA  +LLK  +RETL  A+R
Sbjct: 70  LEAITQIQEQWPHIAVIILTTYDEDDL--MLRGLRAGACGYLLKDTDRETLFHAIR 123


>gi|256829816|ref|YP_003158544.1| response regulator receiver protein [Desulfomicrobium baculatum DSM
           4028]
 gi|256578992|gb|ACU90128.1| response regulator receiver protein [Desulfomicrobium baculatum DSM
           4028]
          Length = 147

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 36/126 (28%), Positives = 62/126 (49%), Gaps = 7/126 (5%)

Query: 4   LLLVDSSHIVRK-VGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           LLL+D     R+ +G+ L  + G+ V  A S  EA +        +  ++D  M G+  +
Sbjct: 7   LLLIDDEDRFRETLGKRLM-ETGYNVSGAASGMEALDMLATNKF-DVAILDIQMPGMSGI 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E +A +R   +G +V +  L    D    + G R GA  +L+KP   E L   ++E  ++
Sbjct: 65  ETLAEIRAKHIGVEVIM--LTGHGDVSSAVEGMRLGAYDYLMKPCEYEYLVVKIQEAYKI 122

Query: 121 QKSKDE 126
           +K +DE
Sbjct: 123 KKDRDE 128


>gi|217969736|ref|YP_002354970.1| response regulator receiver protein [Thauera sp. MZ1T]
 gi|217507063|gb|ACK54074.1| response regulator receiver protein [Thauera sp. MZ1T]
          Length = 121

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 34/120 (28%), Positives = 59/120 (49%), Gaps = 9/120 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPNYLVIDE----SME 57
           ++L+VD S  +R+V        G+ V EA   C+ R+   K      +L+I +    +M+
Sbjct: 4   TVLIVDDSASLRQVVSLSLKGAGYQVIEA---CDGRDALGKLGGQKVHLIISDVNMPNMD 60

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+  F+  V++ P      V  L  E   EK   G  AGA ++++KPF  + +  A+ +L
Sbjct: 61  GI-AFVREVKKNPSYKFTPVIMLTTEAAEEKKRLGQEAGARAWVVKPFQPQQMLAAVSKL 119


>gi|149371968|ref|ZP_01891287.1| two-component response regulator [unidentified eubacterium SCB49]
 gi|149355108|gb|EDM43669.1| two-component response regulator [unidentified eubacterium SCB49]
          Length = 239

 Score = 40.4 bits (93), Expect = 0.073,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 62/123 (50%), Gaps = 6/123 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           LL+ D   I+  VG +L N+ G+ V  A +  E  E  +KE  P+ +++D     M+G+ 
Sbjct: 21  LLVDDEPDILEIVGYNLSNE-GYQVITAENGREGVEKAKKEK-PHLIILDVMMPEMDGI- 77

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R +P  ++  + +L    +    +AG  AGA+ ++ KP   + L   ++ L + 
Sbjct: 78  EACEKIRSIPELSETVITFLTARGEDYSQVAGFDAGADDYITKPIKPKILLSKVKALLRR 137

Query: 121 QKS 123
            KS
Sbjct: 138 FKS 140


>gi|261407257|ref|YP_003243498.1| winged helix family two component transcriptional regulator
           [Paenibacillus sp. Y412MC10]
 gi|261283720|gb|ACX65691.1| two component transcriptional regulator, winged helix family
           [Paenibacillus sp. Y412MC10]
          Length = 224

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 54/109 (49%), Gaps = 9/109 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPNYLVIDESM--E 57
           M  +L+VD    +RK+    F   G+ V  A    ++RE   K EL P+ +++D +M  E
Sbjct: 1   MHKILIVDDEADLRKLLTDYFEINGYFVMTAK---DSREAMRKVELGPDLVLLDINMPEE 57

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
             LE    +R         + +L   ++    IAG RAG + ++LKPF+
Sbjct: 58  SGLEICERIRGF---VSCPILFLTARIEDADKIAGFRAGGDDYILKPFS 103


>gi|163848766|ref|YP_001636810.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222526715|ref|YP_002571186.1| LuxR family two component transcriptional regulator [Chloroflexus
           sp. Y-400-fl]
 gi|163670055|gb|ABY36421.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222450594|gb|ACM54860.1| two component transcriptional regulator, LuxR family [Chloroflexus
           sp. Y-400-fl]
          Length = 218

 Score = 40.4 bits (93), Expect = 0.074,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 56/116 (48%), Gaps = 5/116 (4%)

Query: 3   SLLLVDSSHIVRKVGR---HLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           ++LL+D   +VR+  R    L  D   +V EA S  E  E   +ELLP+ +++D  M G+
Sbjct: 5   TVLLIDDHRVVRQGLRDFLELQPDIE-VVGEAGSGAEGVELA-RELLPDVVLMDLVMPGI 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
                  R   +     V  L    D +K+    +AGA S+LLK  + E L  A+R
Sbjct: 63  DGVETTRRLKAVSPSSQVIVLTSFADDDKVFPAIKAGAISYLLKDISPEDLAHAIR 118


>gi|307824890|ref|ZP_07655112.1| multi-sensor hybrid histidine kinase [Methylobacter tundripaludum
           SV96]
 gi|307733937|gb|EFO04792.1| multi-sensor hybrid histidine kinase [Methylobacter tundripaludum
           SV96]
          Length = 860

 Score = 40.4 bits (93), Expect = 0.076,   Method: Composition-based stats.
 Identities = 36/122 (29%), Positives = 58/122 (47%), Gaps = 7/122 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L+VD     R V   L +  GF + EA    EA E  +  + P+ +++D     M+G  
Sbjct: 657 VLIVDDVASNRAVLVDLLSPLGFGIIEACDGIEALELAQAAI-PDLILMDIVMPKMDG-- 713

Query: 61  EFIAHV-RQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           E + H+ RQ+P    V +  L             +AGAN+FL KP +++ L   M  L Q
Sbjct: 714 EEVTHLLRQLPALAQVPIIALSASASNADETKCLQAGANAFLPKPVDQDELLAQMAALMQ 773

Query: 120 MQ 121
           ++
Sbjct: 774 LE 775


>gi|239908931|ref|YP_002955673.1| response regulator receiver protein [Desulfovibrio magneticus RS-1]
 gi|239798798|dbj|BAH77787.1| response regulator receiver protein [Desulfovibrio magneticus RS-1]
          Length = 382

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 29/107 (27%), Positives = 46/107 (42%), Gaps = 3/107 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+VD   I  +    +  + GF    A S    R     E  P  +++D  M G    E
Sbjct: 17  ILIVDDETINVETLAWMLKEAGFTPLRAASGPAGRRMAADEQ-PELIILDIMMPGESGFE 75

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRE 108
             A +   P  TD+ + ++    D E  + G + GA  ++ KPF RE
Sbjct: 76  TCAKLTADPATTDIPIIFISGLDDVENKVRGLKLGAVDYITKPFARE 122


>gi|227328327|ref|ZP_03832351.1| chemotaxis regulatory protein CheY [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
          Length = 129

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALNKLRSGAF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLQTIRADGALSSLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|46202804|ref|ZP_00052574.2| COG0784: FOG: CheY-like receiver [Magnetospirillum magnetotacticum
           MS-1]
 gi|163849869|ref|YP_001637912.1| response regulator receiver [Methylobacterium extorquens PA1]
 gi|188579757|ref|YP_001923202.1| response regulator receiver protein [Methylobacterium populi BJ001]
 gi|218528500|ref|YP_002419316.1| response regulator receiver protein [Methylobacterium
           chloromethanicum CM4]
 gi|240137094|ref|YP_002961563.1| putative response regulator receiver (CheY-like protein)
           [Methylobacterium extorquens AM1]
 gi|254559106|ref|YP_003066201.1| response regulator receiver [Methylobacterium extorquens DM4]
 gi|163661474|gb|ABY28841.1| response regulator receiver [Methylobacterium extorquens PA1]
 gi|179343255|gb|ACB78667.1| response regulator receiver protein [Methylobacterium populi BJ001]
 gi|218520803|gb|ACK81388.1| response regulator receiver protein [Methylobacterium
           chloromethanicum CM4]
 gi|240007060|gb|ACS38286.1| putative response regulator receiver (CheY-like protein)
           [Methylobacterium extorquens AM1]
 gi|254266384|emb|CAX22148.1| putative response regulator receiver (CheY-like protein)
           [Methylobacterium extorquens DM4]
          Length = 127

 Score = 40.4 bits (93), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 33/111 (29%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+VD    + ++ R+L    GF   +  S   A     K      ++ D +ME +   E
Sbjct: 9   ILVVDDYQTMVRIIRNLLKQLGFEDVDDASDGTAALARLKGRKYGLVISDWNMEPMTGYE 68

Query: 62  FIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            + HVR    L T  F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 69  LLRHVRADEGLRTTPFIM-VTAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|330447435|ref|ZP_08311084.1| arcA transcriptional dual regulator [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328491626|dbj|GAA05581.1| arcA transcriptional dual regulator [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 239

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 4/115 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-DESMEGVLEF 62
           +L+V+  H+ R   + +F   G+ VFEA    E  +   +   P +LVI D ++ G    
Sbjct: 6   ILIVEDEHVTRNTLKSIFEAEGYTVFEANDGAEMHQMLSEN--PVHLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +   R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L
Sbjct: 64  LL-ARELREQGDMALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL 117


>gi|283785622|ref|YP_003365487.1| chemotaxis protein CheY [Citrobacter rodentium ICC168]
 gi|282949076|emb|CBG88682.1| chemotaxis protein CheY [Citrobacter rodentium ICC168]
          Length = 129

 Score = 40.4 bits (93), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF-GFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R   +   + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRADSVMASMPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|302343588|ref|YP_003808117.1| multi-sensor signal transduction histidine kinase [Desulfarculus
           baarsii DSM 2075]
 gi|301640201|gb|ADK85523.1| multi-sensor signal transduction histidine kinase [Desulfarculus
           baarsii DSM 2075]
          Length = 483

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 34/118 (28%), Positives = 55/118 (46%), Gaps = 15/118 (12%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--ELLPNYLVID---ESMEG 58
           +L+VD    +R+  R +    G +V EA +    RE  E+  +  P+ +++D     M+G
Sbjct: 9   ILVVDDEERIRQAVRRVLETMGMVVMEAAN---GREGLERIADYKPDLVLVDLMMPVMDG 65

Query: 59  VLEFIAHVRQ--MPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            +E I   R+    L   V   Y  +E   E M    + GA+ FL KPF  + LR  +
Sbjct: 66  -MEMIGRARKSHASLAFVVITGYATLEKAVEAM----KQGADDFLAKPFKPQELRLVI 118


>gi|293375811|ref|ZP_06622081.1| putative subtilin biosynthesis regulatory protein SpaR
           [Turicibacter sanguinis PC909]
 gi|325840818|ref|ZP_08167182.1| subtilin biosynthesis regulatory protein SpaR [Turicibacter sp.
           HGF1]
 gi|292645588|gb|EFF63628.1| putative subtilin biosynthesis regulatory protein SpaR
           [Turicibacter sanguinis PC909]
 gi|325490188|gb|EGC92525.1| subtilin biosynthesis regulatory protein SpaR [Turicibacter sp.
           HGF1]
          Length = 226

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 7/110 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD    + ++     ND G++V++A++  EAR   + ++ P+ +++D  M G    E
Sbjct: 5   ILVVDDDLEILEMLYDALNDEGYLVYKASNSFEARS--QLKVNPDLMILDVMMPGQDGFE 62

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           F   +R +     +F+   + E D   +I G   G + +L KPF+   LR
Sbjct: 63  FCKEIRSVVSCPIIFLTAKVSESD---LIQGFAIGGDDYLTKPFSLRELR 109


>gi|148240584|ref|YP_001225971.1| two-component system response regulator [Synechococcus sp. WH 7803]
 gi|147849123|emb|CAK24674.1| Two-component system response regulator [Synechococcus sp. WH 7803]
          Length = 248

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 56/114 (49%), Gaps = 2/114 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           +++L+VD    +R++     +  G+ V  A    EA E C +E  P+ +V+D  M   L+
Sbjct: 9   ETILVVDDEASIRRILETRLSMIGYNVVTACDGTEALE-CFQECEPDLVVLDVMMPK-LD 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
                +++   +DV +  L    D    I G   GA+ +++KPF+ + L   +R
Sbjct: 67  GYGVCQELRKESDVPIVMLTALGDVADRITGLELGADDYVIKPFSPKELEARIR 120


>gi|320352609|ref|YP_004193948.1| Fis family two component sigma54 specific transcriptional regulator
           [Desulfobulbus propionicus DSM 2032]
 gi|320121111|gb|ADW16657.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Desulfobulbus propionicus DSM 2032]
          Length = 455

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 35/116 (30%), Positives = 50/116 (43%), Gaps = 5/116 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD +   R+V      D G+MV    SV EA    E  +  + ++ D  M     LE
Sbjct: 14  ILVVDDAEDAREVIHTHLEDAGYMVRTCASVAEALLAVESSVF-DIIITDLRMPKASGLE 72

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            I HVR      D+ V  +      E  I   + GA  +L KPF    L  A+R +
Sbjct: 73  LIQHVRNTL--EDIEVMMITGYPSIEGAIEAIKTGAEHYLPKPFTERELLEAVRAI 126


>gi|315123064|ref|YP_004065070.1| response regulator [Pseudoalteromonas sp. SM9913]
 gi|315016824|gb|ADT70161.1| response regulator [Pseudoalteromonas sp. SM9913]
          Length = 192

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 53/109 (48%), Gaps = 4/109 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L++D    VR V + +    GF V EA    EA     +   P  + +D SM G+  +E
Sbjct: 69  VLIIDDEANVRSVIKRVLKRSGFDVVEAAGGFEAGTLMHQRK-PELITVDLSMPGLSGIE 127

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            I  +R      D+ V  ++  +   ++I    AGA+ ++ KPF+ +TL
Sbjct: 128 VIRFIRSCEEFKDIKVL-VISGMPETQLIDAVNAGADGYICKPFSNDTL 175


>gi|289209556|ref|YP_003461622.1| CheA signal transduction histidine kinase [Thioalkalivibrio sp.
            K90mix]
 gi|288945187|gb|ADC72886.1| CheA signal transduction histidine kinase [Thioalkalivibrio sp.
            K90mix]
          Length = 1832

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 5/105 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
            +++VD S  +RKV   L    G+ V  A    +A    E E  P  +++D     M+G  
Sbjct: 1712 IMVVDDSITIRKVTARLLARHGYDVVTARDGLDAVTMLE-ERRPQLILLDVEMPRMDG-F 1769

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
            EF AHVR  P  + V +  +      +     +R G N +L KP+
Sbjct: 1770 EFAAHVRDHPELSQVPIIMITSRSGTKHRERASRLGVNGYLGKPY 1814


>gi|219851955|ref|YP_002466387.1| multi-sensor signal transduction histidine kinase [Methanosphaerula
           palustris E1-9c]
 gi|219546214|gb|ACL16664.1| multi-sensor signal transduction histidine kinase [Methanosphaerula
           palustris E1-9c]
          Length = 576

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 59/117 (50%), Gaps = 5/117 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +++V+ S   ++  R++    G+ VF AT+  +A +    E+ P+ L+ D     M G  
Sbjct: 14  VVIVEDSPTQQEYLRYILEKHGYTVFAATNGQQALDLI-GEVRPDLLISDVIMPVMNG-Y 71

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +    ++  P   ++ V  L    D + +    ++GA++F+ KP+N E L   +R++
Sbjct: 72  DLCRAIKSDPASQEIPVILLTALSDTKDVALALQSGADNFITKPYNEEYLILRIRQI 128


>gi|27382590|ref|NP_774119.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
 gi|27355762|dbj|BAC52744.1| two-component response regulator [Bradyrhizobium japonicum USDA
           110]
          Length = 131

 Score = 40.4 bits (93), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 33/124 (26%), Positives = 59/124 (47%), Gaps = 5/124 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+VD    + ++ R+L    GF   +  S   A     +      ++ D +ME +   +
Sbjct: 9   VLVVDDYSTMIRIIRNLLKQLGFENIDDASDGSAALNKMRGKKYGLVISDWNMEPMTGYD 68

Query: 62  FIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL-PQ 119
            +  VR  P L T  F+  +  E   E +IA  +AG N++++KPFN  TL+  +  + P 
Sbjct: 69  LLREVRADPNLATTPFIM-ITAESKTENVIAAKKAGVNNYIVKPFNAATLKTKIEAVFPD 127

Query: 120 MQKS 123
           M  +
Sbjct: 128 MASA 131


>gi|310659355|ref|YP_003937076.1| response regulator receiver:metal-dependent phosphohydrolase, hd
           subdomain [Clostridium sticklandii DSM 519]
 gi|308826133|emb|CBH22171.1| Response regulator receiver:Metal-dependent phosphohydrolase, HD
           subdomain [Clostridium sticklandii]
          Length = 332

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 26/129 (20%), Positives = 59/129 (45%), Gaps = 3/129 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+ D   I RK+      + G+ V  A    EA++  E E  P+ ++ D +M  +  ++
Sbjct: 3   ILVADDEAINRKLLEIEVKELGYKVLTAKDGYEAKQIWENE-RPSIVLTDWNMPNMNGID 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            + H+R        ++  +      + +I G  AG + +L KP  +  L + ++   ++ 
Sbjct: 62  LVKHIRNNEGNDYTYIIMVTAMAREDDLIVGFEAGVDDYLTKPVGKHELYWRLKAGLRLI 121

Query: 122 KSKDENQFL 130
            + D++  +
Sbjct: 122 SNNDKDMLI 130


>gi|291326201|ref|ZP_06123556.2| nitrate/nitrite response regulator protein NarL [Providencia
           rettgeri DSM 1131]
 gi|291315361|gb|EFE55814.1| nitrate/nitrite response regulator protein NarL [Providencia
           rettgeri DSM 1131]
          Length = 212

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 32/121 (26%), Positives = 60/121 (49%), Gaps = 3/121 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFN-DFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           ++++VD   ++R   R L N D  F+V   +S C       ++L PN ++ID +++G+  
Sbjct: 11  TVMIVDEHPLIRLGLRQLINTDTHFIVTAESSCCYEALSIARQLQPNLIIIDTNIQGIKT 70

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGA-RAGANSFLLKPFNRETLRFAMRELPQM 120
           F   +R +    +     +L     +  I GA  AGA  +LLK    + L ++M++  + 
Sbjct: 71  F-ETIRLLRKHCNNSYLLVLSASTIKTDIYGAIDAGAQGYLLKSSELDMLFYSMKKASRG 129

Query: 121 Q 121
           Q
Sbjct: 130 Q 130


>gi|254523795|ref|ZP_05135850.1| chemotaxis protein CheY [Stenotrophomonas sp. SKA14]
 gi|219721386|gb|EED39911.1| chemotaxis protein CheY [Stenotrophomonas sp. SKA14]
          Length = 130

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLP----NYLVIDESMEG 58
           +L+VD    +R++ ++L  D GF     T+  EA +      LL     +++V D +M  
Sbjct: 7   ILIVDDFSTMRRIVKNLLGDLGF-----TNTAEAEDGHAALSLLQSQPFDFVVTDWNMPV 61

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +E +  +R       + V  +  E   E++I  A++G N +++KPF  +TL
Sbjct: 62  MTGIELLKAIRADAKLKTLPVLMVTAEAKREQIIEAAQSGVNGYIIKPFTAQTL 115


>gi|113477889|ref|YP_723950.1| two component LuxR family transcriptional regulator [Trichodesmium
           erythraeum IMS101]
 gi|110168937|gb|ABG53477.1| two component transcriptional regulator, LuxR family [Trichodesmium
           erythraeum IMS101]
          Length = 233

 Score = 40.4 bits (93), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +LLVD    +R+  +    D  F V  A++  E  +  EK L P+ ++ D  M  V   +
Sbjct: 8   ILLVDDEPGLREAVQAYLEDSHFNVDVASNANEGWDILEKNL-PDLVITDVMMPQVDGYQ 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+  +R+ P    + V +L  +      I G +AG +++L KPF+ E L
Sbjct: 67  FLQKLREEPRFKALPVVFLTAKGMTTDRIQGYQAGCDAYLSKPFDPEEL 115


>gi|311695192|gb|ADP98065.1| response regulator receiver domain protein (CheY-) [marine
           bacterium HP15]
          Length = 127

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 16/118 (13%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLP-------NYLVIDES 55
            +L+VD    +R++ ++L  D GF     T+  EA +      LP       ++LV D +
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----TNTDEADD--GNTALPMLKSGKYDFLVTDWN 58

Query: 56  MEGVLEF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           M G+  F  +  VR       + V  +  E   ++++A A+AG N +++KPF    L+
Sbjct: 59  MPGMSGFDLLKAVRADENLKTLPVLMVTAEAKRDQIVAAAQAGVNGYVVKPFTAAVLK 116


>gi|294635418|ref|ZP_06713908.1| phosphate regulon transcriptional regulatory protein PhoB
           [Edwardsiella tarda ATCC 23685]
 gi|291091207|gb|EFE23768.1| phosphate regulon transcriptional regulatory protein PhoB
           [Edwardsiella tarda ATCC 23685]
          Length = 237

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 54/110 (49%), Gaps = 5/110 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV--L 60
           +L+V+    +R++   +    G+   EA S   A    CE    P+ +++D  + G   +
Sbjct: 13  ILVVEDETPIREMVSFVLEQNGYQPLEAESYDGALSRLCEP--YPDLILLDWMLPGGSGI 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + I H+++ P   D+ V  L    + E  + G   GA+ +++KPF+ + L
Sbjct: 71  QLIKHLKREPATRDIPVMMLTARGEEEDRVRGLEVGADDYIIKPFSPKEL 120


>gi|261209996|ref|ZP_05924295.1| chemotaxis regulator CheY [Vibrio sp. RC341]
 gi|260840942|gb|EEX67479.1| chemotaxis regulator CheY [Vibrio sp. RC341]
          Length = 126

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +K    +++V D +M G+  
Sbjct: 6   KILIVDDFSTMRRIVKNLLRDLGFNNTQEADDGLTALPMLKKGEF-DFVVTDWNMPGMQG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ + ++R       + V  +  E   E++I  A+AG N +++KPF    L+
Sbjct: 65  IDLLKNIRADEELKHLPVLMITAEAKREQIIEAAQAGVNGYIVKPFTAAMLK 116


>gi|148259863|ref|YP_001233990.1| two component transcriptional regulator [Acidiphilium cryptum JF-5]
 gi|326403209|ref|YP_004283290.1| two component transcriptional regulator [Acidiphilium multivorum
           AIU301]
 gi|146401544|gb|ABQ30071.1| two component transcriptional regulator, winged helix family
           [Acidiphilium cryptum JF-5]
 gi|325050070|dbj|BAJ80408.1| two component transcriptional regulator [Acidiphilium multivorum
           AIU301]
          Length = 231

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 37/116 (31%), Positives = 55/116 (47%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLE 61
           +LLVD    +R + +    + GF V  A S   ARE   + + P+ +V+D  M  E  LE
Sbjct: 8   ILLVDDDARLRALMQRYLVENGFRVTVAESAAAARETL-RVVDPDMMVLDVMMPEETGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            I  +R      D+ +  L      E  IAG  AGA+ +L KPF+   L   +R +
Sbjct: 67  LIESLRA-DRAPDLPILLLTARGAPEDRIAGFEAGADDYLGKPFDPRELLLRIRAM 121


>gi|146277832|ref|YP_001167991.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17025]
 gi|145556073|gb|ABP70686.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17025]
          Length = 122

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 5/118 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L +D S  +R++ R      GF V  A    +  E  +  + PN ++ D     M+G 
Sbjct: 4   TILAIDDSRTIRELLREALVRAGFQVHLAIDGVDGLEKLDA-VRPNAVITDINMPRMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             FI  VR  P  + + +  L  E   E       AGA ++++KPF+   L  A+R +
Sbjct: 62  FGFIRAVRAQPEQSALPIIVLTTESAAELKSRAREAGATAWIVKPFDEAKLVSALRRV 119


>gi|296135656|ref|YP_003642898.1| response regulator receiver protein [Thiomonas intermedia K12]
 gi|295795778|gb|ADG30568.1| response regulator receiver protein [Thiomonas intermedia K12]
          Length = 162

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM---VFEATSVCEAREFCEKELLPNYLVIDESM---EG 58
           L+VD    +R++ R L    G++   + EA +  EA    +   +  ++V D +M   +G
Sbjct: 32  LVVDDFPTMRRIVRGLLMQTGYVTGNIDEAENGEEAWRRLQAGGI-EFVVTDWNMPVMQG 90

Query: 59  VLEFIAHVRQM--PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + + + H+R    P    + V  +  E   E +IA A+AG N +++KPF  +TL+
Sbjct: 91  I-DLLKHIRASDNPAIRSLPVLMVTAEAKKENIIAAAQAGVNGYIVKPFTAQTLK 144


>gi|194365638|ref|YP_002028248.1| response regulator receiver protein [Stenotrophomonas maltophilia
           R551-3]
 gi|194348442|gb|ACF51565.1| response regulator receiver protein [Stenotrophomonas maltophilia
           R551-3]
          Length = 126

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 57/114 (50%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLP----NYLVIDESMEG 58
           +L+VD    +R++ ++L  D GF     T+  EA +      LL     +++V D +M  
Sbjct: 3   ILIVDDFSTMRRIVKNLLGDLGF-----TNTAEAEDGHAALSLLQSQPFDFVVTDWNMPV 57

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +E +  +R       + V  +  E   E++I  A++G N +++KPF  +TL
Sbjct: 58  MTGIELLKAIRADAKLKTLPVLMVTAEAKREQIIEAAQSGVNGYIIKPFTAQTL 111


>gi|78223121|ref|YP_384868.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter metallireducens GS-15]
 gi|78194376|gb|ABB32143.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter metallireducens GS-15]
          Length = 459

 Score = 40.4 bits (93), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 54/114 (47%), Gaps = 7/114 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFC---EKELLPNYLVIDESME 57
           MD +L+V+     R++   L  + G+ V   TS   A E     + +L+   LVI   M 
Sbjct: 1   MDKILVVEDDRFFRQMYVDLLKEDGYEVDTVTSGARALELLSANDYQLVITELVI-PGMS 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G+ E +  V+Q     DV +  +    + E  +   ++GA  +LLKPFN E  +
Sbjct: 60  GI-ELLTRVKQQMPTVDVIL--VTGHANVESAVLALKSGARDYLLKPFNHEEFK 110


>gi|114570709|ref|YP_757389.1| response regulator receiver protein [Maricaulis maris MCS10]
 gi|114341171|gb|ABI66451.1| response regulator receiver protein [Maricaulis maris MCS10]
          Length = 162

 Score = 40.4 bits (93), Expect = 0.081,   Method: Compositional matrix adjust.
 Identities = 39/114 (34%), Positives = 53/114 (46%), Gaps = 8/114 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           ++LLVD S  VR V R L N  GF  VFEA    EA     +   P+  ++D  +     
Sbjct: 23  TVLLVDDSRPVRGVIRTLLNGIGFARVFEAADGDEALVLA-RTCRPDLALVDYDLGQATG 81

Query: 60  LEFIAHVRQMPL--GTDVFVYYLLMEVDFEKMIAGAR-AGANSFLLKPFNRETL 110
           L+    +R  PL         +LL    F  ++ GAR AG ++ L KP N  TL
Sbjct: 82  LDLARRLRD-PLQCARPDLPVFLLAADGFAHLVRGARAAGVSAVLPKPVNPRTL 134


>gi|325270713|ref|ZP_08137308.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           multiformis DSM 16608]
 gi|324986959|gb|EGC18947.1| DNA-binding response regulator/sensor histidine kinase [Prevotella
           multiformis DSM 16608]
          Length = 954

 Score = 40.4 bits (93), Expect = 0.082,   Method: Composition-based stats.
 Identities = 22/76 (28%), Positives = 43/76 (56%), Gaps = 2/76 (2%)

Query: 44  ELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFL 101
           +L+P+ ++ D  M G+  LE    VR   +   + +  +  ++  E+ I G  AGA++++
Sbjct: 744 DLMPDLIITDLMMPGMDGLEVCRQVRGNEIINHIPIIVVTAKITEEERIRGLEAGADAYI 803

Query: 102 LKPFNRETLRFAMREL 117
           +KPFN + LR  + +L
Sbjct: 804 VKPFNADELRTRVEKL 819


>gi|285018162|ref|YP_003375873.1| chemotaxis response regulator chey protein [Xanthomonas albilineans
           GPE PC73]
 gi|283473380|emb|CBA15885.1| probable chemotaxis response regulator chey protein [Xanthomonas
           albilineans]
          Length = 130

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 56/114 (49%), Gaps = 12/114 (10%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE----FCEKELLP-NYLVIDESMEG 58
           +L+VD    +R++ ++L  D GF     T+  EA +           P  ++V D +M G
Sbjct: 7   ILIVDDFSTMRRIVKNLLGDLGF-----TNTAEAEDGNSALAALRSAPFEFVVTDWNMPG 61

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  ++ + ++R       + V  +  E   E++I  A+ G N +++KPF  +TL
Sbjct: 62  MTGIDLLRNIRGDDKLKHLPVLMVTAEAKREQIIEAAQCGVNGYIIKPFTAQTL 115


>gi|89900556|ref|YP_523027.1| response regulator receiver modulated PAS/PAC sensor-containing
           diguanylate cyclase/phosphodiesterase [Rhodoferax
           ferrireducens T118]
 gi|89345293|gb|ABD69496.1| response regulator receiver modulated diguanylate
           cyclase/phosphodiesterase with PAS/PAC sensor(s)
           [Rhodoferax ferrireducens T118]
          Length = 716

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 43/85 (50%), Gaps = 4/85 (4%)

Query: 47  PNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKP 104
           P  +V+D  M G+  +E +  +R  P  +D+ V  L  +   +  IAG   GAN +L+KP
Sbjct: 57  PKLVVLDVKMPGMSGIEVLRRMRDDPHTSDIPVILLSADASEQSEIAGLHLGANDYLVKP 116

Query: 105 FNRETLRFAMRELPQMQKSKDENQF 129
            +   L   +R L  +Q++ D  Q 
Sbjct: 117 VSTNVLIVRVRNL--IQRNADRIQL 139


>gi|300790130|ref|YP_003770421.1| two-component system response regulator [Amycolatopsis mediterranei
           U32]
 gi|299799644|gb|ADJ50019.1| two-component system response regulator [Amycolatopsis mediterranei
           U32]
          Length = 233

 Score = 40.4 bits (93), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 54/110 (49%), Gaps = 8/110 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    VR V R      GF V  A +  E   +F   E  P+ +V+D  M G+  L
Sbjct: 8   VLVVDDDETVRDVVRRYLEVAGFTVDVAGNGAEGLAKFGAHE--PDLVVLDVMMPGINGL 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E    +RQ+   + V +  L    + E  IAG + GA+ ++ KPF+ + L
Sbjct: 66  EVCKRLRQV---SQVPIVMLTALGEEENRIAGLQLGADDYVTKPFSPKEL 112


>gi|171317083|ref|ZP_02906287.1| two component transcriptional regulator, winged helix family
           [Burkholderia ambifaria MEX-5]
 gi|171097784|gb|EDT42608.1| two component transcriptional regulator, winged helix family
           [Burkholderia ambifaria MEX-5]
          Length = 225

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 56/115 (48%), Gaps = 11/115 (9%)

Query: 1   MDSLLLVDSSHIV-RKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI--DESME 57
           M S+L+++   IV   +  HL  D GF V     V + RE   + L   Y V+  D  + 
Sbjct: 1   MPSVLIIEDDEIVAHDMATHL-KDRGFGV---EWVPDGREGLARALSRQYDVVTLDRMLP 56

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           G+  L  +  +R + + T V +   L +VD    + G RAG + +L KPF+ E L
Sbjct: 57  GIDGLTIVTTMRSVGVRTPVLMVSALSDVD--NRVGGLRAGGDDYLTKPFDPEEL 109


>gi|46908754|ref|YP_015143.1| DNA-binding response regulator [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|254854409|ref|ZP_05243757.1| DNA-binding response regulator [Listeria monocytogenes FSL R2-503]
 gi|300766082|ref|ZP_07076050.1| DNA-binding response regulator [Listeria monocytogenes FSL N1-017]
 gi|46882026|gb|AAT05320.1| DNA-binding response regulator [Listeria monocytogenes serotype 4b
           str. F2365]
 gi|258607809|gb|EEW20417.1| DNA-binding response regulator [Listeria monocytogenes FSL R2-503]
 gi|300513228|gb|EFK40307.1| DNA-binding response regulator [Listeria monocytogenes FSL N1-017]
          Length = 225

 Score = 40.4 bits (93), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 52/118 (44%), Gaps = 3/118 (2%)

Query: 1   MDSLLLVDSS-HIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M  +L+VD   HI++ VG H     GF V EA    EA +  E E + +  VID  M  +
Sbjct: 1   MKQILVVDDDRHILKLVG-HYLRAEGFRVLEANDGVEAEKIVETEQV-HLAVIDVMMPNM 58

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             F    +     TD+ V  L  +        G   G + ++ KPF  E L F +R L
Sbjct: 59  DGFELCKKMRTSYTDIPVIMLTAKDALADKSRGFEVGTDDYVTKPFEPEELIFRIRAL 116


>gi|329924862|ref|ZP_08279811.1| subtilin biosynthesis regulatory protein SpaR [Paenibacillus sp.
           HGF5]
 gi|328940359|gb|EGG36686.1| subtilin biosynthesis regulatory protein SpaR [Paenibacillus sp.
           HGF5]
          Length = 224

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 53/108 (49%), Gaps = 7/108 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EG 58
           M  +L+VD    +RK+    F   G+ V  A +  EA +  E+   P+ +++D +M  E 
Sbjct: 1   MHKILIVDDEADLRKLLTDYFEINGYFVMTAKNSREAMQKVEQG--PDLVLLDINMPEEN 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            LE    +R         + +L   ++    IAG RAG + ++LKPF+
Sbjct: 59  GLEICERIRGF---VSCPILFLTARIEDADKIAGFRAGGDDYILKPFS 103


>gi|296120947|ref|YP_003628725.1| response regulator receiver [Planctomyces limnophilus DSM 3776]
 gi|296013287|gb|ADG66526.1| response regulator receiver [Planctomyces limnophilus DSM 3776]
          Length = 337

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 54/115 (46%), Gaps = 5/115 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-DESMEGV--L 60
           +L+VD   ++ ++  H     G+ V  A +   A E   +E  P  LVI D  M G+  +
Sbjct: 3   ILIVDDDDMILEMLEHTLVPAGYEVLRAHNGTTALEILSQE--PCRLVISDWDMPGMSGI 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           +    VR     + V+V  L      E ++ G  AGA+ F+ KPF+ E L   +R
Sbjct: 61  DLCRAVRSQDFVSYVYVLLLTSHNSRESLVEGMIAGADDFVNKPFDPEELLVRLR 115


>gi|311114543|ref|YP_003985764.1| response regulator [Gardnerella vaginalis ATCC 14019]
 gi|310946037|gb|ADP38741.1| response regulator [Gardnerella vaginalis ATCC 14019]
          Length = 250

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+++VD    +R++     +  GF V  A S  EA +  E+ + P+ +V+D  +  +  F
Sbjct: 12  SIVVVDDEPSIRELLVASLHFAGFDVETAASGSEAIDVIER-VHPDLIVMDVMLPDIDGF 70

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V +L    D +  I G   G + ++ KPF+ E +   +R + +  +
Sbjct: 71  TVTRRIRQNGVAVPVLFLTARDDTQDKIMGLTVGGDDYVTKPFSLEEVVARIRAILRRTQ 130

Query: 123 SKDEN 127
             DE+
Sbjct: 131 DPDED 135


>gi|167746905|ref|ZP_02419032.1| hypothetical protein ANACAC_01617 [Anaerostipes caccae DSM 14662]
 gi|167653865|gb|EDR97994.1| hypothetical protein ANACAC_01617 [Anaerostipes caccae DSM 14662]
          Length = 223

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 33/132 (25%), Positives = 61/132 (46%), Gaps = 2/132 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+    + +   +     G+ ++ A SVCEA+    +E +   L+     +G  
Sbjct: 1   MQKILIVEDDRELNRTICYALKKEGYDIYSAYSVCEAKAIYRQEKMELILLDVNLPDG-- 58

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E  +  R M    +V V +L      E  + G  +GA  ++ KPF+   L+  +R + + 
Sbjct: 59  EGFSLCRWMKGQREVPVLFLTARDLEEDALEGYGSGAEDYITKPFSIRILKEKIRVVLKR 118

Query: 121 QKSKDENQFLDA 132
           +K+  EN F D 
Sbjct: 119 EKTGRENFFDDG 130


>gi|67921315|ref|ZP_00514834.1| Response regulator receiver [Crocosphaera watsonii WH 8501]
 gi|67857432|gb|EAM52672.1| Response regulator receiver [Crocosphaera watsonii WH 8501]
          Length = 122

 Score = 40.4 bits (93), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 50/118 (42%), Gaps = 2/118 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EG 58
           M ++L+VD ++  RK+   L    GF      S   A E+ E    P+ +++D  M  E 
Sbjct: 1   MKTILVVDDTNAQRKLISALLTHAGFETANVESAKLAWEWLENNDFPDLIILDIIMPEET 60

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
            LE    +R  P   D+ + +   + +          G N ++ KPF    L  A+ +
Sbjct: 61  GLELCRKIRANPKWKDIPIVFCSSKSEEFDRFWALHQGGNDYITKPFAPNELIHAVSK 118


>gi|308234693|ref|ZP_07665430.1| response regulator receiver domain protein [Gardnerella vaginalis
           ATCC 14018]
          Length = 246

 Score = 40.4 bits (93), Expect = 0.085,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 59/125 (47%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+++VD    +R++     +  GF V  A S  EA +  E+ + P+ +V+D  +  +  F
Sbjct: 8   SIVVVDDEPSIRELLVASLHFAGFDVETAASGSEAIDVIER-VHPDLIVMDVMLPDIDGF 66

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V +L    D +  I G   G + ++ KPF+ E +   +R + +  +
Sbjct: 67  TVTRRIRQNGVAVPVLFLTARDDTQDKIMGLTVGGDDYVTKPFSLEEVVARIRAILRRTQ 126

Query: 123 SKDEN 127
             DE+
Sbjct: 127 DPDED 131


>gi|219848730|ref|YP_002463163.1| response regulator receiver modulated diguanylate cyclase
           [Chloroflexus aggregans DSM 9485]
 gi|219542989|gb|ACL24727.1| response regulator receiver modulated diguanylate cyclase
           [Chloroflexus aggregans DSM 9485]
          Length = 941

 Score = 40.4 bits (93), Expect = 0.085,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD S ++ +V        G  V   T   EA      E  P+ +++D  M G    
Sbjct: 254 TVLIVDDSPLMAEVYALALRAAGMQVIATTDPLEAPTLL-AEQQPDLILLDVYMPGCSGQ 312

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E  A +RQ P    + + +L  E D    +A    G + FL KP N E L  A+    Q 
Sbjct: 313 ELAAVIRQQPEYHSIPIVFLSGETDRSAQLAALARGGDDFLTKPINLEHLVAAVSSRIQR 372

Query: 121 QKS 123
            ++
Sbjct: 373 ARA 375


>gi|255305139|ref|ZP_05349311.1| two-component response regulator [Clostridium difficile ATCC 43255]
          Length = 231

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 66/131 (50%), Gaps = 4/131 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           +L+VD    + ++ + +F   GF  V  A+S   A + CE E  P+ +++D  M G+  F
Sbjct: 6   ILVVDDETDLLEMVKSIFTRAGFTQVLTASSGEAALKMCE-EQEPDMMILDVMMPGMDGF 64

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE-LPQMQ 121
            A ++++   + + V  L    + E    G   GA+ +LLKPF  + L F ++  L ++ 
Sbjct: 65  -AALKELRKTSKIPVLMLTARGEAEDKFVGFENGADDYLLKPFLPKELLFRVQAILKRVY 123

Query: 122 KSKDENQFLDA 132
             K+   F DA
Sbjct: 124 PEKERKVFFDA 134


>gi|160877438|ref|YP_001556754.1| response regulator receiver modulated diguanylate cyclase
           [Shewanella baltica OS195]
 gi|160862960|gb|ABX51494.1| response regulator receiver modulated diguanylate cyclase
           [Shewanella baltica OS195]
 gi|315269640|gb|ADT96493.1| response regulator receiver modulated diguanylate cyclase
           [Shewanella baltica OS678]
          Length = 310

 Score = 40.4 bits (93), Expect = 0.086,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 62/128 (48%), Gaps = 15/128 (11%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+VD   +  K+   LFN+  + +F AT+  +A   C+K + P+ +++D  M G+  F 
Sbjct: 17  ILIVDDQPLNIKILHQLFNE-EYELFMATNGEQAIAICQK-VQPDLVLLDIEMPGMSGFD 74

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
              H++  P    + V ++    D  + + G + GA  F+ KP N           P + 
Sbjct: 75  VCQHIKADPETATIGVIFVTAHFDEVQEVKGFQLGAVDFIHKPIN-----------PIIT 123

Query: 122 KSKDENQF 129
            ++ +NQF
Sbjct: 124 TARVKNQF 131


>gi|332526414|ref|ZP_08402536.1| chemotaxis signal transduction protein CheY [Rubrivivax
           benzoatilyticus JA2]
 gi|332110546|gb|EGJ10869.1| chemotaxis signal transduction protein CheY [Rubrivivax
           benzoatilyticus JA2]
          Length = 120

 Score = 40.4 bits (93), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S+L VD S  +R++      + GF V EA    +A E   +    N ++ D++M  + 
Sbjct: 1   MHSILAVDDSASMRQMVSFTLKNAGFHVVEAVDGQDAYEKANQRDF-NLVLTDQNMPRMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +     +R+ P      +  L  E   +   AG  AGA  +L+KPF+   L
Sbjct: 60  GISLTKKLRENPKFKSTPILILTTESSDQMKQAGRAAGATGWLVKPFDPAKL 111


>gi|157834751|pdb|2CHY|A Chain A, Three-Dimensional Structure Of Chey, The Response
           Regulator Of Bacterial Chemotaxis
          Length = 128

 Score = 40.4 bits (93), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 8   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF-GFIICDWNMPNMDGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 67  LLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 115


>gi|332531139|ref|ZP_08407053.1| response regulator receiver domain-containing protein [Hylemonella
           gracilis ATCC 19624]
 gi|332039424|gb|EGI75836.1| response regulator receiver domain-containing protein [Hylemonella
           gracilis ATCC 19624]
          Length = 120

 Score = 40.4 bits (93), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 50/105 (47%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +RK+        G+ V EA    EA E  +++ + + ++ D++M  +  L 
Sbjct: 4   ILAVDDSPSMRKMVAFTLTGAGYQVVEAADGQEALEKAQQQHV-DLVLTDQNMPRLDGLG 62

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            I  +R  P   D  +  L  E       AG  AGA  +L+KPF+
Sbjct: 63  LIRKLRADPKYKDTPILMLTTESSDLMKEAGKTAGATGWLVKPFD 107


>gi|114705527|ref|ZP_01438430.1| response regulator receiver domain protein [Fulvimarina pelagi
           HTCC2506]
 gi|114538373|gb|EAU41494.1| response regulator receiver domain protein [Fulvimarina pelagi
           HTCC2506]
          Length = 122

 Score = 40.4 bits (93), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 27/104 (25%), Positives = 52/104 (50%), Gaps = 2/104 (1%)

Query: 8   DSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME-GVL-EFIAH 65
           D   IVRK+   +    G+ V  A ++ EA     ++ +P+  ++  + E G L   +  
Sbjct: 3   DEMPIVRKIAERILAKAGYEVCLAETLEEAEARIVQDGVPDLAILSSTGERGDLPTLVRA 62

Query: 66  VRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRET 109
           +R+   G +  +   ++E +   ++   RAGAN  L+KPF+ E+
Sbjct: 63  IREERGGKNPVILIAIVERNIGALMRFRRAGANGILMKPFDAES 106


>gi|77463001|ref|YP_352505.1| putative chemotaxis response regulator, CheY5 [Rhodobacter
           sphaeroides 2.4.1]
 gi|126461875|ref|YP_001042989.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|332557877|ref|ZP_08412199.1| CheY5 [Rhodobacter sphaeroides WS8N]
 gi|7532753|emb|CAB87128.1| chemotaxis response regulator [Rhodobacter sphaeroides]
 gi|77387419|gb|ABA78604.1| putative Chemotaxis response regulator, CheY5 [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103539|gb|ABN76217.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|332275589|gb|EGJ20904.1| CheY5 [Rhodobacter sphaeroides WS8N]
          Length = 122

 Score = 40.4 bits (93), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 52/110 (47%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L VD S  VR++ R      G+ V EA    +A E    +   + ++ D++M  +  +
Sbjct: 4   TILAVDDSPSVRQMVRLTLVGAGYTVVEAVDGQDALEKATAQRF-DAILTDQNMPRLDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            FI   R +P G  V + +L  E           AGA  +++KPF++  L
Sbjct: 63  GFIRKFRTLPEGKGVPIVFLSTESQDTLKAQAKEAGAIGWMIKPFDQAQL 112


>gi|330720205|gb|EGG98586.1| Phosphate regulon transcriptional regulatory protein PhoB [gamma
           proteobacterium IMCC2047]
          Length = 139

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 48/104 (46%), Gaps = 3/104 (2%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLEF 62
           L+VD    VR V R +    G  V EA    +A +  EKE  P+ +V+D  M  +  L+ 
Sbjct: 13  LIVDDDTTVRIVMRSVLESHGIRVNEAEDGEKALQSFEKET-PDIIVLDIEMPVKDGLQV 71

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            A +R+ P G  + +  +    D + +     AGA    +KP N
Sbjct: 72  CAEIRRHPKGQFIPIIIITGVDDTDTIKRAYEAGATDLAVKPIN 115


>gi|295085734|emb|CBK67257.1| Signal transduction histidine kinase [Bacteroides xylanisolvens XB1A]
          Length = 1311

 Score = 40.4 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 31/135 (22%), Positives = 61/135 (45%), Gaps = 14/135 (10%)

Query: 2    DSLLLVDS----SHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
            ++LL+V+      H +R+   HL+             C A E+      P+ ++ D  M 
Sbjct: 1040 NTLLIVEDHETLRHYLRQTFEHLYRVIDVADGHEAIACLANEY------PDIILSDVMMP 1093

Query: 58   GVL--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            G+   E    V++ P  + + V  L  + + E ++ G + GA+ ++ KPF+ E L+  ++
Sbjct: 1094 GIRGDELCRMVKENPDTSGIPVVLLTAKANHEAIVEGLKKGADDYIPKPFSTEILK--LK 1151

Query: 116  ELPQMQKSKDENQFL 130
            E   +     + QF 
Sbjct: 1152 EQGLIDNRNRQRQFF 1166


>gi|227112510|ref|ZP_03826166.1| chemotaxis regulatory protein CheY [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
          Length = 129

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALNKLRAGAF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLQTIRADGALSSLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|197106694|ref|YP_002132071.1| chemotaxis protein CheYII [Phenylobacterium zucineum HLK1]
 gi|196480114|gb|ACG79642.1| chemotaxis protein CheYII [Phenylobacterium zucineum HLK1]
          Length = 128

 Score = 40.4 bits (93), Expect = 0.088,   Method: Compositional matrix adjust.
 Identities = 33/114 (28%), Positives = 57/114 (50%), Gaps = 8/114 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVI--DESMEGV 59
           ++L+VD    + ++ R L    GF  V +AT    A E  + +   +Y +I  D +M+ +
Sbjct: 8   NVLVVDDYKTMIRIMRGLLEQLGFRNVDDATDGPTALEKIKHK---DYGLILSDWNMQPM 64

Query: 60  L--EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
              + +  VR  P   DV    +  E   E +IA  +AG N++++KPFN   L+
Sbjct: 65  TGYDLLKAVRAEPRTKDVPFVMVTAEAKTENVIAARQAGVNNYIIKPFNLAVLK 118


>gi|171059161|ref|YP_001791510.1| PAS/PAC sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
 gi|170776606|gb|ACB34745.1| PAS/PAC sensor hybrid histidine kinase [Leptothrix cholodnii SP-6]
          Length = 846

 Score = 40.4 bits (93), Expect = 0.088,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 53/110 (48%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++LLVD   I R+V   +  D GF V  A++  EA E  ++  + + +++D  M G+  L
Sbjct: 728 AVLLVDDEPINREVAAEILEDAGFDVTLASNGMEALERLQRHPV-DLVIMDIQMPGMDGL 786

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
                +RQMP    + +  +      E       AG N+F+ KP + E L
Sbjct: 787 TTTRRIRQMPDRAHLPIIAMTANAFAEDETECLNAGMNAFIPKPIDPERL 836


>gi|317485002|ref|ZP_07943885.1| response regulator receiver domain-containing protein [Bilophila
           wadsworthia 3_1_6]
 gi|316923740|gb|EFV44943.1| response regulator receiver domain-containing protein [Bilophila
           wadsworthia 3_1_6]
          Length = 247

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 37/115 (32%), Positives = 51/115 (44%), Gaps = 7/115 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +LLVD    +R V   L  DFG+ V  A S  EA E       P  +V D  M G+  L 
Sbjct: 7   VLLVDDEPGIRHVLGALIRDFGYDVHTAESAREALEAFTANPFP-IVVTDIRMPGMDGLA 65

Query: 62  FIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +  VR Q P   D  V  +    D +  +   R GA  F+ KP N + L  +++
Sbjct: 66  LLERVRNQNP---DTQVVMITGHGDMDNAVECLRLGAADFIAKPVNDDLLEHSLK 117


>gi|282896572|ref|ZP_06304590.1| Two Component Transcriptional Regulator, LuxR family [Raphidiopsis
           brookii D9]
 gi|281198514|gb|EFA73397.1| Two Component Transcriptional Regulator, LuxR family [Raphidiopsis
           brookii D9]
          Length = 231

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    +R+  +    + GF V  A++  E  E  ++   P+ ++ D  M  V   +
Sbjct: 5   LLLVDDEPGLREAVKEYLQESGFGVRVASNAREGWELIQQNT-PDLVISDVMMPQVDGYQ 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+  +R  P    + V +L  +      I G +AG +++L KPF+ + L
Sbjct: 64  FLKQLRDDPRFASLPVIFLTAKGMTSDRIQGYQAGVDAYLPKPFDPDEL 112


>gi|332968745|gb|EGK07795.1| response regulator [Psychrobacter sp. 1501(2011)]
          Length = 248

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 34/123 (27%), Positives = 55/123 (44%), Gaps = 9/123 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    +R + +    D GF+V  A    +  +  ++EL  + +V+D  + G     
Sbjct: 16  ILVVDDDARLRSLLQRFLEDDGFVVRTAHDGSQMDKLMQRELF-SLVVLDLMLPGEDGIS 74

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETLRFAMR 115
              R     +D+ +  L  +      IAG  AGA+ +L KPFN        +  LR   R
Sbjct: 75  ICKRLREDNSDIPIIMLTAKGSDSDRIAGLEAGADDYLPKPFNPKELLARIKAVLRRHSR 134

Query: 116 ELP 118
           ELP
Sbjct: 135 ELP 137


>gi|188991536|ref|YP_001903546.1| Two-component system response regulator RpfG [Xanthomonas
           campestris pv. campestris str. B100]
 gi|167733296|emb|CAP51495.1| Two-component system response regulator RpfG [Xanthomonas
           campestris pv. campestris]
          Length = 378

 Score = 40.4 bits (93), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 59/127 (46%), Gaps = 5/127 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++++VD     R + RH+  D      V++     +A  +CE   + + L++D  M G+ 
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPELKVYDFGDPLDALSWCEVGRV-DLLLLDYRMPGMD 87

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LEF   +R++P   D+ +  + +  D     A   AG   FL+KP     LR     L 
Sbjct: 88  GLEFARRLRRLPSHRDIPIILITIVGDEPIRQAALEAGVIDFLVKPIRPRELRARCSNLL 147

Query: 119 QMQKSKD 125
           Q+++  +
Sbjct: 148 QLRQQSE 154


>gi|228994055|ref|ZP_04153956.1| Sporulation initiation phosphotransferase F [Bacillus
           pseudomycoides DSM 12442]
 gi|229000124|ref|ZP_04159694.1| Sporulation initiation phosphotransferase F [Bacillus mycoides
           Rock3-17]
 gi|229007645|ref|ZP_04165238.1| Sporulation initiation phosphotransferase F [Bacillus mycoides
           Rock1-4]
 gi|229087829|ref|ZP_04219943.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock3-44]
 gi|228695465|gb|EEL48336.1| Sporulation initiation phosphotransferase F [Bacillus cereus
           Rock3-44]
 gi|228753596|gb|EEM03041.1| Sporulation initiation phosphotransferase F [Bacillus mycoides
           Rock1-4]
 gi|228759661|gb|EEM08637.1| Sporulation initiation phosphotransferase F [Bacillus mycoides
           Rock3-17]
 gi|228765703|gb|EEM14356.1| Sporulation initiation phosphotransferase F [Bacillus
           pseudomycoides DSM 12442]
          Length = 122

 Score = 40.4 bits (93), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 61/116 (52%), Gaps = 7/116 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +  +A +  +K+  P+ +++D  + G+  +
Sbjct: 4   KILIVDDQYGIRVLLHEVFQKEGYQTFQAANGFQALDIVKKD-NPDLVILDMKIPGMDGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETLRFAMR 115
           E + HV+++     V +     E+D   MI  A+  GA     KPF+ + +R A+R
Sbjct: 63  EILKHVKEINEDIKVILMTAYGELD---MIQEAKDLGALMHFAKPFDIDEIRQAVR 115


>gi|126662999|ref|ZP_01733997.1| two-component response regulator [Flavobacteria bacterium BAL38]
 gi|126624657|gb|EAZ95347.1| two-component response regulator [Flavobacteria bacterium BAL38]
          Length = 229

 Score = 40.4 bits (93), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 54/111 (48%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
            +LLVD    + ++  +  +  G+ +  A++  EA    +KE LP  +++D     M+G 
Sbjct: 7   KILLVDDEQDILEIVGYNLSQEGYQIVTASNGKEAVAMAKKE-LPQLIIMDVMMPEMDG- 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           +E    +R+ P   D  + +L    +    +AG  AGA+ ++ KP   + L
Sbjct: 65  MEACEIIRKTPELQDTVITFLTARSEDYSQVAGFDAGADDYIAKPIKPKVL 115


>gi|89889436|ref|ZP_01200947.1| transcriptional regulatory protein [Flavobacteria bacterium BBFL7]
 gi|89517709|gb|EAS20365.1| transcriptional regulatory protein [Flavobacteria bacterium BBFL7]
          Length = 228

 Score = 40.4 bits (93), Expect = 0.090,   Method: Compositional matrix adjust.
 Identities = 32/117 (27%), Positives = 58/117 (49%), Gaps = 6/117 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           LL+ D   I+  V  +L N+ G+ VF A +  E  +  +K+  P+ +++D     M+G+ 
Sbjct: 9   LLVDDEPDILEIVSYNLKNE-GYQVFTAENGKEGVQKAKKKK-PDLIILDVMMPVMDGI- 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E    +R++P      + +L    +   MIAG  AGA+ ++ KP     L   ++ L
Sbjct: 66  EACEQIRKIPELDQTIITFLTARGEDYSMIAGFDAGADDYIAKPIKPRVLVSKVKSL 122


>gi|254444474|ref|ZP_05057950.1| response regulator receiver domain protein [Verrucomicrobiae
           bacterium DG1235]
 gi|198258782|gb|EDY83090.1| response regulator receiver domain protein [Verrucomicrobiae
           bacterium DG1235]
          Length = 482

 Score = 40.4 bits (93), Expect = 0.091,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 62/133 (46%), Gaps = 6/133 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           + ++L+VD +   R+    L     +    A S   A E  E E  P+ +++D  M G+ 
Sbjct: 6   LSTILVVDDNLGARRSIEALLTQESYRFLLADSGVVALELLE-EHTPDVILLDVMMPGMS 64

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R     +++ +  +    D E MI G  AGA+ FL KP ++  LR  +R + 
Sbjct: 65  GFETCQKIRANSRVSEIPIIMITALDDEESMIQGIDAGADDFLSKPISKIELRSRIRSIL 124

Query: 119 QMQKSK---DENQ 128
           ++ + +   DE Q
Sbjct: 125 RLNRFRKLCDERQ 137


>gi|74317632|ref|YP_315372.1| response regulator receiver domain-containing protein [Thiobacillus
           denitrificans ATCC 25259]
 gi|74057127|gb|AAZ97567.1| Response regulator receiver domain protein (CheY) [Thiobacillus
           denitrificans ATCC 25259]
          Length = 131

 Score = 40.4 bits (93), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 58/113 (51%), Gaps = 12/113 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESMEGV 59
           L+VD    +R++ R+L  + G+     ++V EA +  +     +    +++V D +M  +
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGY-----SNVEEAEDGADGLAKLRAGSFDFVVSDWNMPNM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             L  + ++R     + + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 64  DGLTMLQNIRADAALSKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|291278597|ref|YP_003495432.1| hypothetical protein DEFDS_0164 [Deferribacter desulfuricans SSM1]
 gi|290753299|dbj|BAI79676.1| conserved hypothetical protein [Deferribacter desulfuricans SSM1]
          Length = 775

 Score = 40.4 bits (93), Expect = 0.092,   Method: Composition-based stats.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 3/111 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           + +L+VD S  VRK  + +    G+ V EA    +A E  E   +P Y++ D  M  +  
Sbjct: 652 NGVLIVDDSISVRKYLKDILTKNGYKVLEAKDGLQALETLELNRVP-YIITDLEMPNLNG 710

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            E I  +R       V +Y +      +        GA+ F++KPF  ET+
Sbjct: 711 YELIDKIRNNIQDKSVKIYVITSRGTEKHRSKALELGADGFIVKPFTEETI 761


>gi|254994186|ref|ZP_05276376.1| two-component response regulator [Listeria monocytogenes FSL
           J2-064]
          Length = 220

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 37/118 (31%), Positives = 53/118 (44%), Gaps = 3/118 (2%)

Query: 1   MDSLLLVDSS-HIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M  +L+VD   HI++ VG H     GF V EA+   EAR+  E E + +  VID  M  +
Sbjct: 1   MKQILVVDDDRHILKLVG-HYLRAEGFRVLEASDGVEARKNVETEQV-HLAVIDVMMPNM 58

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             F    +      D+ V  L  +        G   G + ++ KPF  E L F +R L
Sbjct: 59  DGFELCKKMRTSYPDIPVIMLTAKDALADKSRGFEVGTDDYVTKPFEPEELIFRIRAL 116


>gi|115351070|ref|YP_772909.1| two component sigma54 specific Fis family transcriptional regulator
           [Burkholderia ambifaria AMMD]
 gi|115281058|gb|ABI86575.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia ambifaria AMMD]
          Length = 461

 Score = 40.4 bits (93), Expect = 0.092,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE + L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVRTLRA 133


>gi|309777048|ref|ZP_07672017.1| DNA-binding response regulator [Erysipelotrichaceae bacterium
           3_1_53]
 gi|308915258|gb|EFP61029.1| DNA-binding response regulator [Erysipelotrichaceae bacterium
           3_1_53]
          Length = 238

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 35/133 (26%), Positives = 64/133 (48%), Gaps = 8/133 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           S+LLV+    ++++ R +    GF V+ A  + EA E    E  P+ LV+D  +     L
Sbjct: 9   SVLLVEDDANIQRINRRILEREGFYVYCAACLQEAYEIL-NEHTPDVLVLDIMLPDGSGL 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F   +R     T + V +L    +  ++I G  AG N ++ KP++ +   F  R   Q+
Sbjct: 68  AFCEKIRPK---TTIPVLFLTALDEKNEIIQGLVAGGNDYITKPYDVD--EFVARVNAQL 122

Query: 121 QKSKDENQFLDAI 133
           + ++   Q ++ I
Sbjct: 123 RLARMNQQAIEQI 135


>gi|209550841|ref|YP_002282758.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
 gi|209536597|gb|ACI56532.1| response regulator receiver protein [Rhizobium leguminosarum bv.
           trifolii WSM2304]
          Length = 122

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 50/111 (45%), Gaps = 5/111 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L VD S  +R   +   ++ G+ V EA    E     +     + +V D     M+G 
Sbjct: 4   NILTVDDSASIRLTTKVTLSNAGYSVTEAADGAEGLATAKGGRF-DLIVTDLNMPVMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L  I  +R++P    V + +L  E D +       AGA  +L KPF+ E L
Sbjct: 62  LTMIEELRKLPGQAGVPIIFLTTESDTDLKARAKAAGATGWLTKPFDPEHL 112


>gi|86607232|ref|YP_475995.1| response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86555774|gb|ABD00732.1| response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 332

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 23/80 (28%), Positives = 44/80 (55%), Gaps = 6/80 (7%)

Query: 47  PNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEV--DFEKMIAGARAGANSFLL 102
           P+ ++ D  M G+  +E    ++ +P G   F+Y++L+    + E  + G  AGA+ F+ 
Sbjct: 54  PDLIICDWVMPGLSGVELCRRLKNLPAGQ--FIYFILLTARSEVEDRVQGLDAGADEFIA 111

Query: 103 KPFNRETLRFAMRELPQMQK 122
           KP + E LR  +R   ++Q+
Sbjct: 112 KPIDPEELRARVRAGLRLQR 131


>gi|2914156|pdb|1AB6|A Chain A, Structure Of Chey Mutant F14n, V86t
 gi|2914157|pdb|1AB6|B Chain B, Structure Of Chey Mutant F14n, V86t
          Length = 125

 Score = 40.4 bits (93), Expect = 0.092,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD +  +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 5   LVVDDNSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY-GFVISDWNMPNMDGLE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V     E   E +IA A+AGA+ +++KPF   TL
Sbjct: 64  LLKTIRADGAMSALPVLMTTAEAKKENIIAAAQAGASGYVVKPFTAATL 112


>gi|170077559|ref|YP_001734197.1| two-component response regulator [Synechococcus sp. PCC 7002]
 gi|169885228|gb|ACA98941.1| two-component response regulator [Synechococcus sp. PCC 7002]
          Length = 239

 Score = 40.4 bits (93), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    +R +        G+ V  AT    A+E  +    P+ +++D ++   L + 
Sbjct: 6   ILVVDDDPAIRTLIVRFLGQKGYAVAAATDGQSAKETFQ-SFSPDLVILDINLPDTLGY- 63

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
           A   QM    D +V  L    D    + G   GA+ +L KPF+   L   +  + + Q+S
Sbjct: 64  ALCEQMQESKDTYVLILTSRTDATDKVRGFTQGADDYLTKPFDIIELEHRVHAILRRQRS 123


>gi|308048770|ref|YP_003912336.1| response regulator receiver protein [Ferrimonas balearica DSM 9799]
 gi|307630960|gb|ADN75262.1| response regulator receiver protein [Ferrimonas balearica DSM 9799]
          Length = 123

 Score = 40.0 bits (92), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 28/112 (25%), Positives = 55/112 (49%), Gaps = 4/112 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD    +R++ ++L  D GF    EA     A    +     +++V D +M G+  
Sbjct: 2   KILIVDDFSTMRRIIKNLLRDLGFNNTQEADDGSTALPMLQNGDF-DFVVTDWNMPGMQG 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           ++ +  +R       + V  +  E   E+++  A+AG N +++KPF   TL+
Sbjct: 61  IDLLRAIRSDDNLKHLPVLMVTAEAKREQIVTAAQAGVNGYIVKPFTAATLK 112


>gi|53747886|emb|CAF05631.1| hypothetical protein [Angiococcus disciformis]
          Length = 481

 Score = 40.0 bits (92), Expect = 0.094,   Method: Composition-based stats.
 Identities = 38/132 (28%), Positives = 59/132 (44%), Gaps = 5/132 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +LLVD   I R +        G  V    S+ +ARE    +   + +V D  + G  
Sbjct: 20  MARILLVDDEKIARTLYGDYLTAVGHAVTAVGSLQDAREALAGDRF-DAVVTDLILPGGD 78

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E + HVR+   G +V V   L +VD    +   ++GA  +L+KP   E L+ A+R   
Sbjct: 79  GMEVLRHVRERHPGVEVVVITGLEKVD--PAVRAIKSGAAEYLVKPVAPEALQHAVRRAL 136

Query: 119 QMQKSKDENQFL 130
             +    EN  L
Sbjct: 137 TTRDLLQENASL 148


>gi|328881400|emb|CCA54639.1| Tricarboxylate transport transcriptional regulator TctD
           [Streptomyces venezuelae ATCC 10712]
          Length = 222

 Score = 40.0 bits (92), Expect = 0.095,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 65/131 (49%), Gaps = 9/131 (6%)

Query: 1   MDSLLLVDSSHIVRKVG-RHLFNDFGFMVFE-ATSVCEAREFCEKELLPNYLVID---ES 55
           M ++L+VD   +V K+  R++    GF V   A S  EA    E+ L P+ +++D     
Sbjct: 1   MTNVLVVDDDFMVAKLHCRYVSAVAGFTVSGVAHSGAEALRAAER-LRPDLVLLDVFLPD 59

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G+   +  +R   LGTD    ++    D   +    RAGA  +L+KPF++  L   +R
Sbjct: 60  MDGI-RVLRELRAAGLGTDAL--FITAARDVGTIREALRAGALHYLIKPFSQAALHEQLR 116

Query: 116 ELPQMQKSKDE 126
            +  ++   DE
Sbjct: 117 HVASLRSRLDE 127


>gi|222824256|ref|YP_002575830.1| chemotaxis protein CheY [Campylobacter lari RM2100]
 gi|222539478|gb|ACM64579.1| chemotaxis protein CheY [Campylobacter lari RM2100]
          Length = 125

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 29/118 (24%), Positives = 56/118 (47%), Gaps = 3/118 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            LL+VD S  +R++ ++     G   V EA    EA +   +      L+ D +M  +  
Sbjct: 2   KLLVVDDSSTMRRIIKNTLVRLGHKDVLEAEHGVEAWDLLSQNDDIKVLITDWNMPEMNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           LE +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+  + ++
Sbjct: 62  LELVKKVRAEEKYADMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLKEKLEDV 119


>gi|213963418|ref|ZP_03391673.1| putative histidine kinase [Capnocytophaga sputigena Capno]
 gi|213953938|gb|EEB65265.1| putative histidine kinase [Capnocytophaga sputigena Capno]
          Length = 1365

 Score = 40.0 bits (92), Expect = 0.096,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 6/124 (4%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +LLLVD +H V  + +++F    + +  A+   +A E C +   PN ++ D  M  +   
Sbjct: 1123 TLLLVDDNHEVLMILKNIFIK-EYNIILASDGEQAIEKCNQHF-PNLVISDVMMPKIDGF 1180

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            E  A +++      + V  L  +   E  I G   GA+++L KPF+ + L+  +R L  +
Sbjct: 1181 ELCAILKKNLQTCFIPVILLTAKSQIESQIEGIELGADAYLTKPFDVKLLKTNVRNL--L 1238

Query: 121  QKSK 124
             KSK
Sbjct: 1239 NKSK 1242


>gi|167854761|ref|ZP_02477539.1| aerobic respiration control protein ArcA [Haemophilus parasuis
           29755]
 gi|167854059|gb|EDS25295.1| aerobic respiration control protein ArcA [Haemophilus parasuis
           29755]
          Length = 238

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 30/117 (25%), Positives = 54/117 (46%), Gaps = 2/117 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+   + R   + +F   G+ VFEAT   E     +   + N +++D ++ G    
Sbjct: 5   QILIVEDEAVTRSTLKSVFEAEGYDVFEATDGNEMNIILDNHEI-NLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +   R++   TD+ + +L    +    I G   GA+ ++ KPFN   L    R L Q
Sbjct: 64  ML-ARELRENTDIALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNLLQ 119


>gi|118590692|ref|ZP_01548093.1| response regulator receiver (CheY-like protein) [Stappia aggregata
           IAM 12614]
 gi|254500489|ref|ZP_05112640.1| response regulator receiver domain, putative [Labrenzia alexandrii
           DFL-11]
 gi|118436668|gb|EAV43308.1| response regulator receiver (CheY-like protein) [Stappia aggregata
           IAM 12614]
 gi|222436560|gb|EEE43239.1| response regulator receiver domain, putative [Labrenzia alexandrii
           DFL-11]
          Length = 127

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 55/111 (49%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           +L+VD    + ++ R+L    GF  + +A    EA E   K+     ++ D +ME +   
Sbjct: 9   VLVVDDYKTMIRIIRNLLKQLGFEDIDDAADGTEALEKM-KQRRYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VR     +      +  E   E +IA  +AG N++++KPFN +TL+
Sbjct: 68  ELLKQVRADGSLSKTPFIMVTAESKTENVIAAKKAGVNNYIVKPFNAQTLK 118


>gi|94500275|ref|ZP_01306808.1| CheY-like receiver protein [Oceanobacter sp. RED65]
 gi|94427574|gb|EAT12551.1| CheY-like receiver protein [Oceanobacter sp. RED65]
          Length = 120

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 58/121 (47%), Gaps = 7/121 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDE----SM 56
           M  +L VD S  +R++        G  V EA+   EA +  + + +   LV+ +    +M
Sbjct: 1   MAKILAVDDSASMRQMVSFTLKGAGHDVLEASDGAEALKIAQGQAVD--LVLSDVNMPNM 58

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
            G+ E   ++RQ+       +  L  E   +K + G  AGA  +++KPFN + L   +++
Sbjct: 59  NGI-ELCKNLRQLSSYKFTPILMLTTESAGDKKMEGKSAGATGWIVKPFNPDQLLSTIKK 117

Query: 117 L 117
           +
Sbjct: 118 V 118


>gi|21231334|ref|NP_637251.1| chemotaxis response regulator [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|21242648|ref|NP_642230.1| chemotaxis response regulator [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|58582458|ref|YP_201474.1| chemotaxis response regulator [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|66768614|ref|YP_243376.1| chemotaxis response regulator [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|78047513|ref|YP_363688.1| chemotaxis response regulator [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|84624349|ref|YP_451721.1| chemotaxis response regulator [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|166711983|ref|ZP_02243190.1| chemotaxis response regulator [Xanthomonas oryzae pv. oryzicola
           BLS256]
 gi|188991568|ref|YP_001903578.1| chemotaxis response regulator [Xanthomonas campestris pv.
           campestris str. B100]
 gi|289662359|ref|ZP_06483940.1| chemotaxis response regulator [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289667250|ref|ZP_06488325.1| chemotaxis response regulator [Xanthomonas campestris pv.
           musacearum NCPPB4381]
 gi|294624027|ref|ZP_06702795.1| chemotaxis response regulator [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|294665074|ref|ZP_06730379.1| chemotaxis response regulator [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325918396|ref|ZP_08180526.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Xanthomonas vesicatoria ATCC 35937]
 gi|325919201|ref|ZP_08181251.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Xanthomonas gardneri ATCC 19865]
 gi|325929026|ref|ZP_08190183.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Xanthomonas perforans 91-118]
 gi|21108116|gb|AAM36766.1| chemotaxis response regulator [Xanthomonas axonopodis pv. citri
           str. 306]
 gi|21112993|gb|AAM41175.1| chemotaxis response regulator [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|58427052|gb|AAW76089.1| chemotaxis response regulator [Xanthomonas oryzae pv. oryzae
           KACC10331]
 gi|66573946|gb|AAY49356.1| chemotaxis response regulator [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|78035943|emb|CAJ23634.1| chemotaxis response regulator [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|84368289|dbj|BAE69447.1| chemotaxis response regulator [Xanthomonas oryzae pv. oryzae MAFF
           311018]
 gi|167733328|emb|CAP51527.1| chemotaxis response regulator [Xanthomonas campestris pv.
           campestris]
 gi|292601673|gb|EFF45642.1| chemotaxis response regulator [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 11122]
 gi|292605155|gb|EFF48501.1| chemotaxis response regulator [Xanthomonas fuscans subsp.
           aurantifolii str. ICPB 10535]
 gi|325535390|gb|EGD07256.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Xanthomonas vesicatoria ATCC 35937]
 gi|325540601|gb|EGD12186.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Xanthomonas perforans 91-118]
 gi|325550318|gb|EGD21122.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Xanthomonas gardneri ATCC 19865]
          Length = 121

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S  +R++        GF V EA     A    + +   N +V D +M  +  + 
Sbjct: 5   ILVVDDSASMRQMVSFALTSAGFAVEEAEDGAVALGRAKGQRF-NAVVTDVNMPNMDGIS 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            I  +RQ+P      +  L  E   +K   G  AGA  +L+KPFN E L
Sbjct: 64  LIRELRQLPDYKFTPMLMLTTESAADKKSEGKAAGATGWLVKPFNPEQL 112


>gi|188533612|ref|YP_001907409.1| chemotaxis regulatory protein CheY [Erwinia tasmaniensis Et1/99]
 gi|188028654|emb|CAO96516.1| Chemotaxis regulator transmits chemoreceptor signals to flagelllar
           motor components [Erwinia tasmaniensis Et1/99]
          Length = 129

 Score = 40.0 bits (92), Expect = 0.096,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD  + +R++ R+L  + GF  V EA    +A          +++V D +M  +  LE
Sbjct: 9   LVVDDFNTMRRIVRNLLKELGFNNVEEAEDGVDALNKLRAGGF-DFVVSDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRTDGALSKLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|313887875|ref|ZP_07821554.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Peptoniphilus harei ACS-146-V-Sch2b]
 gi|312846041|gb|EFR33423.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Peptoniphilus harei ACS-146-V-Sch2b]
          Length = 227

 Score = 40.0 bits (92), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 60/127 (47%), Gaps = 3/127 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +LLV+    +RK  +      G+ +FEA S  E  E   +EL P+ +V+D  + G+  F
Sbjct: 4   KVLLVEDEESIRKFVKINLEREGYTIFEAGSGEEGIEIARREL-PDIVVLDIMLPGIDGF 62

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +    +    +   +       D++K I G + G + +L KPFN   L   ++ + +  
Sbjct: 63  EVCKTLRGEFPSLGIIMLTAKAEDYDK-IMGLQYGTDDYLTKPFNPTELTLRIKSIERRL 121

Query: 122 KSKDENQ 128
           +  +EN+
Sbjct: 122 EIGEENE 128


>gi|39997676|ref|NP_953627.1| sigma-54 dependent transcriptional regulator [Geobacter
           sulfurreducens PCA]
 gi|39984568|gb|AAR35954.1| sigma-54 dependent transcriptional regulator [Geobacter
           sulfurreducens PCA]
 gi|298506617|gb|ADI85340.1| sigma-54-dependent transcriptional response regulator [Geobacter
           sulfurreducens KN400]
          Length = 456

 Score = 40.0 bits (92), Expect = 0.100,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 45/95 (47%), Gaps = 5/95 (5%)

Query: 23  DFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYL 80
           D GF    A S  +A    E+E + + L+ D  MEG+  LE +  VR+     +V V  +
Sbjct: 25  DAGFAPLTAVSGAQALALLEREHV-DLLISDLIMEGMNGLELLDRVRER--YPNVPVIVV 81

Query: 81  LMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
                 E  +   R GA  +L KPFN E LR  ++
Sbjct: 82  TARGSVESAVEAMRRGAYDYLAKPFNPEVLRITLQ 116


>gi|171322744|ref|ZP_02911486.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia ambifaria MEX-5]
 gi|171091910|gb|EDT37384.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia ambifaria MEX-5]
          Length = 461

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE + L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVRTLRA 133


>gi|256820298|ref|YP_003141577.1| histidine kinase [Capnocytophaga ochracea DSM 7271]
 gi|256581881|gb|ACU93016.1| histidine kinase [Capnocytophaga ochracea DSM 7271]
          Length = 1376

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 6/124 (4%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +LLLVD +H V  + +++F    + +  A+   +A E C +   PN ++ D  M  +   
Sbjct: 1134 TLLLVDDNHEVLMILKNIFIK-EYNIILASDGEQAIEKCNQHF-PNLVISDVMMPKIDGF 1191

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            E  A +++      + V  L  +   E  I G   GA+++L KPF+ + L+  +R L  +
Sbjct: 1192 ELCAILKKNLQTCFIPVILLTAKSQIESQIEGIELGADAYLTKPFDVKLLKTNVRNL--L 1249

Query: 121  QKSK 124
             KSK
Sbjct: 1250 NKSK 1253


>gi|209695976|ref|YP_002263906.1| two-component response regulator [Aliivibrio salmonicida LFI1238]
 gi|208009929|emb|CAQ80242.1| response regulator, aerobic respiration control protein ArcA
           [Aliivibrio salmonicida LFI1238]
          Length = 239

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/114 (25%), Positives = 54/114 (47%), Gaps = 2/114 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+V+  H+ R   + +F   G+ VFEA+   E      ++ L N +++D ++ G    +
Sbjct: 6   ILIVEDEHVTRNTLKSIFEAEGYNVFEASDGEEMHTVLSEQQL-NLVIMDINLPGKNGLL 64

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L
Sbjct: 65  L-ARELRERGDMALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL 117


>gi|170747318|ref|YP_001753578.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
 gi|170653840|gb|ACB22895.1| response regulator receiver protein [Methylobacterium radiotolerans
           JCM 2831]
          Length = 127

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 57/112 (50%), Gaps = 6/112 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           +L+VD    + ++ R+L    GF  V +A+   EA    +       ++ D +ME +   
Sbjct: 9   ILVVDDYQTMVRIIRNLLKQLGFEEVDDASDGTEALARLKGRKY-GLVISDWNMEPMTGY 67

Query: 61  EFIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E + HVR    L T  F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 68  ELLRHVRADENLRTTPFIM-VTAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|315223343|ref|ZP_07865202.1| histidine kinase [Capnocytophaga ochracea F0287]
 gi|314946674|gb|EFS98663.1| histidine kinase [Capnocytophaga ochracea F0287]
          Length = 1376

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 35/124 (28%), Positives = 62/124 (50%), Gaps = 6/124 (4%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +LLLVD +H V  + +++F    + +  A+   +A E C +   PN ++ D  M  +   
Sbjct: 1134 TLLLVDDNHEVLMILKNIFIK-EYNIILASDGEQAIEKCNQHF-PNLVISDVMMPKIDGF 1191

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            E  A +++      + V  L  +   E  I G   GA+++L KPF+ + L+  +R L  +
Sbjct: 1192 ELCAILKKNLQTCFIPVILLTAKSQIESQIEGIELGADAYLTKPFDVKLLKTNVRNL--L 1249

Query: 121  QKSK 124
             KSK
Sbjct: 1250 NKSK 1253


>gi|50120628|ref|YP_049795.1| chemotaxis regulatory protein CheY [Pectobacterium atrosepticum
           SCRI1043]
 gi|49611154|emb|CAG74600.1| chemotaxis protein [Pectobacterium atrosepticum SCRI1043]
          Length = 129

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGSDALNKLRSGAF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLQTIRADGALSKLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|313159142|gb|EFR58517.1| response regulator receiver domain protein [Alistipes sp. HGB5]
          Length = 392

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 26  FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLME 83
           + +  A+   EA E   KE  P+ +++D  M  +   E I H++  P   D+ V +L   
Sbjct: 35  YKIVTASGGYEAIEKASKEA-PDLILLDIMMPDLDGYEVIKHLKADPATQDIPVIFLTAL 93

Query: 84  VDFEKMIAGARAGANSFLLKPFNRETL 110
            + E ++ G + GA+ ++ KPFN E L
Sbjct: 94  HNPEDIVKGFKLGASDYVSKPFNHEEL 120


>gi|269103458|ref|ZP_06156155.1| aerobic respiration control protein ArcA [Photobacterium damselae
           subsp. damselae CIP 102761]
 gi|268163356|gb|EEZ41852.1| aerobic respiration control protein ArcA [Photobacterium damselae
           subsp. damselae CIP 102761]
          Length = 239

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/115 (26%), Positives = 53/115 (46%), Gaps = 4/115 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-DESMEGVLEF 62
           +L+V+  H+ R   + +F   G+ VFEA    E  +   +   P +LVI D ++ G    
Sbjct: 6   ILIVEDEHVTRNTLKSIFEAEGYTVFEANDGNEMHQMLSEH--PVHLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +   R++    D+ + +L    +    I G   GA+ ++ KPFN   L    R L
Sbjct: 64  LL-ARELREQGDMALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL 117


>gi|115522945|ref|YP_779856.1| response regulator receiver protein [Rhodopseudomonas palustris
           BisA53]
 gi|115516892|gb|ABJ04876.1| response regulator receiver protein [Rhodopseudomonas palustris
           BisA53]
          Length = 131

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 30/111 (27%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL--E 61
           +L+VD  + + ++ R+L    GF   +  S   A     +      ++ D +ME +   +
Sbjct: 9   VLVVDDYNTMIRIIRNLLKQLGFADIDDASDGSAALAKMRTKKYGLVISDWNMEPMTGYD 68

Query: 62  FIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            +  VR  P L    F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 69  LLKEVRADPNLAMTKFIM-ITAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|309791230|ref|ZP_07685762.1| two component transcriptional regulator, LuxR family
           [Oscillochloris trichoides DG6]
 gi|308226792|gb|EFO80488.1| two component transcriptional regulator, LuxR family
           [Oscillochloris trichoides DG6]
          Length = 218

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 59/117 (50%), Gaps = 7/117 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM--VFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           +++L+D   +VR+  R      G +  V EA+S  E  +   ++LLP+ +++D  M G+ 
Sbjct: 5   TVMLIDDHRVVRQGLRDFLELQGDIEVVGEASSGAEGVQLA-RDLLPDIVLMDLVMPGID 63

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +E    ++ +   + V V       D  K+    +AGA S+LLK  + E L  A+R
Sbjct: 64  GVETTRQIKTVSPSSKVIVLTSFS--DDNKVFPAIKAGAISYLLKDISPEELAHAIR 118


>gi|299541709|ref|ZP_07052039.1| signal transduction histidine kinase, LytS [Lysinibacillus
           fusiformis ZC1]
 gi|298725804|gb|EFI66438.1| signal transduction histidine kinase, LytS [Lysinibacillus
           fusiformis ZC1]
          Length = 1002

 Score = 40.0 bits (92), Expect = 0.10,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 60/136 (44%), Gaps = 7/136 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   +  KV   +     + +    +     E+  ++   + L++D  M  +   E
Sbjct: 675 ILIVDDDAVNLKVLIDILTQENYSIIAIDNGHHVFEYLTQQPSIDLLILDIMMPSISGYE 734

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               VRQ    T++ +  L   V  E MIA  + GAN FL KP +   L+  +R L  ++
Sbjct: 735 ICQQVRQNYTSTELPILMLTAAVRPEDMIAAFQTGANDFLHKPLDATELKTRVRNLLLLK 794

Query: 122 KS-----KDENQFLDA 132
           +S     K E  FL A
Sbjct: 795 ESAETAVKMETAFLQA 810


>gi|298505432|gb|ADI84155.1| sigma-54-dependent transcriptional response regulator [Geobacter
           sulfurreducens KN400]
          Length = 461

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGVLEF 62
           +L+VD    +R+V  +   + G+ V  A S  E  R F E+   P  +V D  M G+  F
Sbjct: 11  VLIVDDDVSLRRVLEYNLQEEGYDVITAGSGEEGLRLFDERS--PALVVTDLKMPGMGGF 68

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  ++     T V V      V  E  +   +AGA  ++ KPFNR+ L+  +++  +M
Sbjct: 69  RLLQEIKGRSPDTAVIVITAFGAV--ETAVDAMKAGAYDYITKPFNRDALKLTVKKALEM 126

Query: 121 QKSKDENQFL 130
                EN+ L
Sbjct: 127 LGLSRENRRL 136


>gi|218439789|ref|YP_002378118.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
 gi|218172517|gb|ACK71250.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
          Length = 234

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 60/130 (46%), Gaps = 11/130 (8%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+V+    + ++ R       F    A S  +A E    +L P+ +++D  + G+  L
Sbjct: 2   NILIVEDEPEIAQLIRETLERENFSCQIAKSGTQALEIF-GQLQPDLIILDLMLPGLDGL 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETLRF 112
           E    +RQ P   D ++  L    +    I G   GA+ +L+KPF+        R  LR 
Sbjct: 61  EVCTRIRQKPGAKDPYILMLTARGEEIDRIIGLSTGADDYLVKPFSPIELVARVRALLRR 120

Query: 113 AMRELPQMQK 122
           ++R   Q+Q+
Sbjct: 121 SLRHGGQVQQ 130


>gi|187926240|ref|YP_001892585.1| response regulator receiver protein [Ralstonia pickettii 12J]
 gi|241665728|ref|YP_002984087.1| response regulator receiver protein [Ralstonia pickettii 12D]
 gi|187727994|gb|ACD29158.1| response regulator receiver protein [Ralstonia pickettii 12J]
 gi|240867755|gb|ACS65415.1| response regulator receiver protein [Ralstonia pickettii 12D]
          Length = 133

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 32/111 (28%), Positives = 55/111 (49%), Gaps = 6/111 (5%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEF 62
           L+VD    +R++ R+L  + GF   +      A     KE   ++++ D +M  +  L+ 
Sbjct: 9   LVVDDFPTMRRIVRNLLKELGFANVDEAEDGAAGLAKVKEGRFDFVISDWNMPNMDGLQM 68

Query: 63  IAHVRQMPLGTDVFVYYLLM---EVDFEKMIAGARAGANSFLLKPFNRETL 110
           +  +R     T +    +LM   E   E +IA A+AGAN +++KPF   TL
Sbjct: 69  LQSIRA-DANTAISKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 118


>gi|15964391|ref|NP_384744.1| chemotaxis regulator protein [Sinorhizobium meliloti 1021]
 gi|307315313|ref|ZP_07594887.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
 gi|307322324|ref|ZP_07601687.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|534836|gb|AAA86673.1| CheY1 [Sinorhizobium meliloti]
 gi|15073568|emb|CAC45210.1| Chemotaxis regulator protein [Sinorhizobium meliloti 1021]
 gi|306892030|gb|EFN22853.1| response regulator receiver protein [Sinorhizobium meliloti AK83]
 gi|306898849|gb|EFN29502.1| response regulator receiver protein [Sinorhizobium meliloti BL225C]
          Length = 121

 Score = 40.0 bits (92), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 31/105 (29%), Positives = 48/105 (45%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R +     N+ GF   +A    E  E  +    P+ +V D +M  +    
Sbjct: 5   VLTVDDSRTIRNMLLVTLNNAGFETIQAEDGVEGLEKLDTAN-PDVIVTDINMPRLDGFG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           FI  VR+      V +  L  E D EK     +AGA  +++KPF+
Sbjct: 64  FIEGVRKNDRYRAVPILVLTTESDAEKKNRARQAGATGWIVKPFD 108


>gi|325962316|ref|YP_004240222.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Arthrobacter phenanthrenivorans
           Sphe3]
 gi|323468403|gb|ADX72088.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Arthrobacter phenanthrenivorans
           Sphe3]
          Length = 256

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 51/107 (47%), Gaps = 2/107 (1%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIA 64
           L+++  H +R++ R + +  GF V  A+S  E      K L P+ + +D  +  +  F  
Sbjct: 8   LVIEDDHDIRELVRTVLSQAGFDVSVASSGAEG-VLIAKNLNPDVITLDLGLPDIDGFEV 66

Query: 65  HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             RQ+   +D ++  L    +    + G  +GA+ +L KPF    LR
Sbjct: 67  S-RQIREFSDAYIVMLTARTEELDTLIGLESGADDYLTKPFRPRELR 112


>gi|16760865|ref|NP_456482.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhi str. CT18]
 gi|16765258|ref|NP_460873.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhimurium str. LT2]
 gi|29141443|ref|NP_804785.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhi str. Ty2]
 gi|56413164|ref|YP_150239.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. ATCC 9150]
 gi|62180493|ref|YP_216910.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. SC-B67]
 gi|161502968|ref|YP_001570080.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:-- str. RSK2980]
 gi|161613524|ref|YP_001587489.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|167552444|ref|ZP_02346197.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|167994222|ref|ZP_02575314.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|168234018|ref|ZP_02659076.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|168238550|ref|ZP_02663608.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|168241549|ref|ZP_02666481.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|168259805|ref|ZP_02681778.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|168462549|ref|ZP_02696480.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|168820744|ref|ZP_02832744.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|194443971|ref|YP_002041182.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194450206|ref|YP_002045970.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194469235|ref|ZP_03075219.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194738315|ref|YP_002114952.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|197251046|ref|YP_002146105.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197264393|ref|ZP_03164467.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197362090|ref|YP_002141727.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Paratyphi A str. AKU_12601]
 gi|198242782|ref|YP_002215167.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|200391037|ref|ZP_03217648.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204931042|ref|ZP_03221868.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205352380|ref|YP_002226181.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 287/91]
 gi|207856563|ref|YP_002243214.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Enteritidis str. P125109]
 gi|213163283|ref|ZP_03348993.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhi str. E00-7866]
 gi|213426383|ref|ZP_03359133.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhi str. E02-1180]
 gi|213613011|ref|ZP_03370837.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-2068]
 gi|213647157|ref|ZP_03377210.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhi str. J185]
 gi|224583580|ref|YP_002637378.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Paratyphi C strain RKS4594]
 gi|238912507|ref|ZP_04656344.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Tennessee str. CDC07-0191]
 gi|289824045|ref|ZP_06543643.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhi str. E98-3139]
 gi|61220888|sp|P0A2D5|CHEY_SALTY RecName: Full=Chemotaxis protein CheY
 gi|61220889|sp|P0A2D6|CHEY_SALTI RecName: Full=Chemotaxis protein CheY
 gi|25298673|pir||AH0745 chemotaxis protein CheY [imported] - Salmonella enterica subsp.
           enterica serovar Typhi (strain CT18)
 gi|109157644|pdb|2FKA|A Chain A, Crystal Structure Of Mg(2+) And Bef(3)(-)-Bound Chey In
           Complex With Chez(200-214) Solved From A F432 Crystal
           Grown In Caps (Ph 10.5)
 gi|109157652|pdb|2FLK|A Chain A, Crystal Structure Of Chey In Complex With Chez(200-214)
           Solved From A F432 Crystal Grown In Caps (Ph 10.5)
 gi|109157658|pdb|2FLW|A Chain A, Crystal Structure Of Mg2+ And Bef3- Ound Chey In Complex
           With Chez 200-214 Solved From A F432 Crystal Grown In
           Hepes (Ph 7.5)
 gi|109157660|pdb|2FMF|A Chain A, Crystal Structure Of Chey In Complex With Chez 200-214
           Solved From A F432 Crystal Grown In Hepes (Ph 7.5)
 gi|109157663|pdb|2FMH|A Chain A, Crystal Structure Of Mg2+ And Bef3- Bound Chey In Complex
           With Chez 200-214 Solved From A F432 Crystal Grown In
           Tris (Ph 8.4)
 gi|109157665|pdb|2FMI|A Chain A, Crystal Structure Of Chey In Complex With Chez 200-214
           Solved From A F432 Crystal Grown In Tris (Ph 8.4)
 gi|109157668|pdb|2FMK|A Chain A, Crystal Structure Of Mg2+ And Bef3- Bound Chey In Complex
           With Chez 200-214 Solved From A P2(1)2(1)2 Crystal Grown
           In Mes (Ph 6.0)
 gi|153909|gb|AAA27037.1| CheY [Salmonella enterica subsp. enterica serovar Typhimurium]
 gi|16420453|gb|AAL20832.1| chemotaxis regulator protein [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|16503162|emb|CAD05667.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Typhi]
 gi|29137070|gb|AAO68634.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|56127421|gb|AAV76927.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. ATCC 9150]
 gi|62128126|gb|AAX65829.1| chemotaxis regulator, transmits chemoreceptor signals to flagelllar
           motor components [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|160864315|gb|ABX20938.1| hypothetical protein SARI_01030 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
 gi|161362888|gb|ABX66656.1| hypothetical protein SPAB_01244 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194402634|gb|ACF62856.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Newport str. SL254]
 gi|194408510|gb|ACF68729.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL476]
 gi|194455599|gb|EDX44438.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Kentucky str. CVM29188]
 gi|194713817|gb|ACF93038.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. CVM19633]
 gi|195634330|gb|EDX52682.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Newport str. SL317]
 gi|197093567|emb|CAR59030.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Paratyphi A str. AKU_12601]
 gi|197214749|gb|ACH52146.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Agona str. SL483]
 gi|197242648|gb|EDY25268.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA23]
 gi|197288648|gb|EDY28023.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Schwarzengrund str. SL480]
 gi|197937298|gb|ACH74631.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Dublin str. CT_02021853]
 gi|199603482|gb|EDZ02028.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Virchow str. SL491]
 gi|204320086|gb|EDZ05291.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Javiana str. GA_MM04042433]
 gi|205272161|emb|CAR37017.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205322902|gb|EDZ10741.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Saintpaul str. SARA29]
 gi|205327866|gb|EDZ14630.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar 4,[5],12:i:- str. CVM23701]
 gi|205331974|gb|EDZ18738.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Kentucky str. CDC 191]
 gi|205339215|gb|EDZ25979.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Heidelberg str. SL486]
 gi|205342668|gb|EDZ29432.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Weltevreden str. HI_N05-537]
 gi|205351062|gb|EDZ37693.1| chemotaxis response regulator CheY [Salmonella enterica subsp.
           enterica serovar Hadar str. RI_05P066]
 gi|206708366|emb|CAR32670.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|224468107|gb|ACN45937.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|261247086|emb|CBG24907.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Typhimurium str. D23580]
 gi|267993903|gb|ACY88788.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 14028S]
 gi|301158436|emb|CBW17945.1| chemotaxis protein CheY [Salmonella enterica subsp. enterica
           serovar Typhimurium str. SL1344]
 gi|312912910|dbj|BAJ36884.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhimurium str. T000240]
 gi|320085464|emb|CBY95245.1| probable transcriptional regulator ycf27 OmpR-like protein
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321224559|gb|EFX49622.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Salmonella enterica
           subsp. enterica serovar Typhimurium str. TN061786]
 gi|322616916|gb|EFY13824.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315996572]
 gi|322618154|gb|EFY15046.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-1]
 gi|322625825|gb|EFY22644.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-3]
 gi|322626277|gb|EFY23087.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 495297-4]
 gi|322632691|gb|EFY29436.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-1]
 gi|322639035|gb|EFY35728.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 515920-2]
 gi|322640475|gb|EFY37128.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 531954]
 gi|322646016|gb|EFY42533.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. NC_MB110209-0054]
 gi|322649562|gb|EFY45994.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. OH_2009072675]
 gi|322655470|gb|EFY51778.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. CASC_09SCPH15965]
 gi|322660249|gb|EFY56487.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 19N]
 gi|322662930|gb|EFY59137.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 81038-01]
 gi|322668115|gb|EFY64274.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. MD_MDA09249507]
 gi|322674125|gb|EFY70219.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 414877]
 gi|322675521|gb|EFY71595.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 366867]
 gi|322683065|gb|EFY79081.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 413180]
 gi|322686759|gb|EFY82737.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 446600]
 gi|322714969|gb|EFZ06540.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Choleraesuis str. A50]
 gi|323130200|gb|ADX17630.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhimurium str. 4/74]
 gi|323195350|gb|EFZ80530.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609458-1]
 gi|323199242|gb|EFZ84337.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556150-1]
 gi|323204033|gb|EFZ89048.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 609460]
 gi|323207498|gb|EFZ92446.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 507440-20]
 gi|323211872|gb|EFZ96701.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 556152]
 gi|323217482|gb|EGA02201.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB101509-0077]
 gi|323221983|gb|EGA06372.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB102109-0047]
 gi|323224720|gb|EGA08989.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB110209-0055]
 gi|323231504|gb|EGA15617.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. MB111609-0052]
 gi|323235946|gb|EGA20025.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009083312]
 gi|323240516|gb|EGA24559.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 2009085258]
 gi|323245408|gb|EGA29408.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. 315731156]
 gi|323250179|gb|EGA34071.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2009159199]
 gi|323253627|gb|EGA37455.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008282]
 gi|323255056|gb|EGA38844.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008283]
 gi|323260288|gb|EGA43909.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008284]
 gi|323266880|gb|EGA50366.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008285]
 gi|323270706|gb|EGA54147.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Montevideo str. IA_2010008287]
 gi|326622915|gb|EGE29260.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Dublin str. 3246]
 gi|326627432|gb|EGE33775.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Gallinarum str. 9]
 gi|332988809|gb|AEF07792.1| chemotaxis regulatory protein CheY [Salmonella enterica subsp.
           enterica serovar Typhimurium str. UK-1]
          Length = 129

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF-GFIISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|262275765|ref|ZP_06053574.1| signal transduction histidine kinase [Grimontia hollisae CIP
           101886]
 gi|262219573|gb|EEY70889.1| signal transduction histidine kinase [Grimontia hollisae CIP
           101886]
          Length = 730

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/105 (26%), Positives = 54/105 (51%), Gaps = 3/105 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD + I R++ R L +  G ++ + +S  EA E  +++   + +++D  M G+  +E
Sbjct: 483 VLVVDDNTINREMIRELLSSLGMVISQVSSGEEAIEAVKQQAF-SLILMDLRMAGMDGIE 541

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
               +R++P G+ V V  L             +AG N +L KP +
Sbjct: 542 ATKALRKLPNGSHVPVIALSANTSASMAETCTQAGMNDYLPKPID 586


>gi|224539619|ref|ZP_03680158.1| hypothetical protein BACCELL_04527 [Bacteroides cellulosilyticus
           DSM 14838]
 gi|224518770|gb|EEF87875.1| hypothetical protein BACCELL_04527 [Bacteroides cellulosilyticus
           DSM 14838]
          Length = 375

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 26/93 (27%), Positives = 47/93 (50%), Gaps = 3/93 (3%)

Query: 20  LFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFV 77
           L  +  F +  A++  +A E  +KE  P+ +++D  M  +   E   H++  P   D+ +
Sbjct: 28  LLTNEKFAIATASNGRQALEQVDKEN-PDLVLLDVMMPDMSGFEVAQHLKANPKTADIPI 86

Query: 78  YYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +L        ++ G + GAN F+ KPFN+E L
Sbjct: 87  IFLTALNSTTDIVKGFQVGANDFISKPFNKEEL 119


>gi|91776281|ref|YP_546037.1| response regulator receiver domain-containing protein
           [Methylobacillus flagellatus KT]
 gi|91710268|gb|ABE50196.1| response regulator receiver domain protein (CheY-like)
           [Methylobacillus flagellatus KT]
          Length = 132

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + G+  V EA     A          +++V D +M  +  L 
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGYNNVDEAEDGVMALAKLRSGSF-DFVVSDWNMPNMDGLT 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R  P  + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  MLQQIRADPALSSLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|39996422|ref|NP_952373.1| sigma-54 dependent DNA-binding response regulator [Geobacter
           sulfurreducens PCA]
 gi|39983302|gb|AAR34696.1| sigma-54 dependent DNA-binding response regulator [Geobacter
           sulfurreducens PCA]
          Length = 460

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 61/130 (46%), Gaps = 7/130 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGVLEF 62
           +L+VD    +R+V  +   + G+ V  A S  E  R F E+   P  +V D  M G+  F
Sbjct: 10  VLIVDDDVSLRRVLEYNLQEEGYDVITAGSGEEGLRLFDERS--PALVVTDLKMPGMGGF 67

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  ++     T V V      V  E  +   +AGA  ++ KPFNR+ L+  +++  +M
Sbjct: 68  RLLQEIKGRSPDTAVIVITAFGAV--ETAVDAMKAGAYDYITKPFNRDALKLTVKKALEM 125

Query: 121 QKSKDENQFL 130
                EN+ L
Sbjct: 126 LGLSRENRRL 135


>gi|163846454|ref|YP_001634498.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222524229|ref|YP_002568700.1| winged helix family two component transcriptional regulator
           [Chloroflexus sp. Y-400-fl]
 gi|163667743|gb|ABY34109.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222448108|gb|ACM52374.1| two component transcriptional regulator, winged helix family
           [Chloroflexus sp. Y-400-fl]
          Length = 233

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 48/106 (45%), Gaps = 3/106 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD    + K+ R      GF V  A     A     +E  P  +V+D  + G+  L
Sbjct: 4   TILVVDDEPGIVKIARDYLERAGFQVISAGDGPTALRLARQEH-PALMVLDLMLPGMDGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
           +    +RQ PL   + +  L   V+    + G   GA+ ++ KPF+
Sbjct: 63  DVTRALRQDPLTARLPIIMLTARVEETDRLIGLELGADDYITKPFS 108


>gi|192359670|ref|YP_001982605.1| CheY [Cellvibrio japonicus Ueda107]
 gi|190685835|gb|ACE83513.1| CheY [Cellvibrio japonicus Ueda107]
          Length = 127

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/116 (25%), Positives = 58/116 (50%), Gaps = 12/116 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK-ELLPN----YLVIDESME 57
            +L+VD    +R++ ++L  D GF     ++  EA +      +L N    +LV D +M 
Sbjct: 6   KILIVDDFSTMRRIIKNLLRDLGF-----SNTHEADDGVTALPMLKNGDFQFLVTDWNMP 60

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G+  ++ +  VR       + V  +  E   +++I  A+AG N +++KPF  + L+
Sbjct: 61  GMTGIDLLKAVRADEKLRSLPVLMVTAEAKRDQIIEAAQAGVNGYVVKPFTAQALK 116


>gi|189466029|ref|ZP_03014814.1| hypothetical protein BACINT_02393 [Bacteroides intestinalis DSM
           17393]
 gi|189434293|gb|EDV03278.1| hypothetical protein BACINT_02393 [Bacteroides intestinalis DSM
           17393]
          Length = 375

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 20  LFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVF 76
           L  +  F +  A++  +A E  +KE  P+ +++D     M G  E   H++  P   D+ 
Sbjct: 28  LLTNEKFAIATASNGRQALEQVDKEN-PDLVLLDVMMPDMSG-FEVAQHLKANPKTADIP 85

Query: 77  VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           + +L        ++ G + GAN F+ KPFN+E L
Sbjct: 86  IIFLTALNSTTDIVKGFQVGANDFISKPFNKEEL 119


>gi|83942362|ref|ZP_00954823.1| nitrogen assimilation regulatory protein NtrX [Sulfitobacter sp.
           EE-36]
 gi|83846455|gb|EAP84331.1| nitrogen assimilation regulatory protein NtrX [Sulfitobacter sp.
           EE-36]
          Length = 470

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 58/136 (42%), Gaps = 11/136 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI------DE 54
           M  +L+VD    +R++   +  D GF+   A +  EA      E  P  L+I      D 
Sbjct: 1   MSDILIVDDERDIRELISDILEDEGFVTRLAGNSDEAISAINAE--PPALMILDIWLKDS 58

Query: 55  SMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            M+G+       R  P   DV V  +    + E  +A  + GA  F+ KPFN + L   +
Sbjct: 59  RMDGIDILKTVKRDNP---DVPVVIISGHGNIEIAVAAIKQGAYDFIEKPFNIDQLMVVI 115

Query: 115 RELPQMQKSKDENQFL 130
           R   +  + + EN  L
Sbjct: 116 RRAMETSRLRRENHSL 131


>gi|325106499|ref|YP_004276153.1| histidine kinase [Pedobacter saltans DSM 12145]
 gi|324975347|gb|ADY54331.1| histidine kinase [Pedobacter saltans DSM 12145]
          Length = 1366

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 26/94 (27%), Positives = 47/94 (50%), Gaps = 3/94 (3%)

Query: 26   FMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLME 83
            ++V EA    E  +   KE+ P+ +V D +M  +  +EF + V++  + + + V  L   
Sbjct: 1134 YLVLEARDGVEGLDLALKEV-PDIIVSDVTMPNMDGMEFCSLVKKNEVSSHIPVIMLTAM 1192

Query: 84   VDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                  + G  +GAN +L KPF+ + L   +R L
Sbjct: 1193 ASHLHQVEGLESGANIYLTKPFSVQLLELHIRNL 1226


>gi|24216213|ref|NP_713694.1| serine/threonine phosphatase [Leptospira interrogans serovar Lai
           str. 56601]
 gi|24197469|gb|AAN50712.1| serine/threonine phosphatase containing signal receiver domain REC
           [Leptospira interrogans serovar Lai str. 56601]
          Length = 377

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPN---YLVIDESM--E 57
           ++L VD S I  K+  H    FGF +F A S  +AR      LL N    L++D SM  +
Sbjct: 11  TVLAVDDSEINLKLIVHTLQPFGFQIFTAESAADARNV----LLTNRVDVLLLDVSMPDQ 66

Query: 58  GVLEFIAHVRQM---PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
               F   +R++    L   +F+  +  EV F++ I+    G + F+ KPF  + L   +
Sbjct: 67  DGFSFCRELREIERFKLLPILFITGINREVGFDEAIS---HGGDDFIQKPFQPKELIAKI 123

Query: 115 RELPQMQKSKDE 126
           R   +++  +DE
Sbjct: 124 RAFIRIKILQDE 135


>gi|313145398|ref|ZP_07807591.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides fragilis 3_1_12]
 gi|313134165|gb|EFR51525.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides fragilis 3_1_12]
          Length = 1361

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 6/118 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +LL+++ +  VR+  R LF    + V EA    E  +   KE+ P+ L+I + M  V + 
Sbjct: 1114 TLLIIEDNVDVRQYIRSLFVA-KYTVLEAADGEEGIQVATKEI-PD-LIISDVMMPVKDG 1170

Query: 63   IA---HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             A    +R+      + +  L    +   ++ G+R+GA+ +++KPFN E L+  +  L
Sbjct: 1171 FACCREIRERQETAHIPILMLTARAEDADVLQGSRSGADDYMMKPFNPEVLKAKVENL 1228


>gi|300858078|ref|YP_003783061.1| two-component system transcriptional regulatory protein
           [Corynebacterium pseudotuberculosis FRC41]
 gi|300685532|gb|ADK28454.1| two-component system transcriptional regulatory protein
           [Corynebacterium pseudotuberculosis FRC41]
 gi|302205800|gb|ADL10142.1| Putative two component system response regulator [Corynebacterium
           pseudotuberculosis C231]
 gi|302330359|gb|ADL20553.1| Putative two component system response regulator [Corynebacterium
           pseudotuberculosis 1002]
 gi|308276035|gb|ADO25934.1| two component system response regulator [Corynebacterium
           pseudotuberculosis I19]
          Length = 230

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/117 (31%), Positives = 54/117 (46%), Gaps = 7/117 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +++VD    VR+  R   +  G+ VF A    +A E  EKE  P  +++D     M+G L
Sbjct: 3   IVVVDDEQAVRESLRRSLSFNGYDVFLAEDGVQALEVIEKEQ-PELVILDVMMPRMDG-L 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E    +R    G D  +  L         +AG  AGA+ +L KPF  E L   +R L
Sbjct: 61  EVCRTLRSA--GDDRPILVLTARDGVSDRVAGLDAGADDYLPKPFALEELLARVRSL 115


>gi|157834748|pdb|2CHE|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And Mechanism Of
           Phosphoryl Transfer In Bacterial Chemotaxis
 gi|157834749|pdb|2CHF|A Chain A, Structure Of The Mg2+-Bound Form Of Chey And The Mechanism
           Of Phosphoryl Transfer In Bacterial Chemotaxis
 gi|165760958|pdb|2PL9|A Chain A, Crystal Structure Of Chey-Mg(2+)-Bef(3)(-) In Complex With
           Chez(C19) Peptide Solved From A P2(1)2(1)2 Crystal
 gi|165760959|pdb|2PL9|B Chain B, Crystal Structure Of Chey-Mg(2+)-Bef(3)(-) In Complex With
           Chez(C19) Peptide Solved From A P2(1)2(1)2 Crystal
 gi|165760960|pdb|2PL9|C Chain C, Crystal Structure Of Chey-Mg(2+)-Bef(3)(-) In Complex With
           Chez(C19) Peptide Solved From A P2(1)2(1)2 Crystal
 gi|165760965|pdb|2PMC|A Chain A, Crystal Structure Of Chey-Mg(2+) In Complex With Chez(C15)
           Peptide Solved From A P1 Crystal
 gi|165760966|pdb|2PMC|B Chain B, Crystal Structure Of Chey-Mg(2+) In Complex With Chez(C15)
           Peptide Solved From A P1 Crystal
 gi|165760967|pdb|2PMC|C Chain C, Crystal Structure Of Chey-Mg(2+) In Complex With Chez(C15)
           Peptide Solved From A P1 Crystal
 gi|165760968|pdb|2PMC|D Chain D, Crystal Structure Of Chey-Mg(2+) In Complex With Chez(C15)
           Peptide Solved From A P1 Crystal
          Length = 128

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 8   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF-GFIISDWNMPNMDGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 67  LLKTIRADSAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 115


>gi|94312612|ref|YP_585821.1| response regulator receiver domain-containing protein [Cupriavidus
           metallidurans CH34]
 gi|93356464|gb|ABF10552.1| response regulator receiver domain protein (CheY-like) [Cupriavidus
           metallidurans CH34]
          Length = 127

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/110 (31%), Positives = 52/110 (47%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD S  +R++        G+ V EA+   EA E   +    + LV D+ M  +  L
Sbjct: 5   SILVVDDSPSLRRMTSACLRAGGYGVTEASDGKEAYEVAREGNF-DMLVTDQVMPVMDGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             I  +R MP    V +  L  E D   +     AGA+ FL KPF+ + L
Sbjct: 64  SLIRALRAMPDYATVPMLMLSTEHDDAILERAREAGASGFLAKPFDPDEL 113


>gi|300717106|ref|YP_003741909.1| Chemotaxis regulator, flagellar motor switch components [Erwinia
           billingiae Eb661]
 gi|299062942|emb|CAX60062.1| Chemotaxis regulator, flagellar motor switch components [Erwinia
           billingiae Eb661]
          Length = 129

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD  + +R++ R+L  + GF  V EA    +A          +++V D +M  +  LE
Sbjct: 9   LVVDDFNTMRRIVRNLLKELGFNNVEEAEDGVDALHKLRAGGF-DFVVSDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R       + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRADAAMAKLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|229822479|ref|YP_002884005.1| two component LuxR family transcriptional regulator [Beutenbergia
           cavernae DSM 12333]
 gi|229568392|gb|ACQ82243.1| two component transcriptional regulator, LuxR family [Beutenbergia
           cavernae DSM 12333]
          Length = 222

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/75 (38%), Positives = 40/75 (53%), Gaps = 2/75 (2%)

Query: 43  KELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSF 100
           +EL P+ +++D  M GV  LE    +   P   DV V  L    D E ++   RAGA +F
Sbjct: 45  RELRPDVVLMDIRMPGVDGLEATRRIVASPELRDVRVIVLTTFDDDELVLGAIRAGAAAF 104

Query: 101 LLKPFNRETLRFAMR 115
           LLK  + E LR A+R
Sbjct: 105 LLKDASPEDLRAAVR 119


>gi|190574211|ref|YP_001972056.1| putative two-component response regulator chemotaxis protein CheY
           [Stenotrophomonas maltophilia K279a]
 gi|194365630|ref|YP_002028240.1| response regulator receiver protein [Stenotrophomonas maltophilia
           R551-3]
 gi|254521672|ref|ZP_05133727.1| chemotaxis response regulator [Stenotrophomonas sp. SKA14]
 gi|190012133|emb|CAQ45756.1| putative two-component response regulator chemotaxis protein CheY
           [Stenotrophomonas maltophilia K279a]
 gi|194348434|gb|ACF51557.1| response regulator receiver protein [Stenotrophomonas maltophilia
           R551-3]
 gi|219719263|gb|EED37788.1| chemotaxis response regulator [Stenotrophomonas sp. SKA14]
          Length = 121

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S  +R++        GF V EA     A    + +   N +V D +M  +  + 
Sbjct: 5   ILVVDDSASMRQMVSFALTSAGFAVEEAEDGAVALGRAKGQRF-NAVVTDVNMPNMDGIA 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            I  +RQ+P      +  L  E   +K   G  AGA  +L+KPFN E L
Sbjct: 64  LIRELRQLPDYKFTPLLMLTTESAADKKSEGKAAGATGWLVKPFNPEQL 112


>gi|110634491|ref|YP_674699.1| two component transcriptional regulator [Mesorhizobium sp. BNC1]
 gi|110285475|gb|ABG63534.1| two component transcriptional regulator, winged helix family
           [Chelativorans sp. BNC1]
          Length = 240

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 49/103 (47%), Gaps = 2/103 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           LL+VD    +R + +    + GF V  A +  EAR      L  + LV+D  M G  + +
Sbjct: 21  LLVVDDDTRIRTLLKRFLTEEGFRVTVAANAAEARRKLAG-LDFDLLVLDVMMPGE-DGV 78

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
              R +    DV +  L    + E  + G +AGA+ +L KPF+
Sbjct: 79  GLTRSLRQERDVPILMLTALSETESRVTGLQAGADDYLPKPFD 121


>gi|325527568|gb|EGD04883.1| LuxR family two-component transcriptional regulator [Burkholderia
           sp. TJI49]
          Length = 205

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/118 (29%), Positives = 49/118 (41%), Gaps = 11/118 (9%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK------ELLPNYLVIDE 54
           M +L L+D   ++R     LF   G     A +  +AR F +          P  L+ID 
Sbjct: 1   MRNLYLIDDDDVIRDALDALFRSRGLA---ARAFGDARAFLDAWREGGLARAPACLLIDV 57

Query: 55  SMEGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            + G+   E  A +R   LG    V +L    D    +   RAGA  FL KPF+   L
Sbjct: 58  RIPGMSGFELFAQLRDAGLGAHHAVVFLTGHGDIPMAVDALRAGAYDFLEKPFSDNRL 115


>gi|255007701|ref|ZP_05279827.1| putative two-component system sensor histidine kinase/response
            regulator fusion protein [Bacteroides fragilis 3_1_12]
          Length = 1362

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 32/118 (27%), Positives = 60/118 (50%), Gaps = 6/118 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +LL+++ +  VR+  R LF    + V EA    E  +   KE+ P+ L+I + M  V + 
Sbjct: 1115 TLLIIEDNVDVRQYIRSLFVA-KYTVLEAADGEEGIQVATKEI-PD-LIISDVMMPVKDG 1171

Query: 63   IA---HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             A    +R+      + +  L    +   ++ G+R+GA+ +++KPFN E L+  +  L
Sbjct: 1172 FACCREIRERQETAHIPILMLTARAEDADVLQGSRSGADDYMMKPFNPEVLKAKVENL 1229


>gi|160896103|ref|YP_001561685.1| response regulator receiver protein [Delftia acidovorans SPH-1]
 gi|160361687|gb|ABX33300.1| response regulator receiver protein [Delftia acidovorans SPH-1]
          Length = 120

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S+L VD S  +RK+        GF V EA    +A E  + E + + ++ D++M  + 
Sbjct: 1   MRSILAVDDSPSMRKMVAFTLAGAGFRVVEAVDGVDALEKAQLEQV-DLVLADQNMPRLD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +     +R+ P   +  +  L  E   +   AG  AGA  +L+KPF+   L
Sbjct: 60  GIGLTRKLREDPKFQNTPILILTTESSDQMKQAGRAAGATGWLVKPFDPNRL 111


>gi|94986969|ref|YP_594902.1| CheY-like receiver [Lawsonia intracellularis PHE/MN1-00]
 gi|94731218|emb|CAJ54580.1| CheY-like receiver [Lawsonia intracellularis PHE/MN1-00]
          Length = 126

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 28/111 (25%), Positives = 57/111 (51%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ +++    GF  V EA     A E   KE + +++V D +M  +  +
Sbjct: 9   VLVVDDFSTMRRIIKNILRQLGFNNVVEADDGTTAWEMINKEKI-DFVVSDWNMPQMTGI 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VR     +++    +  E   E +I   +A  +++++KPF  ET++
Sbjct: 68  ELLRKVRASEQYSELPFLMVTAEAQQENIIEAVQAKVSNYIVKPFTAETMK 118


>gi|1065051|pdb|1VLZ|A Chain A, Uncoupled Phosphorylation And Activation In Bacterial
           Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To
           Isoleucine Mutant At Position 87 Of Chey
 gi|1065052|pdb|1VLZ|B Chain B, Uncoupled Phosphorylation And Activation In Bacterial
           Chemotaxis: The 2.1 Angstrom Structure Of A Threonine To
           Isoleucine Mutant At Position 87 Of Chey
          Length = 128

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 8   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY-GFVISDWNMPNMDGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  ++ E   E +IA A+AGA+ +++KPF   TL
Sbjct: 67  LLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGYVVKPFTAATL 115


>gi|15825820|pdb|1JBE|A Chain A, 1.08 A Structure Of Apo-Chey Reveals Meta-Active
           Conformation
          Length = 128

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 8   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY-GFVISDWNMPNMDGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 67  LLKTIRAXXAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 115


>gi|83953582|ref|ZP_00962303.1| nitrogen assimilation regulatory protein NtrX [Sulfitobacter sp.
           NAS-14.1]
 gi|83841527|gb|EAP80696.1| nitrogen assimilation regulatory protein NtrX [Sulfitobacter sp.
           NAS-14.1]
          Length = 470

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 37/136 (27%), Positives = 58/136 (42%), Gaps = 11/136 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI------DE 54
           M  +L+VD    +R++   +  D GF+   A +  EA      E  P  L+I      D 
Sbjct: 1   MSDILIVDDERDIRELISDILEDEGFVTRLAGNSDEAISAINAE--PPALMILDIWLKDS 58

Query: 55  SMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            M+G+       R  P   DV V  +    + E  +A  + GA  F+ KPFN + L   +
Sbjct: 59  RMDGIDILKTVKRDNP---DVPVVIISGHGNIEIAVAAIKQGAYDFIEKPFNIDQLMVVI 115

Query: 115 RELPQMQKSKDENQFL 130
           R   +  + + EN  L
Sbjct: 116 RRAMETSRLRRENHSL 131


>gi|317153073|ref|YP_004121121.1| response regulator receiver [Desulfovibrio aespoeensis Aspo-2]
 gi|316943324|gb|ADU62375.1| response regulator receiver [Desulfovibrio aespoeensis Aspo-2]
          Length = 126

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 55/110 (50%), Gaps = 4/110 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +RK+ +++    GF  + EA     A E   K+ + +++V D +M  +  +
Sbjct: 9   ILVVDDFSTMRKIIKNILRQLGFTNIVEADDGSTAWEVLNKDNI-DFIVSDWNMPTMSGI 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           E +  VR      D+    +  E   E +I   +A  +++++KPF  ETL
Sbjct: 68  ELLRKVRGSEEYADLPFLMVTAEAQQENIIEAVQAKVSNYIVKPFTPETL 117


>gi|148243360|ref|YP_001228517.1| two-component system response regulator [Synechococcus sp. RCC307]
 gi|147851670|emb|CAK29164.1| Two-component system response regulator [Synechococcus sp. RCC307]
          Length = 244

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 59/124 (47%), Gaps = 9/124 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME-----G 58
           +LLVD    +R   +  F D GF+V  A    E  E  + E+ P+ ++ D  M      G
Sbjct: 20  VLLVDDEPGLRTAVQAYFEDEGFIVSTAADGEEGWEKAQSEV-PDVVLSDVMMPRVDGFG 78

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
           +L+ +    ++     +F+    M  D    IAG RAG + ++ KPF+ + L   +R + 
Sbjct: 79  LLKLLREDERLGGTPVIFLTAKGMTAD---RIAGFRAGVDDYIPKPFDPDELVARVRNVV 135

Query: 119 QMQK 122
           Q Q+
Sbjct: 136 QRQE 139


>gi|145295044|ref|YP_001137865.1| hypothetical protein cgR_0988 [Corynebacterium glutamicum R]
 gi|140844964|dbj|BAF53963.1| hypothetical protein [Corynebacterium glutamicum R]
          Length = 255

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/117 (30%), Positives = 53/117 (45%), Gaps = 7/117 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +L+VD    VR   R   +  G+ V  A    +A E  +KE  P  +++D     M+G L
Sbjct: 26  ILVVDDEQAVRDSLRRSLSFNGYNVVLAEDGIQALEMIDKEQ-PALVILDVMMPRMDG-L 83

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E   H+R    G D  +  L    +    + G  AGA+ +L KPF  E L   +R L
Sbjct: 84  EVCRHLRSE--GDDRPILILTARDNVSDRVGGLDAGADDYLAKPFALEELLARVRSL 138


>gi|255264575|ref|ZP_05343917.1| nitrogen assimilation regulatory protein NtrX [Thalassiobium sp.
           R2A62]
 gi|255106910|gb|EET49584.1| nitrogen assimilation regulatory protein NtrX [Thalassiobium sp.
           R2A62]
          Length = 467

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/132 (25%), Positives = 58/132 (43%), Gaps = 9/132 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI-----DES 55
           M  +L+ D    +R++   +  D GF    A S  E     EKE  P  +++     D +
Sbjct: 1   MGDILITDDERDIRELIGDILEDEGFSTRLAGSSNECMAEIEKE-APALMILDIWLKDSA 59

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G+    A  R  P   D+ +  +    + E  +A  + GA  F+ KPFN + L   +R
Sbjct: 60  MDGIDILKAVKRDHP---DIPIVIISGHGNVEIAVAAIKQGAYDFIEKPFNIDQLMVVIR 116

Query: 116 ELPQMQKSKDEN 127
              +  + + EN
Sbjct: 117 RAMETSRLRREN 128


>gi|253700150|ref|YP_003021339.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter sp. M21]
 gi|251775000|gb|ACT17581.1| response regulator receiver modulated diguanylate cyclase
           [Geobacter sp. M21]
          Length = 316

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 49/104 (47%), Gaps = 5/104 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD    +R V   + +  GF V EA S  EA E       P  ++ D  M G+  +E
Sbjct: 3   LLVVDDEETLRSVVSQVLSADGFTVAEAASGEEALEAFRSVSHP-LVITDIRMGGMTGIE 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
            +A +++    T V +  +      +  +   RAGA  +L+KPF
Sbjct: 62  LLAEIKEHNPDTQVVI--MTSHASLDSALTALRAGAYDYLVKPF 103


>gi|225548632|ref|ZP_03769679.1| chemotaxis response regulator [Borrelia burgdorferi 94a]
 gi|225370662|gb|EEH00098.1| chemotaxis response regulator [Borrelia burgdorferi 94a]
          Length = 124

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA----REFCEKELLPNYLVIDESMEGV 59
           +L++D +  +R+   ++    GF V EA    E     +E   +      LVI +     
Sbjct: 5   ILVIDDNRAIRQSVAYILEQNGFGVSEAKDGLEGVLKFKEVVGQGDKDFDLVITDINMPN 64

Query: 60  LEFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L+ I  ++Q+   G+ V +  L  E +  K+  G +AGA  +L+KPFN E L
Sbjct: 65  LDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAGATGWLVKPFNPEAL 116


>gi|163761582|ref|ZP_02168653.1| two component transcriptional regulator, winged helix family
           protein [Hoeflea phototrophica DFL-43]
 gi|162281178|gb|EDQ31478.1| two component transcriptional regulator, winged helix family
           protein [Hoeflea phototrophica DFL-43]
          Length = 235

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 47/105 (44%), Gaps = 6/105 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           LL+VD    +R +      D GF V  A    EAR   E  +  + LVID  M G   L 
Sbjct: 13  LLVVDDDTRIRDLLSRYLTDQGFRVTTAADASEARRKLEG-IDFDLLVIDVMMPGESGLS 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
               +R++     V +  L    + +  I G  AGA+ +L KPFN
Sbjct: 72  LTRSLREIKT---VPILMLTALAEGDARIDGLEAGADDYLAKPFN 113


>gi|28198322|ref|NP_778636.1| response regulator [Xylella fastidiosa Temecula1]
 gi|182680961|ref|YP_001829121.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Xylella fastidiosa M23]
 gi|28056392|gb|AAO28285.1| response regulator [Xylella fastidiosa Temecula1]
 gi|182631071|gb|ACB91847.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Xylella fastidiosa M23]
          Length = 384

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 9/129 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKE----LLPNYLVIDESM 56
           ++++VD     R + RH+  D      VF+     EA  +CE      LL +Y + D  M
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPHLQVFDFGDPSEALAWCEVSQVDLLLLDYRMPD--M 86

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +G LEF   + Q+P   D+ +  + +  D     A   AG   FL+KP     LR     
Sbjct: 87  DG-LEFAMRLHQLPNRRDIPILLITIVGDEPIRQAALDAGVIDFLIKPIRPRELRARCNN 145

Query: 117 LPQMQKSKD 125
           L Q+++  +
Sbjct: 146 LLQLRQHSE 154


>gi|254252839|ref|ZP_04946157.1| Response regulator [Burkholderia dolosa AUO158]
 gi|124895448|gb|EAY69328.1| Response regulator [Burkholderia dolosa AUO158]
          Length = 461

 Score = 40.0 bits (92), Expect = 0.11,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARTALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  +E Q L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIEEVQSLRA 133


>gi|332520078|ref|ZP_08396542.1| response regulator receiver [Lacinutrix algicola 5H-3-7-4]
 gi|332044637|gb|EGI80831.1| response regulator receiver [Lacinutrix algicola 5H-3-7-4]
          Length = 227

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 65/127 (51%), Gaps = 6/127 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           LL+ D   I+  VG +L  + G+ V  A++  E  +  +KE  P+ +++D     M+G+ 
Sbjct: 9   LLVDDEPDILEIVGYNLSKE-GYQVSTASNGVEGVKKAKKEK-PHLIILDVMMPEMDGI- 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R++P   +  + +L    +    +AG  AGA+ ++ KP   + L   ++ L + 
Sbjct: 66  EACEQIRKVPELKNTIITFLTARGEDYSQVAGFDAGADDYITKPIKPKLLLSKVKALLRR 125

Query: 121 QKSKDEN 127
            K+++ N
Sbjct: 126 LKAEEGN 132


>gi|294339825|emb|CAZ88188.1| Chemotaxis protein cheY [Thiomonas sp. 3As]
          Length = 134

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 59/115 (51%), Gaps = 10/115 (8%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM---VFEATSVCEAREFCEKELLPNYLVIDESM---EG 58
           L+VD    +R++ R L    G++   + EA +  EA    +   +  ++V D +M   +G
Sbjct: 4   LVVDDFPTMRRIVRGLLMQTGYVTGNIDEAENGEEAWRRLQAGGI-EFVVTDWNMPVMQG 62

Query: 59  VLEFIAHVRQM--PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + + + H+R    P    + V  +  E   E +IA A+AG N +++KPF  +TL+
Sbjct: 63  I-DLLKHIRASDNPAIRSLPVLMVTAEAKKENIIAAAQAGVNGYIVKPFTAQTLK 116


>gi|45656576|ref|YP_000662.1| response regulator [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
 gi|45599811|gb|AAS69299.1| response regulator [Leptospira interrogans serovar Copenhageni str.
           Fiocruz L1-130]
          Length = 377

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 39/132 (29%), Positives = 64/132 (48%), Gaps = 15/132 (11%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPN---YLVIDESM--E 57
           ++L VD S I  K+  H    FGF +F A S  +AR      LL N    L++D SM  +
Sbjct: 11  TVLAVDDSEINLKLIVHTLQPFGFQIFTAESAADARNV----LLTNRIDVLLLDVSMPDQ 66

Query: 58  GVLEFIAHVRQM---PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
               F   +R++    L   +F+  +  EV F++ I+    G + F+ KPF  + L   +
Sbjct: 67  DGFSFCRELREIERFKLLPILFITGINREVGFDEAIS---HGGDDFIQKPFQPKELIAKI 123

Query: 115 RELPQMQKSKDE 126
           R   +++  +DE
Sbjct: 124 RAFIRIKILQDE 135


>gi|15602084|ref|NP_245156.1| two-component response regulator [Pasteurella multocida subsp.
           multocida str. Pm70]
 gi|12720444|gb|AAK02303.1| ArcA [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 236

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+   I R   + +F   G+ VFEA    +       +++ N +++D ++ G    
Sbjct: 5   QILIVEDEAITRNTLKSIFEAEGYEVFEAADGAQMHRILSNKVI-NLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
           +   R++   T+  + +L    +    I G   GA+ ++ KPFN   L    R L  +Q+
Sbjct: 64  ML-ARELRETTNTALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL--LQR 120

Query: 123 SKDEN 127
           +  EN
Sbjct: 121 TMQEN 125


>gi|220932529|ref|YP_002509437.1| response regulator receiver protein [Halothermothrix orenii H 168]
 gi|219993839|gb|ACL70442.1| response regulator receiver protein [Halothermothrix orenii H 168]
          Length = 117

 Score = 40.0 bits (92), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 65/120 (54%), Gaps = 7/120 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M ++L+VD +  +R   +++  D   +V EA +  EA E  + EL P+ + +D +M  + 
Sbjct: 1   MKTVLIVDDAAFMRLNLKNILKDDYEIVGEAKNGQEAVEMYQ-ELNPDIVTMDITMPVMD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGA-RAGANSFLLKPFNRETLRFAMREL 117
            LE I  ++ +    ++ V   + +   +KMI  A  AGA  F++KPF  E +  A+++L
Sbjct: 60  GLEAIRAIKDIDPDANIIVCSAMGQ---QKMIIEAIEAGAKDFIVKPFKEERVIEAVKKL 116


>gi|119952783|ref|YP_950374.1| putative two-component system response regulator [Arthrobacter
           aurescens TC1]
 gi|119951913|gb|ABM10822.1| putative two-component system response regulator [Arthrobacter
           aurescens TC1]
          Length = 259

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/123 (23%), Positives = 56/123 (45%), Gaps = 2/123 (1%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIA 64
           ++++    +R     +F   GF V  A+S  E  E   KE  P+ + ID  +    + + 
Sbjct: 8   VVIEDDEDIRAAVAEIFRQSGFAVHAASSGSEGLERV-KEHNPDIVTIDIGLPD-FDGLE 65

Query: 65  HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSK 124
             R++   +D +V  +    D    + G  AGA+ ++ KPF    LR  ++ + +  +S 
Sbjct: 66  ASRRIRTFSDAYVIIVSGRADEADALMGFEAGADDYITKPFRPRELRARIKAMLRRPRST 125

Query: 125 DEN 127
            +N
Sbjct: 126 HQN 128


>gi|1942869|pdb|6CHY|A Chain A, Structure Of Chemotaxis Protein Chey
 gi|1942870|pdb|6CHY|B Chain B, Structure Of Chemotaxis Protein Chey
          Length = 128

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 8   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY-GFVISDWNMPNMDGLE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  ++ E   E +IA A+AGA+ +++KPF   TL
Sbjct: 67  LLKTIRADGAMSALPVLMVIAEAKKENIIAAAQAGASGWVVKPFTAATL 115


>gi|294505895|ref|YP_003569953.1| two-component system sensor histidine kinase/response regulator,
           hybrid [Salinibacter ruber M8]
 gi|294342223|emb|CBH23001.1| two-component system sensor histidine kinase/response regulator,
           hybrid [Salinibacter ruber M8]
          Length = 802

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 33/111 (29%), Positives = 53/111 (47%), Gaps = 6/111 (5%)

Query: 3   SLLLVDSSHIVRKVGR-HLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           ++L++D + +V  + R HL  ++   V EA    E      + LLP+ ++ D  M  V  
Sbjct: 534 TVLVIDDNSVVCTLVRTHLEPEY--RVEEAHDGAEGYTLA-RTLLPDLVISDVMMPEVDG 590

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            E    ++Q P    V V +L    D E  + G   GA+++L KPF  E L
Sbjct: 591 FELCRKIKQDPDIDHVPVVFLTARADLEDKVEGLDVGADAYLTKPFEPEAL 641


>gi|154174704|ref|YP_001407722.1| putative chemotaxis protein CheY-like protein [Campylobacter curvus
           525.92]
 gi|112803634|gb|EAU00978.1| putative Chemotaxis protein CheY-like protein [Campylobacter curvus
           525.92]
          Length = 139

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 27/112 (24%), Positives = 53/112 (47%), Gaps = 3/112 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +L+VD S  +R++ ++     G   + EA    EA     +    + L+ D +M  +  
Sbjct: 20  KILVVDDSSTMRRIIKNTLQRLGHQEILEAEHGLEAWNLMAQHSDIDVLITDWNMPEMNG 79

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           LE +  VR      D+ +  +  E    ++I   +AG N++++KPF  + L+
Sbjct: 80  LELVKKVRAEQKYVDMPIIMVTTEGGKAEVITALKAGVNNYIVKPFTPQVLK 131


>gi|77462995|ref|YP_352499.1| chemotaxis response regulator, CheY1 [Rhodobacter sphaeroides
           2.4.1]
 gi|77387413|gb|ABA78598.1| chemotaxis response regulator, CheY1 [Rhodobacter sphaeroides
           2.4.1]
          Length = 122

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 5/118 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L +D S  +R++ R      GF V  A    +  E  E    P+ ++ D     M+G 
Sbjct: 4   TVLAIDDSRTIRELLREALMQAGFEVHLAIDGLDGLEKLEAAK-PHAVITDINMPRMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             FI  VR+ P  + + +  L  E   E       AGA ++++KPF+   L  A+R +
Sbjct: 62  FGFIRAVREQPQHSALPIIVLTTESAAELKAKAREAGATAWIVKPFDEAKLVSALRRV 119


>gi|85716086|ref|ZP_01047062.1| helix-turn-helix, Fis-type protein [Nitrobacter sp. Nb-311A]
 gi|85697085|gb|EAQ34967.1| helix-turn-helix, Fis-type protein [Nitrobacter sp. Nb-311A]
          Length = 498

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/130 (25%), Positives = 61/130 (46%), Gaps = 6/130 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGF--MVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           ++L+VD   + R++  ++    G+  MV E+     A          + LV+D  M G+ 
Sbjct: 4   TILIVDDDAVQRRLVENMVRRCGYETMVVESGDAAVAAVTASDGPAIDALVLDLVMPGLD 63

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +  +A +R+  L   V V      +D   +++  RAGA+ F++KP   E L+ ++R   
Sbjct: 64  GMGVLAGIREAGLNIPVIVQTAHGGID--NVVSAMRAGAHDFVVKPVGIERLQVSLRNAL 121

Query: 119 QMQKSKDENQ 128
                K+E Q
Sbjct: 122 NASALKNELQ 131


>gi|330445298|ref|ZP_08308950.1| diguanylate cyclase domain protein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
 gi|328489489|dbj|GAA03447.1| diguanylate cyclase domain protein [Photobacterium leiognathi
           subsp. mandapamensis svers.1.1.]
          Length = 405

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 32/124 (25%), Positives = 52/124 (41%), Gaps = 2/124 (1%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGVLEF 62
           L+VD S +VR     L       V+EA+   EA +  E     + ++ D  M  +  +  
Sbjct: 127 LVVDDSDMVRNHVSSLLKKQNLTVYEASDGNEALQIIENNPDISLVITDNDMPEKDGITM 186

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+      + V  L    D        +AGAN FL KPFN+E     +  +  M+ 
Sbjct: 187 TREIRREHSRNKMAVLGLSGSNDSTMTAQFLKAGANDFLYKPFNQEEFNCRIHHILNMKD 246

Query: 123 SKDE 126
           + D+
Sbjct: 247 TSDK 250


>gi|325285338|ref|YP_004261128.1| histidine kinase [Cellulophaga lytica DSM 7489]
 gi|324320792|gb|ADY28257.1| histidine kinase [Cellulophaga lytica DSM 7489]
          Length = 1436

 Score = 40.0 bits (92), Expect = 0.12,   Method: Composition-based stats.
 Identities = 28/117 (23%), Positives = 58/117 (49%), Gaps = 6/117 (5%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
            LL++D +  +R   +    +  + ++EA +  +  E  +K  +PN ++ D     M+G+ 
Sbjct: 1182 LLIIDDNPDIRSFIKKGLGE-SYYIYEAENGQKGLELAKK-FIPNIVITDLVMPVMDGI- 1238

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            EF   ++     + + V  L  +   EK I G + GA++++ KPF+ E L   +  +
Sbjct: 1239 EFCNQIKSTQETSHIPVVMLTAKTSQEKEIEGLKTGADAYIRKPFDLELLEIKLSNI 1295


>gi|254465413|ref|ZP_05078824.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Rhodobacterales bacterium Y4I]
 gi|206686321|gb|EDZ46803.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Rhodobacterales bacterium Y4I]
          Length = 469

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 34/135 (25%), Positives = 58/135 (42%), Gaps = 9/135 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID-----ES 55
           M  +L+VD    +R++   +  D G+   +A S  E     E E  P  +++D       
Sbjct: 1   MSDILIVDDERDIRELISDILEDEGYATRKAGSSDECMARLE-EAKPALMILDIWLKDSQ 59

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G+       R  P   D+ V  +    + E  +A  + GA  F+ KPFN + L   +R
Sbjct: 60  MDGIDILKTVKRDTP---DIPVVIISGHGNIEIAVAAIKQGAYDFIEKPFNIDQLMVVIR 116

Query: 116 ELPQMQKSKDENQFL 130
              +  + + EN  L
Sbjct: 117 RAMETSRLRRENSDL 131


>gi|116624973|ref|YP_827129.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
 gi|116228135|gb|ABJ86844.1| response regulator receiver protein [Candidatus Solibacter usitatus
           Ellin6076]
          Length = 232

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 57/121 (47%), Gaps = 9/121 (7%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           + +L+VD + +  K+ R L  + G+ V  A S  EA E   +   P  ++ D  + G+  
Sbjct: 4   EPILIVDDTPVNLKLTRILLVNEGYKVLTAASAEEALELL-RGYQPRLVLADIQLPGIDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLL---MEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           LE    ++Q     D  V  L    M+ D ++ I    AG + +L+KP +  +    +RE
Sbjct: 63  LEMTRRIKQDERTRDTLVVALTAFAMKGDEQRAI---EAGCDGYLVKPIDTRSFGGKIRE 119

Query: 117 L 117
           L
Sbjct: 120 L 120


>gi|121596078|ref|YP_987974.1| response regulator receiver protein [Acidovorax sp. JS42]
 gi|222112234|ref|YP_002554498.1| response regulator receiver protein [Acidovorax ebreus TPSY]
 gi|120608158|gb|ABM43898.1| response regulator receiver protein [Acidovorax sp. JS42]
 gi|221731678|gb|ACM34498.1| response regulator receiver protein [Acidovorax ebreus TPSY]
          Length = 120

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 30/108 (27%), Positives = 51/108 (47%), Gaps = 3/108 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S+L VD S  +RK+        G+ V EA    +A E  E   + + ++ D++M  + 
Sbjct: 1   MQSILAVDDSPSMRKMVSFTLTGAGYHVVEAVDGQDALEKAETHDI-HLVLADQNMPRLD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            +     +R+ P    + +  L  E   +   AG  AGA  +L+KPF+
Sbjct: 60  GIGLTRKLREHPRFKSIPILILTTESSDQMKQAGRSAGATGWLVKPFD 107


>gi|71897688|ref|ZP_00679933.1| Response regulator receiver:Metal-dependent phosphohydrolase, HD
           subdomain [Xylella fastidiosa Ann-1]
 gi|71732591|gb|EAO34644.1| Response regulator receiver:Metal-dependent phosphohydrolase, HD
           subdomain [Xylella fastidiosa Ann-1]
          Length = 365

 Score = 40.0 bits (92), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 9/129 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKE----LLPNYLVIDESM 56
           ++++VD     R + RH+  D      VF+     EA  +CE      LL +Y + D  M
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPHLQVFDFGDPSEALAWCEVSQVDLLLLDYRMPD--M 86

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +G LEF   + Q+P   D+ +  + +  D     A   AG   FL+KP     LR     
Sbjct: 87  DG-LEFALRLHQLPNRRDIPILLITIVGDEPIRQAALDAGVIDFLIKPIRPRELRARCNN 145

Query: 117 LPQMQKSKD 125
           L Q+++  +
Sbjct: 146 LLQLRQHSE 154


>gi|253688982|ref|YP_003018172.1| response regulator receiver protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
 gi|251755560|gb|ACT13636.1| response regulator receiver protein [Pectobacterium carotovorum
           subsp. carotovorum PC1]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALNKLRAGAF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLQTIRADGSLSSLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|254420539|ref|ZP_05034263.1| hypothetical protein BBAL3_2849 [Brevundimonas sp. BAL3]
 gi|196186716|gb|EDX81692.1| hypothetical protein BBAL3_2849 [Brevundimonas sp. BAL3]
          Length = 122

 Score = 39.7 bits (91), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 35/112 (31%), Positives = 54/112 (48%), Gaps = 7/112 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           S+L VD S  +R   +    + G+ V EA +  E  E  +     + ++ D     M+G 
Sbjct: 4   SILTVDDSPSIRVALKIALTNAGYSVAEAVNGAEGIEKAKASAF-DLIITDLNMPVMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARA-GANSFLLKPFNRETL 110
           L  I  +R+MP    V + +L  E D E   A A+A GA  +L KPF+ + L
Sbjct: 62  LTMIEEMRRMPDQMGVPIVFLTTESD-EGFKARAKAAGATGWLTKPFDPDQL 112


>gi|284164248|ref|YP_003402527.1| response regulator receiver protein [Haloterrigena turkmenica DSM
           5511]
 gi|284013903|gb|ADB59854.1| response regulator receiver protein [Haloterrigena turkmenica DSM
           5511]
          Length = 120

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 54/115 (46%), Gaps = 1/115 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD SH +R + R +      ++ EA++  EA +   KE  P+ +++D  M      
Sbjct: 4   GVLIVDDSHFMRNLLRQILEQDYRILGEASNGAEAVKL-YKEHDPDIVMMDIVMPKCNGI 62

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            A      +  D  V         EKM    +AGA+ ++ KPF   ++R A+ ++
Sbjct: 63  KATAAIKKIDPDARVIMCTSVGQREKMKLAVKAGADGYVTKPFEEPSVRKALTDV 117


>gi|163848921|ref|YP_001636965.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|163670210|gb|ABY36576.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 3   SLLLVDSSH-IVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           ++L+VD    IV  V  +L N+ GF+V  A     A     + + P+ +V+D  + G L+
Sbjct: 5   TILVVDDEQPIVDLVSSYLTNE-GFVVHRAYDGPGALALA-RSVKPDLVVLDVMLPG-LD 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            I   RQ+   T VFV  L    D    + G   GA+ +L KPF+
Sbjct: 62  GIEVCRQLHRDTSVFVLMLTARADEIDKLIGLSVGADDYLTKPFS 106


>gi|301059927|ref|ZP_07200811.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
 gi|300445982|gb|EFK09863.1| response regulator receiver domain protein [delta proteobacterium
           NaphS2]
          Length = 386

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 53/115 (46%), Gaps = 3/115 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +LLVD    +R V      D+G+ V  A S  EA     K+  P+ ++ D  M G ++
Sbjct: 3   EKILLVDDEEGIRTVLGIALADYGYEVLTAASGGEAVSVFRKQK-PSIVLTDIKMPG-MD 60

Query: 62  FIAHVRQMPLGT-DVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            I  +R++   + D  V  +    D E  I   +  A  F+ KP N + L  A++
Sbjct: 61  GIQVLRKIKEESPDTEVIMITGHGDLELAIESLKCDATDFITKPINDDALEIALK 115


>gi|284053232|ref|ZP_06383442.1| two component transcriptional regulator [Arthrospira platensis str.
           Paraca]
 gi|291565873|dbj|BAI88145.1| two-component response regulator [Arthrospira platensis NIES-39]
          Length = 233

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/134 (25%), Positives = 64/134 (47%), Gaps = 12/134 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M+ L++ D   I   + R L  + GF    + +   A E  +++  P+ +++D  + G+ 
Sbjct: 1   MNILIVEDEPEIALLIRRTLEGE-GFSCQISQNGLSALEIFQQQR-PDVIILDLMLPGLD 58

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETL 110
            LE  A +RQ P   D ++  L  + +    I G   GA+ +++KPF+        R  L
Sbjct: 59  GLEVCARIRQQPGQKDPYILMLTAKGEEIDRIVGLSTGADDYMVKPFSPRELVARVRALL 118

Query: 111 RFAMRELPQMQKSK 124
           R ++R+  Q Q  +
Sbjct: 119 RRSLRQGGQTQTHQ 132


>gi|257052642|ref|YP_003130475.1| response regulator receiver protein [Halorhabdus utahensis DSM
           12940]
 gi|256691405|gb|ACV11742.1| response regulator receiver protein [Halorhabdus utahensis DSM
           12940]
          Length = 124

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 57/122 (46%), Gaps = 5/122 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           +S+L+VD    +R++ RH F   GF V       EA +       P+ LV+D  M  +  
Sbjct: 3   ESILVVDDDTTIRQLLRHRFEAAGFEVRVCEDGQEAADLLSTGFEPDALVVDVMMPRLNG 62

Query: 60  LEFIAHVR--QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF-NRETLRFAMRE 116
              +  +R  ++ + TD+ V  L      E ++ G  AG + ++ KPF + E L    R 
Sbjct: 63  TRLVRMLRNGELAVRTDLPVVMLTSRGREEHVLEGFDAGVDDYVSKPFRSAELLARVRRH 122

Query: 117 LP 118
           LP
Sbjct: 123 LP 124


>gi|222526878|ref|YP_002571349.1| winged helix family two component transcriptional regulator
           [Chloroflexus sp. Y-400-fl]
 gi|222450757|gb|ACM55023.1| two component transcriptional regulator, winged helix family
           [Chloroflexus sp. Y-400-fl]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 34/105 (32%), Positives = 52/105 (49%), Gaps = 4/105 (3%)

Query: 3   SLLLVDSSH-IVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           ++L+VD    IV  V  +L N+ GF+V  A     A     + + P+ +V+D  + G L+
Sbjct: 5   TILVVDDEQPIVDLVSSYLTNE-GFVVHRAYDGPGALALA-RSVKPDLVVLDVMLPG-LD 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            I   RQ+   T VFV  L    D    + G   GA+ +L KPF+
Sbjct: 62  GIEVCRQLHRDTSVFVLMLTARADEIDKLIGLSVGADDYLTKPFS 106


>gi|120613015|ref|YP_972693.1| response regulator receiver protein [Acidovorax citrulli AAC00-1]
 gi|326319055|ref|YP_004236727.1| response regulator receiver protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|120591479|gb|ABM34919.1| response regulator receiver protein [Acidovorax citrulli AAC00-1]
 gi|323375891|gb|ADX48160.1| response regulator receiver protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 120

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 51/112 (45%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M S+L VD S  +RK+        G+ V EA    +A E  E   +   ++ D++M  + 
Sbjct: 1   MQSILAVDDSPSMRKMVSFTLTGAGYHVVEAVDGQDALEKAETHDI-QLVLADQNMPRLD 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +     +R+ P    + +  L  E   +   AG  AGA  +L+KPF+   L
Sbjct: 60  GIGLTRKLREHPRFKTIPILILTTESSDQMKQAGRNAGATGWLVKPFDPNRL 111


>gi|186681953|ref|YP_001865149.1| LuxR family transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186464405|gb|ACC80206.1| two component transcriptional regulator, LuxR family [Nostoc
           punctiforme PCC 73102]
          Length = 231

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    +R+  +    + GF V  A++  E  E+ +    P+ ++ D  M  V   +
Sbjct: 5   LLLVDDEPGIREAVKDYLQESGFSVQVASNALEGWEWMQMN-TPDLVISDVMMPQVDGYQ 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+  +R+ P    + V +L  +      I G  AG +++L KPF+ + L
Sbjct: 64  FLKQLREDPRFQALPVVFLTAKGMTGDRIQGYHAGVDAYLPKPFDPDEL 112


>gi|126461869|ref|YP_001042983.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|332557871|ref|ZP_08412193.1| CheY1 [Rhodobacter sphaeroides WS8N]
 gi|510670|emb|CAA56329.1| cheY [Rhodobacter sphaeroides]
 gi|7532758|emb|CAB87133.1| chemotaxis response regulator [Rhodobacter sphaeroides]
 gi|126103533|gb|ABN76211.1| response regulator receiver protein [Rhodobacter sphaeroides ATCC
           17029]
 gi|332275583|gb|EGJ20898.1| CheY1 [Rhodobacter sphaeroides WS8N]
          Length = 122

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 54/118 (45%), Gaps = 5/118 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGV 59
           ++L +D S  +R++ R      GF V  A    +  E  E    P+ ++ D     M+G 
Sbjct: 4   TVLAIDDSRTIRELLREALVQAGFEVHLAIDGLDGLEKLEAAK-PHAVITDINMPRMDG- 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             FI  VR+ P  + + +  L  E   E       AGA ++++KPF+   L  A+R +
Sbjct: 62  FGFIRAVREQPQHSALPIIVLTTESAAELKAKAREAGATAWIVKPFDEAKLVSALRRV 119


>gi|329851142|ref|ZP_08265899.1| cheY protein [Asticcacaulis biprosthecum C19]
 gi|328839988|gb|EGF89560.1| cheY protein [Asticcacaulis biprosthecum C19]
          Length = 128

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 36/113 (31%), Positives = 57/113 (50%), Gaps = 8/113 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNY-LVI-DESMEGVL 60
           +L+VD    + ++  +L    GF  V EA+   EA +  +K    NY LVI D +ME + 
Sbjct: 9   VLVVDDYKTMLRIISNLLKQLGFENVEEASDGTEALDKMKKS---NYGLVISDWNMEPMT 65

Query: 61  --EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             E +  VR   +        +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 66  GYELLLKVRADDVLKRTPFIMVTAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|308187226|ref|YP_003931357.1| Chemotaxis protein cheY [Pantoea vagans C9-1]
 gi|308057736|gb|ADO09908.1| Chemotaxis protein cheY [Pantoea vagans C9-1]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 58/113 (51%), Gaps = 12/113 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESMEGV 59
           L+VD  + +R++ R+L  + GF      +V EA +  +     K    ++++ D +M  +
Sbjct: 9   LVVDDFNTMRRIVRNLLKELGF-----NNVEEAEDGVDALGKLKAGGFDFVISDWNMPNM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             L+ +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 64  DGLQLLQTIRADAAMSSLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|313682761|ref|YP_004060499.1| response regulator receiver modulated diguanylate cyclase
           [Sulfuricurvum kujiense DSM 16994]
 gi|313155621|gb|ADR34299.1| response regulator receiver modulated diguanylate cyclase
           [Sulfuricurvum kujiense DSM 16994]
          Length = 428

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 31/120 (25%), Positives = 61/120 (50%), Gaps = 5/120 (4%)

Query: 4   LLLVDSSHI-VRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD   + +  V   L +++  +V  AT+  +A +    +  P+ +++D  M G+   
Sbjct: 9   ILIVDDEPLNISIVAEILNHEYDLLV--ATNGEKALQIVSLDPKPDLILLDIMMPGMNGF 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++++P    + + +L  + D E +I G  AGA  F+ KPF +E L   ++   QM
Sbjct: 67  EVAKRLKEIPETFQIPIIFLTAKHDSESIIKGFEAGAVDFVSKPFQKEELLARIKNTLQM 126


>gi|293400081|ref|ZP_06644227.1| DNA-binding response regulator [Erysipelotrichaceae bacterium
           5_2_54FAA]
 gi|291306481|gb|EFE47724.1| DNA-binding response regulator [Erysipelotrichaceae bacterium
           5_2_54FAA]
          Length = 229

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 56/103 (54%), Gaps = 4/103 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD +  +R+V   L ++ G++V EA +  EA   CE + L   +++D  M G+  F
Sbjct: 4   NVLIVDDNKEIREVVNVLLSNEGYIVNEADNGAEAITKCEAQDL---IILDIMMPGMDGF 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
               R++   T+V + +L  +   +    G  +G + +L+KPF
Sbjct: 61  -KTCRRIRELTNVPILFLTSKTLDQDKEDGFNSGGDDYLIKPF 102


>gi|260913715|ref|ZP_05920191.1| aerobic respiration control protein ArcA [Pasteurella dagmatis ATCC
           43325]
 gi|260632254|gb|EEX50429.1| aerobic respiration control protein ArcA [Pasteurella dagmatis ATCC
           43325]
          Length = 236

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+   I R   + +F   G+ VFEA    +       +++ N +++D ++ G    
Sbjct: 5   QILIVEDEAITRNTLKSIFEAEGYEVFEAADGAQMHRILSNKVI-NLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
           +   R++   T+  + +L    +    I G   GA+ ++ KPFN   L    R L  +Q+
Sbjct: 64  ML-ARELRETTNTALMFLTGRDNEVDKILGLEIGADDYITKPFNPRELTIRARNL--LQR 120

Query: 123 SKDEN 127
           +  EN
Sbjct: 121 TMQEN 125


>gi|154249283|ref|YP_001410108.1| response regulator receiver modulated diguanylate cyclase
           [Fervidobacterium nodosum Rt17-B1]
 gi|154153219|gb|ABS60451.1| response regulator receiver modulated diguanylate cyclase
           [Fervidobacterium nodosum Rt17-B1]
          Length = 474

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 53/119 (44%), Gaps = 3/119 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD S   R V  ++F   G+ V       +A E   KE  P+ ++ D +M G+ 
Sbjct: 1   MKKILIVDDSKFWRLVLENIFKSRGYEVIVTEDATKAIEIALKEY-PDVIISDYNMPGIS 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            L+   ++R +P  ++  +  L    D         +GAN F+ K   ++ L   + E 
Sbjct: 60  GLQLCLYLRSIPAFSNAGIAVLTGSDDVINQFWAEHSGANKFISKLLTKDELERVLLEF 118


>gi|114319521|ref|YP_741204.1| CheA signal transduction histidine kinases [Alkalilimnicola ehrlichii
            MLHE-1]
 gi|114225915|gb|ABI55714.1| CheA signal transduction histidine kinase [Alkalilimnicola ehrlichii
            MLHE-1]
          Length = 1834

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 58/127 (45%), Gaps = 3/127 (2%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
            +++VD S  +RKV   L       V  A    EA    E+++ P+ +++D  M  +   E
Sbjct: 1706 VMVVDDSITMRKVATRLLERNHMDVVTARDGMEALTRLEQQV-PDVMLLDIEMPRMDGFE 1764

Query: 62   FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               H+R  P  ++V +  +   V  +        G   ++ KP+    L  A+REL + +
Sbjct: 1765 LATHMRNQPEFSEVPIIMITSRVGDKHRRRAEDIGVQRYMGKPYQESELLAAIRELVEGR 1824

Query: 122  KSKDENQ 128
            + +DE +
Sbjct: 1825 RPQDEEE 1831


>gi|83593493|ref|YP_427245.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Rhodospirillum rubrum ATCC 11170]
 gi|83576407|gb|ABC22958.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Rhodospirillum rubrum ATCC 11170]
          Length = 511

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/104 (29%), Positives = 51/104 (49%), Gaps = 13/104 (12%)

Query: 30  EATSVCEAREFCEKELLPNYLVID---ESMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDF 86
           EA +V E R        P+ +++D     M+G +E +  VR +PL   V +  +      
Sbjct: 87  EALAVLERRP-------PSLMLLDIHLPDMDG-MEILRRVRSLPLSMGVVM--ITSNASI 136

Query: 87  EKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFL 130
              +A  +AGAN FL+KPF+R+ L   +R +   Q+   E + L
Sbjct: 137 SLAVAAMQAGANDFLVKPFSRDRLMVTLRNVIDNQRLSREVETL 180


>gi|327440492|dbj|BAK16857.1| response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Solibacillus silvestris
           StLB046]
          Length = 226

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 64/134 (47%), Gaps = 15/134 (11%)

Query: 1   MDSLLLVDSS-HIVRKVGRHLFNDFGFMVFEATSVCEA-----REFCEKELLPNYLVIDE 54
           M ++L+VD   +I++ V  HL ++ GF VF+A    EA     RE C+       L + +
Sbjct: 1   MTTILIVDDDINILQLVNIHL-SEAGFKVFQAKDGTEALGILNREVCD-------LAVVD 52

Query: 55  SMEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
            M   ++  A  R +    D+ V  L  +   E    G ++G + +L+KPF  + L F +
Sbjct: 53  VMMPFMDGYALTRVIRKKYDIPVILLTAKNQIEDKEIGYKSGTDDYLVKPFEPKELNFRI 112

Query: 115 RE-LPQMQKSKDEN 127
              L +  K  DE+
Sbjct: 113 EALLRRYDKQSDES 126


>gi|307131621|ref|YP_003883637.1| chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components cheY [Dickeya dadantii 3937]
 gi|306529150|gb|ADM99080.1| Chemotaxis regulator - transmits chemoreceptor signals to
           flagelllar motor components CheY [Dickeya dadantii 3937]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALNKLRSGGF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLQAIRADGTLSKLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|322420858|ref|YP_004200081.1| Fis family two component sigma54 specific transcriptional regulator
           [Geobacter sp. M18]
 gi|320127245|gb|ADW14805.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Geobacter sp. M18]
          Length = 457

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/132 (24%), Positives = 59/132 (44%), Gaps = 7/132 (5%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEG 58
           +++L+VD    +R     +  D G+    A    EA   C KE LP  +++D     M+G
Sbjct: 3   ETILIVDDEEGIRSSLAGILEDEGYRTVCAADGTEALALCNKE-LPGLVLLDIWMPKMDG 61

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
           + E +  +++   G +V +  +      E  +   + GA  F+ KP + E +   +    
Sbjct: 62  I-ETLKRLKEQHPGLNVIM--MSGHGTIETAVKSTKLGAYDFIEKPLSLEKVVVTVENAL 118

Query: 119 QMQKSKDENQFL 130
            M + K+EN  L
Sbjct: 119 SMNRLKEENATL 130


>gi|218782319|ref|YP_002433637.1| response regulator receiver modulated diguanylate cyclase
           [Desulfatibacillum alkenivorans AK-01]
 gi|218763703|gb|ACL06169.1| response regulator receiver modulated diguanylate cyclase
           [Desulfatibacillum alkenivorans AK-01]
          Length = 301

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 26/107 (24%), Positives = 52/107 (48%), Gaps = 3/107 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L++D S ++  V +++    G  V  AT+  E  E     + P+ +++D  M G+ 
Sbjct: 1   MANILVIDDSRLIAHVAKNMLTARGHEVTVATNGEEGLEAVAT-IKPDLILLDLIMPGMD 59

Query: 61  EFIA--HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
            +     ++  P   D+ V  L  + +    + G  AGA+ ++ KPF
Sbjct: 60  GYAVCEKIKGSPATADIPVIMLTSKAETADKVRGLEAGASDYVTKPF 106


>gi|75906526|ref|YP_320822.1| two component LuxR family transcriptional regulator [Anabaena
           variabilis ATCC 29413]
 gi|75700251|gb|ABA19927.1| two component transcriptional regulator, LuxR family [Anabaena
           variabilis ATCC 29413]
          Length = 231

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 29/109 (26%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    +R+  +    + GF V  A++  E  +  ++   P+ ++ D  M  V   +
Sbjct: 5   LLLVDDEPGLREAVKDYLQESGFSVQVASNAREGWDLMQQST-PDLVISDVMMPQVDGYQ 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+  +R+ P    + V +L  +      I G +AG +++L KPF+ + L
Sbjct: 64  FLKQLREDPRFQSLPVVFLTAKGMTSDRIQGYQAGVDAYLPKPFDPDEL 112


>gi|307824619|ref|ZP_07654843.1| response regulator receiver protein [Methylobacter tundripaludum
           SV96]
 gi|307734273|gb|EFO05126.1| response regulator receiver protein [Methylobacter tundripaludum
           SV96]
          Length = 120

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 52/112 (46%), Gaps = 3/112 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EG 58
           M S+L VD S  +RK+        G+ V EA    +A E  +     + +V D +M  + 
Sbjct: 1   MASILAVDDSASMRKMVSFTLRAAGYDVEEAVDGVDALEKAQARKF-DCVVTDVNMPNKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  I  +R +P    + +  L  E   EK   G  AGA  +++KPFN + L
Sbjct: 60  GITLIRDLRALPDYKFIPMLMLTTESGIEKKQEGKAAGATGWMVKPFNPDQL 111


>gi|261340268|ref|ZP_05968126.1| chemotaxis protein CheY [Enterobacter cancerogenus ATCC 35316]
 gi|288317357|gb|EFC56295.1| chemotaxis protein CheY [Enterobacter cancerogenus ATCC 35316]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF-GFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R       + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRADAAMASLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|209964279|ref|YP_002297194.1| chemotaxis protein CheY [Rhodospirillum centenum SW]
 gi|209957745|gb|ACI98381.1| chemotaxis protein CheY [Rhodospirillum centenum SW]
          Length = 128

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 33/112 (29%), Positives = 57/112 (50%), Gaps = 6/112 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           +L+VD    +R++ R+L    GF  + EA    EA            ++ D +ME +  L
Sbjct: 8   VLVVDDYATMRRIIRNLLTQIGFTRIEEAADGAEALAKLRGGTF-GLVISDWNMEPMTGL 66

Query: 61  EFIAHVR-QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           + +  VR  + L +  F+  +  E   E +IA   AG N++++KPFN +TL+
Sbjct: 67  QLLKEVRADIRLKSMPFIM-VTAESKTENVIAAKEAGVNNYIVKPFNADTLK 117


>gi|172060075|ref|YP_001807727.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Burkholderia ambifaria MC40-6]
 gi|171992592|gb|ACB63511.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia ambifaria MC40-6]
          Length = 461

 Score = 39.7 bits (91), Expect = 0.13,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 25  GFSVDTATSLAEARMALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 83

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE + L A
Sbjct: 84  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVRTLRA 133


>gi|308273562|emb|CBX30164.1| hypothetical protein N47_D29730 [uncultured Desulfobacterium sp.]
          Length = 123

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 7/113 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK---ELLPNYLVIDESMEGV 59
           ++++ D S +VR +        G+  F+A    EA E  EK   E+  + +++D +M  +
Sbjct: 2   NVIIADDSKVVRSIVEKAIKTIGYSSFQAIHGGEAIEILEKMGGEI--DLILMDWNMPVM 59

Query: 60  LEFIA--HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             F A  ++++ P  + + V  L  E D  K+     AGA  ++ KPF ++ L
Sbjct: 60  DGFNALVNIKKNPKFSSIPVIMLTSESDDNKVKMAHDAGAAGYIRKPFTQDEL 112


>gi|126732018|ref|ZP_01747821.1| chemotaxis two-component response regulator protein [Sagittula
           stellata E-37]
 gi|126707550|gb|EBA06613.1| chemotaxis two-component response regulator protein [Sagittula
           stellata E-37]
          Length = 124

 Score = 39.7 bits (91), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 55/118 (46%), Gaps = 7/118 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE--KELLPNYLVIDESMEGVLE 61
           +L +D S  +R + R      GF   E  S C+ +E  +   E+ P+ ++ D +M  +  
Sbjct: 5   VLAIDDSRTIRNLLRVSLEGAGF---EFHSACDGQEGVDIFPEVDPDVVITDINMPKMDG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           F  I  +R  P  T+V +  L  E   +       AGA  +++KPF+  +L   +R L
Sbjct: 62  FGVIDTLRGGPNRTNVPILVLTTESSDDLKSRARSAGATGWIVKPFDDASLVSVLRRL 119


>gi|159898879|ref|YP_001545126.1| two component transcriptional regulator [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159891918|gb|ABX04998.1| two component transcriptional regulator, winged helix family
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 231

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 61/127 (48%), Gaps = 14/127 (11%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L++D    +R++ R    + GF VFEA +  E   +  +++ P+ +++D  M   G L
Sbjct: 4   TILVIDDEAKLRELLRSYLQNEGFNVFEAKNGREGL-YVARDVKPDLILLDIMMPELGGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN--------RETLRF 112
           +F+   R      +  +  L  +++    I G   GA+ ++ KPFN        R  LR 
Sbjct: 63  DFM---RAWNKEAETPIILLTAKIEDHDKIIGLELGADDYITKPFNAREVMARVRAVLRR 119

Query: 113 AMRELPQ 119
           + +  PQ
Sbjct: 120 SYKAQPQ 126


>gi|311112222|ref|YP_003983444.1| two component response regulator [Rothia dentocariosa ATCC 17931]
 gi|310943716|gb|ADP40010.1| two component response regulator [Rothia dentocariosa ATCC 17931]
          Length = 234

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 54/109 (49%), Gaps = 3/109 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIAHVRQMPLGTDVFVYYLLMEV 84
           GF V  A +  EA E  E E  P+ +V+D  M G+  F    R    G    V +L  + 
Sbjct: 28  GFEVVTAGNGREAIEKAENEQ-PDLIVLDVMMPGMDGFEVTRRLRDAGRTYPVLFLTAKD 86

Query: 85  DFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDAI 133
             E  +AG  AG + ++ KPF+ + +   +R +  +++S++  +  DAI
Sbjct: 87  ATEDKVAGLGAGGDDYVTKPFSLDEVIARIRAI--LRRSRNAQEEDDAI 133


>gi|157371219|ref|YP_001479208.1| chemotaxis regulatory protein CheY [Serratia proteamaculans 568]
 gi|157322983|gb|ABV42080.1| response regulator receiver protein [Serratia proteamaculans 568]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/115 (27%), Positives = 55/115 (47%), Gaps = 16/115 (13%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFE-------ATSVCEAREFCEKELLPNYLVIDESME 57
           L+VD    +R++ R+L  + GF   E       A +   A +F       +++V D +M 
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALNKLRAGDF-------DFVVSDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  LE +  +R       + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 62  NMDGLELLQTIRADGALASMPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|54308026|ref|YP_129046.1| putative transcriptional regulator [Photobacterium profundum SS9]
 gi|46912452|emb|CAG19244.1| putative transcriptional regulator [Photobacterium profundum SS9]
          Length = 410

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/127 (25%), Positives = 54/127 (42%), Gaps = 8/127 (6%)

Query: 5   LLVDSSHIVRKVGRHLFNDF---GFMVFEATSVCEAREFCEKELLPNYLVIDESM--EGV 59
           ++VD S ++R   RHL N        V +A + CEA     +      ++ D  M  +  
Sbjct: 127 MVVDDSTMIR---RHLVNLLERQNLSVIQAENGCEAISLLAEHPDVTLIITDNDMPKKDG 183

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +     +R+M     + +  L    D        +AGAN FL KPFN+E     +  +  
Sbjct: 184 ITMTREIRRMYSRNQIAILGLSGSSDNSMTAQYLKAGANDFLYKPFNQEEFYCRIHHMLN 243

Query: 120 MQKSKDE 126
           M+ + D+
Sbjct: 244 MKDTSDK 250


>gi|325263091|ref|ZP_08129826.1| two-component response regulator [Clostridium sp. D5]
 gi|324031484|gb|EGB92764.1| two-component response regulator [Clostridium sp. D5]
          Length = 294

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/139 (23%), Positives = 63/139 (45%), Gaps = 10/139 (7%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M+ +L+VD +  +  +   + N++GF V +A    +     + E  P+ +++D  + G+ 
Sbjct: 1   MEKILVVDDNEAICDMLYDVLNEWGFCVEKAYQGIKVMPLVD-EFGPDLILLDVMLPGMN 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM---- 114
             E    ++  P    + V  L +  D    +     GA+ FL KP N + LR  M    
Sbjct: 60  GFEICKRIKSDPEKEHIAVILLTVLSDVSDRMQAVNVGADLFLNKPVNYKELRKQMGYLL 119

Query: 115 ---RELPQMQKSKDENQFL 130
              + L  M+K++   QF+
Sbjct: 120 MRKKRLADMEKAESVCQFI 138


>gi|51473435|ref|YP_067192.1| response regulator PleD [Rickettsia typhi str. Wilmington]
 gi|51459747|gb|AAU03710.1| response regulator protein [Rickettsia typhi str. Wilmington]
          Length = 450

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 35/129 (27%), Positives = 60/129 (46%), Gaps = 5/129 (3%)

Query: 1   MDSLLLVDSSHI-VRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYL--VIDESME 57
           M ++L+VD     ++ +   L  ++ + V  A S  EA    +KE +   L  V+   M+
Sbjct: 1   MTTILVVDDIETNIKLLTAKLLKEY-YTVLTANSGKEALSILKKEKIDTILLDVMMPEMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G  E    ++  P  T + V  +    D +  + G  AGA+ FL+KP N   L   ++ L
Sbjct: 60  G-FEVCKIIKTDPGTTHIPVVMITALSDIDDRVKGLEAGADEFLIKPINDTALFVRLKSL 118

Query: 118 PQMQKSKDE 126
            +M+   DE
Sbjct: 119 SRMKSLIDE 127


>gi|71276050|ref|ZP_00652331.1| Response regulator receiver:Metal-dependent phosphohydrolase, HD
           subdomain [Xylella fastidiosa Dixon]
 gi|71899472|ref|ZP_00681630.1| Response regulator receiver:Metal-dependent phosphohydrolase, HD
           subdomain [Xylella fastidiosa Ann-1]
 gi|170729666|ref|YP_001775099.1| response regulator receiver protein [Xylella fastidiosa M12]
 gi|71163133|gb|EAO12854.1| Response regulator receiver:Metal-dependent phosphohydrolase, HD
           subdomain [Xylella fastidiosa Dixon]
 gi|71730785|gb|EAO32858.1| Response regulator receiver:Metal-dependent phosphohydrolase, HD
           subdomain [Xylella fastidiosa Ann-1]
 gi|167964459|gb|ACA11469.1| response regulator receiver protein [Xylella fastidiosa M12]
          Length = 384

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 36/129 (27%), Positives = 58/129 (44%), Gaps = 9/129 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFG--FMVFEATSVCEAREFCEKE----LLPNYLVIDESM 56
           ++++VD     R + RH+  D      VF+     EA  +CE      LL +Y + D  M
Sbjct: 29  NIVIVDDQMSARTMLRHVIEDIAPHLQVFDFGDPSEALAWCEVSQVDLLLLDYRMPD--M 86

Query: 57  EGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +G LEF   + Q+P   D+ +  + +  D     A   AG   FL+KP     LR     
Sbjct: 87  DG-LEFALRLHQLPNRRDIPILLITIVGDEPIRQAALDAGVIDFLIKPIRPRELRARCNN 145

Query: 117 LPQMQKSKD 125
           L Q+++  +
Sbjct: 146 LLQLRQHSE 154


>gi|153007122|ref|YP_001381447.1| response regulator receiver protein [Anaeromyxobacter sp. Fw109-5]
 gi|152030695|gb|ABS28463.1| response regulator receiver protein [Anaeromyxobacter sp. Fw109-5]
          Length = 168

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 33/117 (28%), Positives = 53/117 (45%), Gaps = 9/117 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           +LLV+    +R+  R L    GF V  A    EA E   +   P  ++ D     M G  
Sbjct: 52  ILLVEDDAGMREAIRALLERAGFSVAIARDGAEAWELLSRGPRPVAILADLYTPRMTG-H 110

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           + +A +R+ P    V +  +  E       +  R  A +FL KPF+RE L +A++ +
Sbjct: 111 DLVARIRRTPRLARVPIIAMTSE-----RASKTRPAAEAFLEKPFSREQLEWALQRV 162


>gi|88861092|ref|ZP_01135727.1| CheY-like receiver protein [Pseudoalteromonas tunicata D2]
 gi|88817020|gb|EAR26840.1| CheY-like receiver protein [Pseudoalteromonas tunicata D2]
          Length = 120

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---E 57
           M  +L VD S  +R++        GF V EA    EA    ++    + ++ D +M   +
Sbjct: 1   MKKILAVDDSASMRQMVGFTLKKAGFDVTEAKDGSEALAIAKQATF-DAVISDVNMPIMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+   I  +R +P      +  L  E   +K   G  AGA  +++KPFN E L   ++++
Sbjct: 60  GI-TLIRELRALPEYKFTPMLMLTTESGLDKKTEGKAAGATGWIVKPFNPEQLLAVIKKV 118


>gi|283853390|ref|ZP_06370636.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Desulfovibrio sp. FW1012B]
 gi|283571203|gb|EFC19217.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Desulfovibrio sp. FW1012B]
          Length = 482

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 34/112 (30%), Positives = 53/112 (47%), Gaps = 9/112 (8%)

Query: 1   MDS----LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM 56
           MDS    +L+VD  H +R+    L    G+ V  A+S  EA     +E +P+ +V+D  M
Sbjct: 1   MDSRTAQILIVDDDHQLRQSFERLLAAEGYAVRTASS-GEAGILAVREAVPDLVVMDVRM 59

Query: 57  EGV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFN 106
            G+  LE  A +R+      V +       D    I   + GA  ++LKPF+
Sbjct: 60  PGISGLEAYAAMREFEPRLPVIIMTAFGTTDIA--IEATKMGAYDYILKPFD 109


>gi|27365180|ref|NP_760708.1| Pole remodelling regulatory diguanylate cyclase [Vibrio vulnificus
           CMCP6]
 gi|37680766|ref|NP_935375.1| response regulator [Vibrio vulnificus YJ016]
 gi|27361327|gb|AAO10235.1| Pole remodelling regulatory diguanylate cyclase [Vibrio vulnificus
           CMCP6]
 gi|37199515|dbj|BAC95346.1| response regulator [Vibrio vulnificus YJ016]
          Length = 416

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIA 64
           L+VD S +VRK    L         EA +  +A E  ++     +++ D  M    + I 
Sbjct: 139 LVVDDSKVVRKHITQLLEHQYIETLEAENGTQALEVLKQHPEVTFVITDHDMPEK-DGIT 197

Query: 65  HVRQMPLGTDVFVYYLLMEVDFEKMIAGAR---AGANSFLLKPFNRETLRFAMRELPQMQ 121
            +R++ + TD     +L     +     AR   AGAN FL KPFN+E     + ++  M+
Sbjct: 198 MIREIRVHTDKNKLAILGLSGSDDRTMTARFLKAGANDFLYKPFNQEEFFCRVHQILDMK 257

Query: 122 KSKDE 126
           ++ +E
Sbjct: 258 EATNE 262


>gi|308066967|ref|YP_003868572.1| sporulation initiation phosphotransferase F (stage 0 sporulation
           protein F) [Paenibacillus polymyxa E681]
 gi|297305202|gb|ADI24137.1| Spo0F [Paenibacillus polymyxa]
 gi|305856246|gb|ADM68034.1| Sporulation initiation phosphotransferase F (Stage 0 sporulation
           protein F) [Paenibacillus polymyxa E681]
          Length = 122

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/116 (26%), Positives = 56/116 (48%), Gaps = 5/116 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD  + +R +   +F   G+  F+A +   A E  EKE  P+ +++D  + G+  L
Sbjct: 5   KVLIVDDQNGIRILLMEVFGSEGYETFQAANGKIALEIVEKE-PPDLVLLDMKIPGMDGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           E + H++ M     V +     E+D  K       GA     KPF+ + +R A+ +
Sbjct: 64  EILKHLKTMNPDIKVIMMTAYGELDMIK--EATELGALMHFTKPFDIDEMRIAVNK 117


>gi|220907616|ref|YP_002482927.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
 gi|219864227|gb|ACL44566.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7425]
          Length = 887

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 58/125 (46%), Gaps = 9/125 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK---ELLPNYLVIDESMEGVL 60
           +L+VD +  VR + R      G+ + EA +     E C K   +L P+ +++D  M G+ 
Sbjct: 13  ILVVDDAKTVRALLREHLESVGYQLAEAVN----GEDCLKSFQQLRPDIVLLDAVMPGMD 68

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F   A +R++P G D  +  +    D   +     AGA  ++ KP +   LR  +  L 
Sbjct: 69  GFNCCARLRRLPQGMDTPILMITGLDDPSSVERAFAAGATDYITKPIHWAVLRMRVSRLI 128

Query: 119 QMQKS 123
           +  ++
Sbjct: 129 EASRA 133


>gi|192360976|ref|YP_001983403.1| chemotaxis protein CheY [Cellvibrio japonicus Ueda107]
 gi|190687141|gb|ACE84819.1| chemotaxis protein CheY [Cellvibrio japonicus Ueda107]
          Length = 121

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/118 (27%), Positives = 57/118 (48%), Gaps = 3/118 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S  +R+V        G+ V EA+   +A    + + + N ++ D +M  +  + 
Sbjct: 5   ILVVDDSASIRQVVGMALRGAGYTVVEASDGRDALSKLDGQKI-NLVISDVNMPNMDGIT 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F+  ++Q P      V  L  E   +K   G  AGA ++++KPF  E +  A+  L Q
Sbjct: 64  FVKEMKQKPNYKFTPVIMLTTEGADDKKREGQAAGAKAWIVKPFRPEQMLQAVSMLIQ 121


>gi|315128019|ref|YP_004070022.1| chemotaxis response regulator [Pseudoalteromonas sp. SM9913]
 gi|315016533|gb|ADT69871.1| chemotaxis response regulator [Pseudoalteromonas sp. SM9913]
          Length = 120

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 31/120 (25%), Positives = 57/120 (47%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---E 57
           M  +L VD S  +R++        GF V EA    EA    +++   + ++ D +M   +
Sbjct: 1   MKRILAVDDSASMRQMVSFTLKTAGFDVTEAKDGSEALAIAKQQGF-DAVISDVNMPVMD 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+   I  +R +P      +  L  E   +K + G  AGA  +++KPFN + L   ++++
Sbjct: 60  GI-TLIRELRGLPNYKFTPLLMLTTESGMDKKVEGKAAGATGWIVKPFNPDQLLAVLKKV 118


>gi|221218158|ref|ZP_03589624.1| chemotaxis response regulator [Borrelia burgdorferi 72a]
 gi|224533497|ref|ZP_03674086.1| chemotaxis response regulator [Borrelia burgdorferi CA-11.2a]
 gi|225549556|ref|ZP_03770522.1| chemotaxis response regulator [Borrelia burgdorferi 118a]
 gi|221192106|gb|EEE18327.1| chemotaxis response regulator [Borrelia burgdorferi 72a]
 gi|224513170|gb|EEF83532.1| chemotaxis response regulator [Borrelia burgdorferi CA-11.2a]
 gi|225369833|gb|EEG99280.1| chemotaxis response regulator [Borrelia burgdorferi 118a]
          Length = 124

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA----REFCEKELLPNYLVIDESMEGV 59
           +L++D +  +R+   ++    GF V EA    E     +E   +      LVI +     
Sbjct: 5   ILVIDDNRAIRQSVAYILEQNGFGVSEAKDGLEGVLQFKEAVGQGDKDFDLVITDINMPN 64

Query: 60  LEFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L+ I  ++Q+   G+ V +  L  E +  K+  G +AGA  +L+KPFN E L
Sbjct: 65  LDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAGATGWLVKPFNPEAL 116


>gi|119476351|ref|ZP_01616702.1| two-component response regulator PhoB [marine gamma proteobacterium
           HTCC2143]
 gi|119450215|gb|EAW31450.1| two-component response regulator PhoB [marine gamma proteobacterium
           HTCC2143]
          Length = 236

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 53/106 (50%), Gaps = 5/106 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDESMEGV-- 59
           ++L+VD    +R++ R   +  GF   EA    EA R   + +  P+ +++D  + G   
Sbjct: 5   TILIVDDEAPIREMIRMSLDMAGFNCREAADTREAYRVIADSK--PDLVLLDWMLPGGSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPF 105
           +E +  +R+  L  D+ V  L  + D +  I G   GA+ ++ KPF
Sbjct: 63  IELLRRLRKEELTADLPVIMLTAKTDEDNKIQGLDVGADDYITKPF 108


>gi|110189863|gb|ABG56106.1| hypothetical protein [Borrelia burgdorferi]
          Length = 124

 Score = 39.7 bits (91), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA----REFCEKELLPNYLVIDESMEGV 59
           +L++D +  +R+   ++    GF V EA    E     +E   +      LVI +     
Sbjct: 5   ILVIDDNRAIRQSVAYILEQNGFGVSEAKDGLEGFLKFKEAVGQGDKDFDLVITDINMPN 64

Query: 60  LEFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L+ I  ++Q+   G+ V +  L  E +  K+  G +AGA  +L+KPFN E L
Sbjct: 65  LDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAGATGWLVKPFNPEAL 116


>gi|114320849|ref|YP_742532.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Alkalilimnicola ehrlichii MLHE-1]
 gi|114227243|gb|ABI57042.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Alkalilimnicola ehrlichii MLHE-1]
          Length = 481

 Score = 39.7 bits (91), Expect = 0.14,   Method: Composition-based stats.
 Identities = 41/131 (31%), Positives = 64/131 (48%), Gaps = 7/131 (5%)

Query: 3   SLLLVDSSHIVRK-VGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           S+L++D    VR  + R L   F   V  A +V EA E   +E   + ++ D  + GV  
Sbjct: 30  SVLVIDDEPGVRNFLERALVRHFRH-VRVAANVKEA-EAAREEGHYDLIISDIRLPGVSG 87

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           ++++  VR     TDV   ++    D E  IA  RAGA+ F+LKPF  + L  A+    +
Sbjct: 88  VDWVEAVRAQGDPTDVI--FITAYADLETAIAALRAGASDFILKPFRMDQLYTAIDRCFE 145

Query: 120 MQKSKDENQFL 130
            +  + EN  L
Sbjct: 146 RRSMQRENFLL 156


>gi|254487115|ref|ZP_05100320.1| nitrogen regulation protein [Roseobacter sp. GAI101]
 gi|214043984|gb|EEB84622.1| nitrogen regulation protein [Roseobacter sp. GAI101]
          Length = 470

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 59/135 (43%), Gaps = 9/135 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVID-----ES 55
           M  +L+VD    +R++   +  D G+    A +  EA      E  P  +V+D       
Sbjct: 1   MSDILIVDDERDIRELISDILEDEGYATRLAGNSDEAMNAINAEA-PALMVLDIWLKDSR 59

Query: 56  MEGVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           M+G+    +  R  P   DV V  +    + E  +A  + GA  F+ KPFN + L   +R
Sbjct: 60  MDGIDILKSVKRDNP---DVPVVIISGHGNIEIAVAAIKQGAYDFIEKPFNIDQLLVVIR 116

Query: 116 ELPQMQKSKDENQFL 130
              +  + + ENQ L
Sbjct: 117 RAMETSRLRRENQSL 131


>gi|146312099|ref|YP_001177173.1| chemotaxis regulatory protein CheY [Enterobacter sp. 638]
 gi|145318975|gb|ABP61122.1| response regulator receiver protein [Enterobacter sp. 638]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A    +     ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRADGNMSSLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|13787180|pdb|1E6L|A Chain A, Two-Component Signal Transduction System D13a Mutant Of
           Chey
          Length = 127

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD+   +R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 7   LVVDAFSTMRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY-GFVISDWNMPNMDGLE 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 66  LLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 114


>gi|320354433|ref|YP_004195772.1| CheA signal transduction histidine kinase [Desulfobulbus propionicus
            DSM 2032]
 gi|320122935|gb|ADW18481.1| CheA signal transduction histidine kinase [Desulfobulbus propionicus
            DSM 2032]
          Length = 1147

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 51/109 (46%), Gaps = 3/109 (2%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEARE-FCEKELLPNYLVIDESMEGV-- 59
            ++++VD S  +R+V   L    G+   EA    +A E    +EL PN +V+D  M  +  
Sbjct: 1010 TVMIVDDSISIRRVMSRLVTANGWTPVEAKDGLDAIEQLGMRELRPNCIVLDIEMPRMNG 1069

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRE 108
             EF+A +  +  G D+ V  L      +      + GA +FL KP   E
Sbjct: 1070 FEFLAKLSNIQGGQDIPVIMLSSRTSSKHQEKAFQLGARAFLSKPCKDE 1118


>gi|239817120|ref|YP_002946030.1| response regulator receiver protein [Variovorax paradoxus S110]
 gi|239803697|gb|ACS20764.1| response regulator receiver protein [Variovorax paradoxus S110]
          Length = 132

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/115 (29%), Positives = 57/115 (49%), Gaps = 12/115 (10%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFC---EKELLPNY--LVIDESME 57
            +L+VD    +R++ R+L  +  F+     +V EA +     EK    N+  +V D +M 
Sbjct: 7   KILVVDDFPTMRRIVRNLLKELEFL-----NVDEAEDGAAGIEKLRGGNFGFVVSDWNMP 61

Query: 58  GV--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  L  +  +R  P    + V  +  E   E +IA A+AGAN +++KPF   TL
Sbjct: 62  NMDGLTMLQTIRADPELAKLPVLMVTAEAKKENIIAAAQAGANGYVVKPFTAATL 116


>gi|170699581|ref|ZP_02890621.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia ambifaria IOP40-10]
 gi|170135532|gb|EDT03820.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Burkholderia ambifaria IOP40-10]
          Length = 475

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 32/110 (29%), Positives = 51/110 (46%), Gaps = 3/110 (2%)

Query: 25  GFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLEFIAHVRQMPLGTDVFVYYLLM 82
           GF V  ATS+ EAR    + + P+ +++D ++      + + H+ Q      + V  L  
Sbjct: 39  GFSVDTATSLAEARMALGRSI-PDVVLVDLNLPDGSGFDLLQHLPQQQPNGSLPVIVLTG 97

Query: 83  EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKSKDENQFLDA 132
               E  I G R G   +LLKP N   LR  +  +P+  +  DE + L A
Sbjct: 98  NATVESAIEGLRHGIWDYLLKPINIPRLRSLLARIPRPYELIDEVRTLRA 147


>gi|153869319|ref|ZP_01998959.1| sensory box/GGDEF family protein [Beggiatoa sp. PS]
 gi|152074149|gb|EDN71035.1| sensory box/GGDEF family protein [Beggiatoa sp. PS]
          Length = 576

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/122 (24%), Positives = 60/122 (49%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD   + R     L +  G+ +  A +  EA +    E +P+ +++D  M G+   
Sbjct: 6   TILIVDDETVSRYTVEVLLSAEGYNLVFAENGEEALKKA-AESIPDLMLLDVMMPGMDGF 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R  P   ++ +  +    D +  + G  AGA+ F+ KPF+R  LR  +R + ++
Sbjct: 65  EVCQRLRTNPRLAELPIVMVTALDDRDSRLRGIEAGADDFMSKPFDRAELRARVRTITRL 124

Query: 121 QK 122
            +
Sbjct: 125 NR 126


>gi|167644250|ref|YP_001681913.1| response regulator receiver protein [Caulobacter sp. K31]
 gi|167346680|gb|ABZ69415.1| response regulator receiver protein [Caulobacter sp. K31]
          Length = 121

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L VD S  +R + R   +  GF V EA       E       P+ ++ D +M  +   
Sbjct: 4   TVLTVDDSRTMRDMLRMALSGAGFNVVEAVDGEHGLEVLSAHR-PDVIITDINMPKLDGF 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            FI  VR       + +  L  E D  K      AGA  +++KPFN E L  A+R +
Sbjct: 63  GFIEAVRVDDDYRAIPILVLTTESDPSKKQRAREAGATGWIVKPFNPEKLVEAIRRV 119


>gi|51598821|ref|YP_073009.1| chemotaxis response regulator [Borrelia garinii PBi]
 gi|111115398|ref|YP_710016.1| chemotaxis response regulator [Borrelia afzelii PKo]
 gi|216263565|ref|ZP_03435560.1| chemotaxis response regulator [Borrelia afzelii ACA-1]
 gi|216264871|ref|ZP_03436863.1| chemotaxis response regulator [Borrelia burgdorferi 156a]
 gi|219684419|ref|ZP_03539363.1| chemotaxis response regulator [Borrelia garinii PBr]
 gi|219685152|ref|ZP_03539972.1| chemotaxis response regulator [Borrelia garinii Far04]
 gi|224531920|ref|ZP_03672552.1| chemotaxis response regulator [Borrelia valaisiana VS116]
 gi|224532757|ref|ZP_03673374.1| chemotaxis response regulator [Borrelia burgdorferi WI91-23]
 gi|224534782|ref|ZP_03675354.1| chemotaxis response regulator [Borrelia spielmanii A14S]
 gi|225552048|ref|ZP_03772988.1| chemotaxis response regulator [Borrelia sp. SV1]
 gi|51573392|gb|AAU07417.1| chemotaxis response regulator [Borrelia garinii PBi]
 gi|110189853|gb|ABG56101.1| hypothetical protein [Borrelia burgdorferi]
 gi|110189855|gb|ABG56102.1| hypothetical protein [Borrelia burgdorferi]
 gi|110189857|gb|ABG56103.1| hypothetical protein [Borrelia burgdorferi]
 gi|110189859|gb|ABG56104.1| hypothetical protein [Borrelia burgdorferi N40]
 gi|110189861|gb|ABG56105.1| hypothetical protein [Borrelia burgdorferi]
 gi|110890672|gb|ABH01840.1| chemotaxis response regulator [Borrelia afzelii PKo]
 gi|215980409|gb|EEC21230.1| chemotaxis response regulator [Borrelia afzelii ACA-1]
 gi|215981344|gb|EEC22151.1| chemotaxis response regulator [Borrelia burgdorferi 156a]
 gi|219672408|gb|EED29461.1| chemotaxis response regulator [Borrelia garinii PBr]
 gi|219673248|gb|EED30267.1| chemotaxis response regulator [Borrelia garinii Far04]
 gi|224511385|gb|EEF81791.1| chemotaxis response regulator [Borrelia valaisiana VS116]
 gi|224512375|gb|EEF82759.1| chemotaxis response regulator [Borrelia burgdorferi WI91-23]
 gi|224514030|gb|EEF84352.1| chemotaxis response regulator [Borrelia spielmanii A14S]
 gi|225371046|gb|EEH00476.1| chemotaxis response regulator [Borrelia sp. SV1]
 gi|312148064|gb|ADQ30723.1| chemotaxis response regulator [Borrelia burgdorferi JD1]
 gi|312149701|gb|ADQ29772.1| chemotaxis response regulator [Borrelia burgdorferi N40]
          Length = 124

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA----REFCEKELLPNYLVIDESMEGV 59
           +L++D +  +R+   ++    GF V EA    E     +E   +      LVI +     
Sbjct: 5   ILVIDDNRAIRQSVAYILEQNGFGVSEAKDGLEGVLKFKEAVGQGDKDFDLVITDINMPN 64

Query: 60  LEFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L+ I  ++Q+   G+ V +  L  E +  K+  G +AGA  +L+KPFN E L
Sbjct: 65  LDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAGATGWLVKPFNPEAL 116


>gi|284007186|emb|CBA72475.1| Chemotaxis regulator-transmits chemoreceptor signals to flagellar
           motor components CheY [Arsenophonus nasoniae]
          Length = 128

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/119 (26%), Positives = 60/119 (50%), Gaps = 6/119 (5%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVID---ESMEGVL 60
           L+VD    +R++ R+L  + GF  V EA    +A     K    ++++ D    +M+G+L
Sbjct: 9   LIVDDFSTMRRILRNLLKESGFHNVEEAEDGEDALAKMNKHNF-DFIITDWNMPNMDGLL 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             +  +RQ      + V  +  E   E +IA ++AGA+ +++KPF    L   + ++ Q
Sbjct: 68  -LLETIRQQEKWAKLPVLMVTAEAKKENIIAASKAGASGYVVKPFTAAILEQKIEQIIQ 125


>gi|15594915|ref|NP_212704.1| chemotaxis response regulator (cheY-2) [Borrelia burgdorferi B31]
 gi|195941704|ref|ZP_03087086.1| chemotaxis response regulator (cheY-2) [Borrelia burgdorferi 80a]
 gi|218249324|ref|YP_002375077.1| chemotaxis response regulator [Borrelia burgdorferi ZS7]
 gi|223888817|ref|ZP_03623408.1| chemotaxis response regulator [Borrelia burgdorferi 64b]
 gi|226321035|ref|ZP_03796578.1| chemotaxis response regulator [Borrelia burgdorferi 29805]
 gi|226321876|ref|ZP_03797402.1| chemotaxis response regulator [Borrelia burgdorferi Bol26]
 gi|2688488|gb|AAC66933.1| chemotaxis response regulator (cheY-2) [Borrelia burgdorferi B31]
 gi|110189843|gb|ABG56096.1| hypothetical protein [Borrelia burgdorferi]
 gi|110189845|gb|ABG56097.1| hypothetical protein [Borrelia burgdorferi]
 gi|110189847|gb|ABG56098.1| hypothetical protein [Borrelia burgdorferi 297]
 gi|110189849|gb|ABG56099.1| hypothetical protein [Borrelia burgdorferi]
 gi|110189851|gb|ABG56100.1| hypothetical protein [Borrelia burgdorferi]
 gi|218164512|gb|ACK74573.1| chemotaxis response regulator [Borrelia burgdorferi ZS7]
 gi|223885633|gb|EEF56732.1| chemotaxis response regulator [Borrelia burgdorferi 64b]
 gi|226233065|gb|EEH31818.1| chemotaxis response regulator [Borrelia burgdorferi Bol26]
 gi|226233559|gb|EEH32297.1| chemotaxis response regulator [Borrelia burgdorferi 29805]
          Length = 124

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/112 (28%), Positives = 54/112 (48%), Gaps = 5/112 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA----REFCEKELLPNYLVIDESMEGV 59
           +L++D +  +R+   ++    GF V EA    E     +E   +      LVI +     
Sbjct: 5   ILVIDDNRAIRQSVAYILEQNGFGVSEAKDGLEGVLRFKEAVGQGDKDFDLVITDINMPN 64

Query: 60  LEFIAHVRQM-PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           L+ I  ++Q+   G+ V +  L  E +  K+  G +AGA  +L+KPFN E L
Sbjct: 65  LDGIGVIKQIREFGSFVPILVLTTESEQSKVDEGRKAGATGWLVKPFNPEAL 116


>gi|320155563|ref|YP_004187942.1| pole remodelling regulatory diguanylate cyclase [Vibrio vulnificus
           MO6-24/O]
 gi|319930875|gb|ADV85739.1| pole remodelling regulatory diguanylate cyclase [Vibrio vulnificus
           MO6-24/O]
          Length = 404

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/125 (27%), Positives = 58/125 (46%), Gaps = 4/125 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFIA 64
           L+VD S +VRK    L         EA +  +A E  ++     +++ D  M    + I 
Sbjct: 127 LVVDDSKVVRKHITQLLEHQYIETLEAENGTQALEVLKQHPEVTFVITDHDMPEK-DGIT 185

Query: 65  HVRQMPLGTDVFVYYLLMEVDFEKMIAGAR---AGANSFLLKPFNRETLRFAMRELPQMQ 121
            +R++ + TD     +L     +     AR   AGAN FL KPFN+E     + ++  M+
Sbjct: 186 MIREIRVHTDKNKLAILGLSGSDDRTMTARFLKAGANDFLYKPFNQEEFFCRVHQILDMK 245

Query: 122 KSKDE 126
           ++ +E
Sbjct: 246 EATNE 250


>gi|319789818|ref|YP_004151451.1| response regulator receiver protein [Thermovibrio ammonificans
           HB-1]
 gi|317114320|gb|ADU96810.1| response regulator receiver protein [Thermovibrio ammonificans
           HB-1]
          Length = 133

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/114 (26%), Positives = 55/114 (48%), Gaps = 6/114 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDE----SME 57
            +L+VD    +RK+ + L    G+  V EA    +A E   +      LVI +    +M 
Sbjct: 9   KILIVDDMAAMRKILKTLLAQLGYKNVDEAEDGKQALEILRQNPDKYGLVITDWNMPNMT 68

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           G+ E +  +R+      + +  +  E   E ++   +AG N++++KPF  ETL+
Sbjct: 69  GI-ELVQEIRKDEKLKHLPILMVTAEAKKENVLMAIKAGVNNYIVKPFTAETLK 121


>gi|282900084|ref|ZP_06308041.1| Two Component Transcriptional Regulator, LuxR family
           [Cylindrospermopsis raciborskii CS-505]
 gi|281194966|gb|EFA69906.1| Two Component Transcriptional Regulator, LuxR family
           [Cylindrospermopsis raciborskii CS-505]
          Length = 231

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/109 (27%), Positives = 53/109 (48%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLLVD    +R+  +    + GF V  A++  E  E  ++   P+ ++ D  M  V   +
Sbjct: 5   LLLVDDEPGLREAVKEYLQESGFGVRVASNAREGWELIQQNT-PDLVISDIMMPQVDGYQ 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           F+  +R  P    + V +L  +      I G +AG +++L KPF+ + L
Sbjct: 64  FLKQLRDDPRLASLPVIFLTAKGMTGDRIQGYQAGVDAYLSKPFDPDEL 112


>gi|255034345|ref|YP_003084966.1| histidine kinase [Dyadobacter fermentans DSM 18053]
 gi|254947101|gb|ACT91801.1| histidine kinase [Dyadobacter fermentans DSM 18053]
          Length = 1324

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 61/122 (50%), Gaps = 4/122 (3%)

Query: 2    DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            +++L+V+ +  +R   R LF    F   EA +     +    E LP+ ++ D  M  +  
Sbjct: 1072 NTILIVEDNDQLRVFIRELFES-EFNTLEAENGLRGLQLA-NEHLPDIVLSDIMMPDMNG 1129

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            L+  +H+++    + + V  L      +++I G  +GA+ +L+KPF+   L   +R L +
Sbjct: 1130 LQLCSHLKKNITTSHIPVVLLTARAQNQQIIEGLASGADDYLVKPFDPRILELKVRNLIR 1189

Query: 120  MQ 121
            ++
Sbjct: 1190 LR 1191


>gi|317050262|ref|YP_004111378.1| ATPase ATP-binding domain-containing protein [Desulfurispirillum
           indicum S5]
 gi|316945346|gb|ADU64822.1| ATP-binding region ATPase domain protein [Desulfurispirillum
           indicum S5]
          Length = 777

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 33/117 (28%), Positives = 55/117 (47%), Gaps = 20/117 (17%)

Query: 4   LLLVDSSHIVRKV-GRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--- 59
           +L+VD   +VR +  R L  + G+ V +A+   +A E  EK  LP  + +D  M G+   
Sbjct: 532 ILIVDDDPVVRDIISRSLVRE-GYSVVQASDGKQALELAEK-FLPTAITLDVMMPGMDGW 589

Query: 60  -----LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
                L+  +  R +P+         +M     +   G   GA+ +L+KP +RE LR
Sbjct: 590 QVLSQLKANSQTRHIPV---------IMVTILNEKSTGFSLGASEYLVKPVDREVLR 637


>gi|222150188|ref|YP_002551145.1| chemotaxis receiver protein [Agrobacterium vitis S4]
 gi|221737170|gb|ACM38133.1| chemotaxis receiver protein [Agrobacterium vitis S4]
          Length = 122

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 28/109 (25%), Positives = 48/109 (44%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L VD S  +R   +    + G+ V EA    +     +     + +V D +M  +  L 
Sbjct: 5   ILTVDDSASIRMTTKIALTNAGYKVTEAVDGLDGLNKAKSSQF-DLIVTDLNMPNMNGLA 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            I  +R+ P  T + + +L  E D +       AGA  ++ KPF+ E L
Sbjct: 64  MIEALRRSPAHTGIPIIFLTTESDADMKNRAKAAGATGWITKPFDAEQL 112


>gi|239993028|ref|ZP_04713552.1| two-component response regulator [Alteromonas macleodii ATCC 27126]
          Length = 235

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 2/128 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+   + R   + LF   G+ VFEA +  +  +F E   + N +++D ++ G    
Sbjct: 5   NVLIVEDEVVTRTTLKSLFEAEGYNVFEAENGDQMHDFFENHAI-NLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
           I   R++    +V + +L    +    I G   GA+ +L KPFN   L    R L     
Sbjct: 64  IL-AREVRDRKNVGLIFLTGRDNDVDRILGLEIGADDYLTKPFNPRELTIRARNLLSRTT 122

Query: 123 SKDENQFL 130
           +  E+  L
Sbjct: 123 NSSEDDDL 130


>gi|94265602|ref|ZP_01289346.1| Response regulator receiver [delta proteobacterium MLMS-1]
 gi|94269201|ref|ZP_01291397.1| Response regulator receiver [delta proteobacterium MLMS-1]
 gi|93451306|gb|EAT02186.1| Response regulator receiver [delta proteobacterium MLMS-1]
 gi|93453881|gb|EAT04239.1| Response regulator receiver [delta proteobacterium MLMS-1]
          Length = 122

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 9/120 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK--ELLPNYLVIDESMEGVL 60
           S+L+VD S ++R++   L    G      T     ++  EK  E+ P+ +++D  M  V+
Sbjct: 4   SILIVDDSAMIRRIVSQLVQQLGH---RPTVAENGQQGWEKALEIGPDMIIMDIEMP-VM 59

Query: 61  EFIAHVRQMPL---GTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           + I   R +      T + V +       E + A   AG N FL KP  +E L  A+ E+
Sbjct: 60  DGIEATRAIKADKRTTAIPVVFFTALGSEENIQAAEAAGGNGFLNKPICKEDLGKAINEI 119


>gi|126432952|ref|YP_001068643.1| PAS/PAC sensor hybrid histidine kinase [Mycobacterium sp. JLS]
 gi|126232752|gb|ABN96152.1| PAS/PAC sensor hybrid histidine kinase [Mycobacterium sp. JLS]
          Length = 1390

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 29  FEATSVCEAREFCE--KELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEV 84
           +E T+V + R+  E  +  LP+ +V D  M G+  LE +A +R       + V  L    
Sbjct: 661 YEVTAVSDGRQALESIRAELPDLVVSDVMMPGLDGLELVAALRAESRTAALPVLLLSARA 720

Query: 85  DFEKMIAGARAGANSFLLKPF 105
             E  I G  AGA+ +L+KPF
Sbjct: 721 GQESSIEGLHAGADDYLVKPF 741


>gi|108797330|ref|YP_637527.1| PAS/PAC sensor hybrid histidine kinase [Mycobacterium sp. MCS]
 gi|119866415|ref|YP_936367.1| PAS/PAC sensor hybrid histidine kinase [Mycobacterium sp. KMS]
 gi|108767749|gb|ABG06471.1| PAS/PAC sensor hybrid histidine kinase [Mycobacterium sp. MCS]
 gi|119692504|gb|ABL89577.1| PAS/PAC sensor hybrid histidine kinase [Mycobacterium sp. KMS]
          Length = 1390

 Score = 39.7 bits (91), Expect = 0.15,   Method: Composition-based stats.
 Identities = 27/81 (33%), Positives = 41/81 (50%), Gaps = 4/81 (4%)

Query: 29  FEATSVCEAREFCE--KELLPNYLVIDESMEGV--LEFIAHVRQMPLGTDVFVYYLLMEV 84
           +E T+V + R+  E  +  LP+ +V D  M G+  LE +A +R       + V  L    
Sbjct: 661 YEVTAVSDGRQALESIRAELPDLVVSDVMMPGLDGLELVAALRAESRTAALPVLLLSARA 720

Query: 85  DFEKMIAGARAGANSFLLKPF 105
             E  I G  AGA+ +L+KPF
Sbjct: 721 GQESSIEGLHAGADDYLVKPF 741


>gi|91793040|ref|YP_562691.1| GGDEF domain-containing protein [Shewanella denitrificans OS217]
 gi|91715042|gb|ABE54968.1| response regulator receiver modulated diguanylate cyclase
           [Shewanella denitrificans OS217]
          Length = 323

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 60/129 (46%), Gaps = 15/129 (11%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +LLVD   +  K+   L +   + +  AT   +A E CEK + P+ +++D  M  +  F
Sbjct: 16  KILLVDDQVVNIKILHQLLHQ-DYDIHMATDGLKAIEICEK-IQPDIILLDIEMPNLNGF 73

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              A ++Q      + V ++    D EK + G + GA  F+ KP N           P +
Sbjct: 74  DVCAKLKQRAETRSIAVIFVTGHFDLEKEVQGFQLGAVDFIHKPIN-----------PVI 122

Query: 121 QKSKDENQF 129
            +++ +NQF
Sbjct: 123 TQARIKNQF 131


>gi|329922247|ref|ZP_08277949.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein
           [Paenibacillus sp. HGF5]
 gi|328942284|gb|EGG38554.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein
           [Paenibacillus sp. HGF5]
          Length = 1049

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 35/132 (26%), Positives = 66/132 (50%), Gaps = 5/132 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK---ELLPNYLVIDESMEGVL 60
           LL+VD   +  KV  HL  D G+ +   T   EA +  E+   +L+ + +++ + M G  
Sbjct: 721 LLIVDDDPVNLKVIHHLLADEGYRIVAVTRAEEALQLLEQGEWDLIISDVMMPQ-MSG-Y 778

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +RQ  + +++ +  L      E +  G  +GAN +L+KP +   L+  +R L ++
Sbjct: 779 ELSRTIRQRYMLSELPILLLTARNRPEDIHMGFISGANDYLIKPVDHLELKTRVRALLEL 838

Query: 121 QKSKDENQFLDA 132
           + S  E   ++A
Sbjct: 839 KHSIKERLHMEA 850


>gi|310767886|gb|ADP12836.1| chemotaxis regulatory protein CheY [Erwinia sp. Ejp617]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 32/109 (29%), Positives = 56/109 (51%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD  + +R++ R+L  + GF  V EA    +A        + +++V D +M  +  LE
Sbjct: 9   LVVDDFNTMRRIVRNLLKELGFNNVEEAEDGVDALNKLRAGGV-DFVVSDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R       + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRSDGSLGKLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|271500055|ref|YP_003333080.1| response regulator receiver protein [Dickeya dadantii Ech586]
 gi|270343610|gb|ACZ76375.1| response regulator receiver protein [Dickeya dadantii Ech586]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD    +R++ R+L  + GF  V EA    +A          ++++ D +M  +  LE
Sbjct: 9   LVVDDFSTMRRIVRNLLKELGFNNVEEAEDGADALNKLRSGGF-DFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLQAIRADGALSKLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|157834319|pdb|1YMV|A Chain A, Signal Transduction Protein Chey Mutant With Phe 14
           Replaced By Gly, Ser 15 Replaced By Gly, And Met 17
           Replaced By Gly
          Length = 129

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 31/109 (28%), Positives = 54/109 (49%), Gaps = 4/109 (3%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           L+VD     R++ R+L  + GF  V EA    +A    +      +++ D +M  +  LE
Sbjct: 9   LVVDDGGTGRRIVRNLLKELGFNNVEEAEDGVDALNKLQAGGY-GFVISDWNMPNMDGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 68  LLKTIRADGAMSALPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|332139680|ref|YP_004425418.1| two-component response regulator [Alteromonas macleodii str. 'Deep
           ecotype']
 gi|327549702|gb|AEA96420.1| two-component response regulator [Alteromonas macleodii str. 'Deep
           ecotype']
          Length = 235

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 59/128 (46%), Gaps = 2/128 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+   + R   + LF   G+ VFEA +  +  +F E   + N +++D ++ G    
Sbjct: 5   NVLIVEDEVVTRTTLKSLFEAEGYNVFEAENGDQMHDFFENHAI-NLVIMDINLPGKNGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
           I   R++    +V + +L    +    I G   GA+ +L KPFN   L    R L     
Sbjct: 64  IL-AREVRDRKNVGLIFLTGRDNDVDRILGLEIGADDYLTKPFNPRELTIRARNLLSRTT 122

Query: 123 SKDENQFL 130
           +  E+  L
Sbjct: 123 NSSEDDDL 130


>gi|118577252|ref|YP_899492.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Pelobacter propionicus DSM 2379]
 gi|118504757|gb|ABL01239.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Pelobacter propionicus DSM 2379]
          Length = 451

 Score = 39.7 bits (91), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 30/131 (22%), Positives = 61/131 (46%), Gaps = 5/131 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L++D    +R+V  +   +  + V  A+S  E   +   +  PN ++ D  M G+  L 
Sbjct: 5   ILIIDDDTSLRRVLEYNLQEEDYEVHAASSGEEGL-YLFGQFRPNLVITDMKMSGMDGLM 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +  +++    T V +      VD    +   + GA  ++ KPFNR+ L+  +++  Q  
Sbjct: 64  VLKSIKERSPETLVIIITAFGTVDV--AVEAMKTGAYDYITKPFNRDALKLTVKKALQFS 121

Query: 122 KSKDENQFLDA 132
              +EN+ L +
Sbjct: 122 GLAEENKRLKS 132


>gi|163749761|ref|ZP_02157007.1| response regulator [Shewanella benthica KT99]
 gi|161330574|gb|EDQ01532.1| response regulator [Shewanella benthica KT99]
          Length = 402

 Score = 39.7 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 35/135 (25%), Positives = 60/135 (44%), Gaps = 9/135 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           S+LLV+ +   R    +L    G  V    S  EA E  + ++ P+ ++ D  M G+   
Sbjct: 14  SVLLVEDTQSERNFIVNLLQSMGMNVSSCASAEEAIELYQSQM-PDIVISDWRMPGLTGP 72

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRF----AMRE 116
           +    ++Q P  +  ++  L      + M+ G  +GA+ FL KPF    L+     A R 
Sbjct: 73  QLCQRLKQAP--SPPYIILLTANNQAKHMVEGIESGADDFLSKPFIPSILKVRLLAAARI 130

Query: 117 LPQMQKSKDENQFLD 131
           +   Q   D+N  L+
Sbjct: 131 VKMQQHLTDQNLALN 145


>gi|83747602|ref|ZP_00944639.1| Probable chemotaxis response regulator protein (cheY) [Ralstonia
           solanacearum UW551]
 gi|207723078|ref|YP_002253486.1| chemotaxis response regulator protein [Ralstonia solanacearum
           MolK2]
 gi|207738645|ref|YP_002257038.1| chemotaxis response regulator protein [Ralstonia solanacearum
           IPO1609]
 gi|83725782|gb|EAP72923.1| Probable chemotaxis response regulator protein (cheY) [Ralstonia
           solanacearum UW551]
 gi|206588270|emb|CAQ18824.1| chemotaxis response regulator protein [Ralstonia solanacearum
           MolK2]
 gi|206592013|emb|CAQ58919.1| chemotaxis response regulator protein [Ralstonia solanacearum
           IPO1609]
          Length = 137

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/119 (29%), Positives = 55/119 (46%), Gaps = 6/119 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKEL-LPNYLVIDE----SMEG 58
           +L+VD S  +R++      + GF V EA     A    ++     ++LVI +    SM+G
Sbjct: 6   ILVVDDSTSIRRMIAACLRECGFAVTEAADGTAALAAVQQRTDGSHHLVITDQVMPSMDG 65

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            L  I  +R +P   D  +  L  E D         AGA  FL KPF+ + L  ++ +L
Sbjct: 66  -LTLIRALRTLPAYADTPILMLTTEADSTIRDQARAAGATGFLPKPFDPDGLTDSVMQL 123


>gi|284046821|ref|YP_003397161.1| two component transcriptional regulator [Conexibacter woesei DSM
           14684]
 gi|283951042|gb|ADB53786.1| two component transcriptional regulator, winged helix family
           [Conexibacter woesei DSM 14684]
          Length = 235

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/112 (27%), Positives = 54/112 (48%), Gaps = 6/112 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+V+    VR++ R L    G  V EA +  EA     K   P+ +V+D +M  + 
Sbjct: 3   MAEVLVVEDEDDVRRLVRVLLERAGHSVSEAGNGIEALRLL-KSATPDLIVLDVTMPELD 61

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             + +  +R +   T+V V  L         + G ++GA+ ++ KPF R+ L
Sbjct: 62  GWQTLERIRDL---TEVPVLMLTARAGELDKVRGLKSGADDYVTKPFGRQEL 110


>gi|158337180|ref|YP_001518355.1| response regulator [Acaryochloris marina MBIC11017]
 gi|158307421|gb|ABW29038.1| response regulator [Acaryochloris marina MBIC11017]
          Length = 121

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 55/120 (45%), Gaps = 5/120 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM--EG 58
           M  +L+VD S   R++  +   D G  V  AT   EA E  +    P+ +V+D  M  + 
Sbjct: 1   MQKVLVVDDSITQRQLMSNALEDMGLTVLIATDGVEALEQIQST-QPDIVVLDIVMPRKN 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEV-DFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             E    ++  P   +V V     +  DF++   G + GA+++L KP     L   +R+L
Sbjct: 60  GYEVCREIKSNPTTQNVPVVICSSKTEDFDRY-WGMKQGADAYLTKPIQPRELLVIVRQL 118


>gi|149912612|ref|ZP_01901146.1| ATP-binding region, ATPase-like protein [Roseobacter sp. AzwK-3b]
 gi|149813018|gb|EDM72844.1| ATP-binding region, ATPase-like protein [Roseobacter sp. AzwK-3b]
          Length = 130

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 54/126 (42%), Gaps = 3/126 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD     R V R L    G+ V EA+S  EA E          +++D +M G+  L
Sbjct: 6   SILVVDDDETNRMVVRVLLERRGYQVLEASSGSEALELFAAHSF-KLILMDLAMPGMDGL 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E   ++R+   G  V V  L              AG N+ L KPF+ +     M  L   
Sbjct: 65  ETTQYIRRHDKGAYVSVAALTANTTLSDQEKCHDAGMNAVLSKPFDPQQFDRLMFLLNGE 124

Query: 121 QKSKDE 126
           +  KD+
Sbjct: 125 EAGKDD 130


>gi|146342885|ref|YP_001207933.1| putative response regulator receiver [Bradyrhizobium sp. ORS278]
 gi|146195691|emb|CAL79718.1| putative Response regulator receiver (CheY-like protein)
           [Bradyrhizobium sp. ORS278]
          Length = 131

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 56/113 (49%), Gaps = 8/113 (7%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNY-LVI-DESMEGVL- 60
           +L+VD    + ++ R+L    GF   +  S  +      K     Y LVI D +ME +  
Sbjct: 9   VLVVDDYSTMIRIIRNLLKQIGFEDIDDAS--DGSMALNKMRAKKYGLVISDWNMEPMTG 66

Query: 61  -EFIAHVRQMP-LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
            + +  VR  P L T  F+  +  E   E +IA  +AG N++++KPFN  TL+
Sbjct: 67  YDLLREVRADPNLATTPFIM-ITAESKTENVIAAKKAGVNNYIVKPFNAATLK 118


>gi|152978555|ref|YP_001344184.1| two-component response regulator [Actinobacillus succinogenes 130Z]
 gi|150840278|gb|ABR74249.1| two component transcriptional regulator, winged helix family
           [Actinobacillus succinogenes 130Z]
          Length = 235

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/121 (25%), Positives = 55/121 (45%), Gaps = 2/121 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+V+   I R   + +F   G+ VFEAT   +      +  + + +V+D ++ G    +
Sbjct: 6   ILVVEDETITRNTLKSIFEAEGYHVFEATDGAQMHRVLAEHTI-HLVVMDINLPGKNGLM 64

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
              R++    D+ + +L    +    I G   GA+ +L KPFN   L    R L Q   S
Sbjct: 65  L-ARELRENADIALIFLTGRDNEVDKILGLEIGADDYLTKPFNPRELTIRARNLLQRTMS 123

Query: 124 K 124
           +
Sbjct: 124 E 124


>gi|304396258|ref|ZP_07378140.1| response regulator receiver protein [Pantoea sp. aB]
 gi|304356627|gb|EFM20992.1| response regulator receiver protein [Pantoea sp. aB]
          Length = 129

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 58/113 (51%), Gaps = 12/113 (10%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCE-----KELLPNYLVIDESMEGV 59
           L+VD  + +R++ R+L  + GF      +V EA +  +     K    ++++ D +M  +
Sbjct: 9   LVVDDFNTMRRIVRNLLKELGF-----NNVEEAEDGVDALGKLKAGGFDFVISDWNMPNM 63

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             L+ +  +R     + + V  +  E   E +IA A+AGA+ +++KPF   TL
Sbjct: 64  DGLQLLQTIRADAAMSTLPVLMVTAEAKKENIIAAAQAGASGYVVKPFTAATL 116


>gi|317486008|ref|ZP_07944863.1| sigma-54 interaction domain-containing protein [Bilophila
           wadsworthia 3_1_6]
 gi|316922781|gb|EFV44012.1| sigma-54 interaction domain-containing protein [Bilophila
           wadsworthia 3_1_6]
          Length = 467

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/133 (23%), Positives = 55/133 (41%), Gaps = 1/133 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    +R   R +  D G+ V EA +  E  E  + E  P+ + +D  + G+ 
Sbjct: 1   MARILIIDDEEPIRFSLRGILEDEGYEVLEAATAEEGLEVADAER-PDLVFLDIWLPGMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              A  R      D+ V  +      E  ++  + GA  F+ KP + E +        + 
Sbjct: 60  GLTAQARLKGNHPDLPVVMISGHGTIETAVSAIQQGAYDFIEKPLSLEKVVIVAARALEA 119

Query: 121 QKSKDENQFLDAI 133
              + ENQ L  +
Sbjct: 120 GSLRRENQVLRTV 132


>gi|325105862|ref|YP_004275516.1| histidine kinase [Pedobacter saltans DSM 12145]
 gi|324974710|gb|ADY53694.1| histidine kinase [Pedobacter saltans DSM 12145]
          Length = 1375

 Score = 39.7 bits (91), Expect = 0.16,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 59/127 (46%), Gaps = 6/127 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
            +L+VD +  +R   +   N   +++FEA +  +    C KE+ P+ L+I + M   +  I
Sbjct: 1123 ILVVDDNEEIRTFLKETLNK-DYLIFEAENGEQGLILC-KEIYPD-LIISDVMMPKVNGI 1179

Query: 64   AHVRQMPLGTDVFVYYLLM---EVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            +  +Q     D+     +M   +   E  I G  +GA+ +  KP N + L   +R + + 
Sbjct: 1180 SFCKQAKDDIDISHIPFMMLTAKTSLEAEIEGKESGADFYFAKPINIDLLEITLRNIFEQ 1239

Query: 121  QKSKDEN 127
            Q    E+
Sbjct: 1240 QNKLKEH 1246


>gi|285018154|ref|YP_003375865.1| two-component system regulatory protein [Xanthomonas albilineans
           GPE PC73]
 gi|283473372|emb|CBA15877.1| probable two-component system regulatory protein [Xanthomonas
           albilineans]
          Length = 121

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 33/109 (30%), Positives = 50/109 (45%), Gaps = 3/109 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD S  +R++        G+ V EA     A    + +   N +V D +M  +  + 
Sbjct: 5   ILVVDDSASMRQMVSFALTSAGYAVEEAEDGQVALGRAKGQRF-NAVVTDVNMPNMDGIS 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
            I  +RQ+P      +  L  E   EK   G  AGA  +L+KPFN E L
Sbjct: 64  LIRELRQLPDYKFTPMLMLTTESAAEKKSEGKAAGATGWLVKPFNPEQL 112


>gi|326318248|ref|YP_004235920.1| response regulator receiver protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
 gi|323375084|gb|ADX47353.1| response regulator receiver protein [Acidovorax avenae subsp.
           avenae ATCC 19860]
          Length = 122

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 35/120 (29%), Positives = 56/120 (46%), Gaps = 9/120 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEA-REFCEKELLPNYLVIDE----SME 57
           ++L+VD S  VR V        G+ V E     +A R    +++   +L+I +    +M+
Sbjct: 4   TILIVDDSASVRSVVGIALRGAGYDVIEGCDGSDALRRLTGQKV---HLIISDVNMPNMD 60

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           G+  F+  V+ MP      V  L  E    K   G  AGA +++ KPF   TL  A+ +L
Sbjct: 61  GI-TFLKTVKAMPAYRFTPVIMLTTESQEAKKREGQLAGAKAWVTKPFQPPTLLSAVEKL 119


>gi|158339404|ref|YP_001520581.1| two component transcriptional regulator [Acaryochloris marina
           MBIC11017]
 gi|158309645|gb|ABW31262.1| two component transcriptional regulator, winged helix family
           [Acaryochloris marina MBIC11017]
          Length = 238

 Score = 39.7 bits (91), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 55/117 (47%), Gaps = 3/117 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+V+    + ++ R++    GF+    ++  +A       L P+ +++D  + G+  L
Sbjct: 4   TILIVEDEKEIAQLVRNMLETEGFICETLSNGADALRVV-TVLQPDLVILDLMLPGLDGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           E    +RQ  L  D ++  L    +    I G   GA+ +L KPF+   L   +R L
Sbjct: 63  EVCTRIRQQSLAKDPYILMLTARAEELDRIIGLTTGADDYLTKPFSPRELIARVRAL 119


>gi|328545056|ref|YP_004305165.1| Response regulator receiver (CheY-like protein) [polymorphum gilvum
           SL003B-26A1]
 gi|326414798|gb|ADZ71861.1| Response regulator receiver (CheY-like protein) [Polymorphum gilvum
           SL003B-26A1]
          Length = 127

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 54/111 (48%), Gaps = 4/111 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM-VFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
           +L+VD    + ++ R+L    GF  + +A    EA E   K+     ++ D +ME +   
Sbjct: 9   VLVVDDYKTMIRIIRNLLKQLGFEDIDDAADGTEALEKM-KQRRYGLVISDWNMEPMTGY 67

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
           E +  VR            +  E   E +IA  +AG N++++KPFN +TL+
Sbjct: 68  ELLKQVRSDSGLCKTPFIMVTAESKTENVIAAKKAGVNNYIVKPFNAQTLK 118


>gi|320105191|ref|YP_004180782.1| response regulator receiver protein [Isosphaera pallida ATCC 43644]
 gi|319752473|gb|ADV64233.1| response regulator receiver protein [Isosphaera pallida ATCC 43644]
          Length = 145

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 29/110 (26%), Positives = 50/110 (45%), Gaps = 3/110 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+ S  V ++      D GF V  AT    A +  ++E  P+ +V+D  +  +  F
Sbjct: 4   TILIVEDSPTVLRMASAALEDGGFRVLTATDGEAALQLVKREK-PDLIVLDIILPKINGF 62

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
               H++  P    + +  L  +        G R GA+ +L KPF  E L
Sbjct: 63  QVCRHLKNDPASRHIKILLLSSKSGESDRYWGLRQGADDYLTKPFEPEGL 112


>gi|292491506|ref|YP_003526945.1| diguanylate cyclase [Nitrosococcus halophilus Nc4]
 gi|291580101|gb|ADE14558.1| diguanylate cyclase [Nitrosococcus halophilus Nc4]
          Length = 1499

 Score = 39.3 bits (90), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 31/111 (27%), Positives = 57/111 (51%), Gaps = 5/111 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
            +L+VD    +R   R++  + G+ + EA +  +A  FC ++ +P+ +++D  M  +  F 
Sbjct: 927  VLIVDDDRAMRMALRNVLEEGGYRIEEAVNGEQALAFCRRQ-MPDLVLMDAVMPLLDGFK 985

Query: 64   A--HVRQMPLGTDVFVYYLLMEVDFEKMIAGA-RAGANSFLLKPFNRETLR 111
            A   +R MP G