PSIBLAST alignment of GI: 254780892 and protein with PDB id: 1nxt

>gi|46014956|pdb|1NXT|A Chain A, Micarec Ph 4.0 Length = 120
>gi|116666721|pdb|2A9R|A Chain A, Rr02-Rec Phosphate In The Active Site Length = 120
 Score =  141 bits (357), Expect = 4e-32,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 51/122 (41%), Gaps = 2/122 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++   +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-QPDIIILXLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QK 122
            +
Sbjct: 119 SQ 120