PSIBLAST alignment of GI: 254780892 and protein with PDB id: 2jba

>gi|126031096|pdb|2JBA|B Chain B, Phob Response Regulator Receiver Domain Constitutively- Active Double Mutant D53a And Y102c Length = 127
 Score =  144 bits (364), Expect = 5e-33,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++   + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLAWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+  + KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDCITKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122