BLASTP 2.2.22 [Sep-27-2009]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.


Reference for composition-based statistics:
Schaffer, Alejandro A., L. Aravind, Thomas L. Madden,
Sergei Shavirin, John L. Spouge, Yuri I. Wolf,  
Eugene V. Koonin, and Stephen F. Altschul (2001), 
"Improving the accuracy of PSI-BLAST protein database searches with 
composition-based statistics and other refinements",  Nucleic Acids Res. 29:2994-3005.

Query= gi|254780892|ref|YP_003065305.1| probable two-component
response regulator protein [Candidatus Liberibacter asiaticus str.
psy62]
         (133 letters)

Database: nr 
           14,124,377 sequences; 4,842,793,630 total letters

Searching..................................................done



>gi|260892897|ref|YP_003238994.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
 gi|260865038|gb|ACX52144.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
          Length = 231

 Score =  167 bits (424), Expect = 5e-40,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 59/132 (44%), Gaps = 3/132 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    ++K+     +  GF V  A    +A E   +   P+ +++D  +  + 
Sbjct: 1   MPLVLVVDDEEHIQKLLHFTLSKEGFQVLVAADGPQALEMARQH-RPDVIILDLMLPALD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+ P   ++ V  L      E  + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GFTVCELLRRDPSLKEIPVIVLSARGTEEDKVRGLDIGADDYVTKPFSPRELAARVKAQL 119

Query: 119 QMQKSKDENQFL 130
           + ++S+ E + L
Sbjct: 120 RRRQSQAEREKL 131


>gi|323702131|ref|ZP_08113798.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323532818|gb|EGB22690.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 231

 Score =  163 bits (415), Expect = 6e-39,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 50/123 (40%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++ ++     GF V  A       +    E  P+ +++D  + G+ 
Sbjct: 1   MPKILVVDDEQPIRELVKYNLEREGFEVLLAGDGNTGLDMARTE-APDLIILDIMLPGMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  + Q P    + +  L    +    + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLSVCRTLHQEPATRAIPIIMLSARGEEVDKVLGLELGADDYITKPFSPRELIARVKARL 119

Query: 119 QMQ 121
           + Q
Sbjct: 120 RRQ 122


>gi|127513677|ref|YP_001094874.1| two component transcriptional regulator [Shewanella loihica PV-4]
 gi|126638972|gb|ABO24615.1| two component transcriptional regulator, winged helix family
           [Shewanella loihica PV-4]
          Length = 241

 Score =  163 bits (414), Expect = 7e-39,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A +    E  P+ +++D    G    
Sbjct: 16  RILIVEDELAIREMLAFVLEQHGFTTTTAEDFDSALDML-SEPYPDLVLLDWMFPGGSGI 74

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 75  QLAKKLRQDEFTRHIPVIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVMRR 134

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 135 AAPTALEEPID 145


>gi|86610346|ref|YP_479108.1| response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558888|gb|ABD03845.1| response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 373

 Score =  163 bits (414), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 33/138 (23%), Positives = 57/138 (41%), Gaps = 7/138 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+VD    +R V +      G+ V  A++  E  E     L+P  ++ D  M  + 
Sbjct: 1   MTTILIVDDDPTIRLVLKRSLERQGYTVEMASNGSEGLEQAHL-LVPGLIICDWMMPDMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  ++  P  +  F   L    + E  I G  AGA+ FL KP +   LR  +R   
Sbjct: 60  GLEVCRRIKADPKFSTTFFILLTARTEVEDRIQGLDAGADEFLSKPIDPNELRARVRAGL 119

Query: 119 QMQK----SKDENQFLDA 132
           ++ +     + +   L A
Sbjct: 120 RLHQLSYDLQQQTARLRA 137


>gi|109897378|ref|YP_660633.1| two component transcriptional regulator [Pseudoalteromonas
           atlantica T6c]
 gi|332307706|ref|YP_004435557.1| two component transcriptional regulator PhoB, winged helix family
           [Glaciecola agarilytica 4H-3-7+YE-5]
 gi|109699659|gb|ABG39579.1| two component transcriptional regulator, winged helix family
           [Pseudoalteromonas atlantica T6c]
 gi|332175035|gb|AEE24289.1| two component transcriptional regulator PhoB, winged helix family
           [Glaciecola agarilytica 4H-3-7+YE-5]
          Length = 229

 Score =  163 bits (414), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +LLV+    +R++ + +    G+   EA     A E    E  P+ +++D  + G   
Sbjct: 3   KRVLLVEDEAPIREMLKFVLEQSGYETIEAEDFDVALEKVV-EPYPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++Q     D+ +  +    + E  + G  +GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  VQLAKRLKQHEFTRDIPIIMVTARGEEEDKVRGLDSGADDYVTKPFSPKELVARIKAVIR 121

Query: 120 MQKSKDENQFLD 131
                  ++ ++
Sbjct: 122 RVTPTSSDELIE 133


>gi|333025498|ref|ZP_08453562.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
 gi|332745350|gb|EGJ75791.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
          Length = 264

 Score =  163 bits (414), Expect = 8e-39,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 57/136 (41%), Gaps = 7/136 (5%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  R      G+ V  A    EA +       P+ +V+D  M G+  
Sbjct: 33  QRILVVDDEPAVREALRRSLVFEGYGVEVAADGHEALQKAAATP-PDLVVLDIQMPGMDG 91

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM- 120
             A  R    G+ V V  L         + G  AGA+ +L+KPF  + L   +R L +  
Sbjct: 92  LTAARRLRATGSTVPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRRS 151

Query: 121 -----QKSKDENQFLD 131
                Q++ D+ + L 
Sbjct: 152 SYAVAQQAADDEETLA 167


>gi|326442416|ref|ZP_08217150.1| putative two-component systen response regulator [Streptomyces
           clavuligerus ATCC 27064]
          Length = 342

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    VR+  +      G+    A    +A    E    P+ LV+D  M  +   
Sbjct: 108 RILIVDDEPAVREALQRSLAFEGYATEVAVDGIDALAKAES-YRPDLLVLDIQMPRMDGL 166

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            A  R    G+ V V  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 167 TAARRLRATGSTVPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 224


>gi|158334336|ref|YP_001515508.1| two-component response regulator [Acaryochloris marina MBIC11017]
 gi|158304577|gb|ABW26194.1| two-component response regulator, putative [Acaryochloris marina
           MBIC11017]
          Length = 375

 Score =  163 bits (413), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 35/138 (25%), Positives = 58/138 (42%), Gaps = 7/138 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D   I + + R      G+ V  A+   E      ++L P  ++ D  M    
Sbjct: 1   MVKILIIDDDPITQLLLRRTLEKQGYQVTVASDGQEGLSKA-QQLCPALIICDWMMPVLD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +     ++  P  +  F   L    D E  IAG  AGA+ FL KP +   LR  +R   
Sbjct: 60  GIGVCQQLKSNPQLSATFFILLTSRSDLEDRIAGLNAGADEFLTKPIDMSELRARVRAGL 119

Query: 119 QM----QKSKDENQFLDA 132
           ++    Q   ++ Q L+A
Sbjct: 120 RLYHLNQDLHEQKQRLEA 137


>gi|294814012|ref|ZP_06772655.1| Two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
 gi|294326611|gb|EFG08254.1| Two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
          Length = 340

 Score =  162 bits (412), Expect = 1e-38,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    VR+  +      G+    A    +A    E    P+ LV+D  M  +   
Sbjct: 106 RILIVDDEPAVREALQRSLAFEGYATEVAVDGIDALAKAES-YRPDLLVLDIQMPRMDGL 164

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            A  R    G+ V V  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 165 TAARRLRATGSTVPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 222


>gi|117619543|ref|YP_855794.1| phosphate regulon transcriptional regulatory protein PhoB
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
 gi|117560950|gb|ABK37898.1| phosphate regulon transcriptional regulatory protein PhoB
           [Aeromonas hydrophila subsp. hydrophila ATCC 7966]
          Length = 229

 Score =  161 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA    +      +E  P  +V+D  M G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQKGYETVEAEDFADGLAKV-REPYPELIVLDWMMPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI  ++Q  +   + V  L    + E  + G  AGA+ ++ KPF+ + L   +  + +
Sbjct: 62  IQFIKQLKQDEVTRQIPVVMLTARGEEEDKVRGLEAGADDYITKPFSPKELTARLHAVMR 121

Query: 120 MQKSKDENQFLD 131
                  ++ ++
Sbjct: 122 RVSPTSVDEVIE 133


>gi|163751022|ref|ZP_02158253.1| phosphate regulon response regulator PhoB [Shewanella benthica
           KT99]
 gi|161329183|gb|EDQ00182.1| phosphate regulon response regulator PhoB [Shewanella benthica
           KT99]
          Length = 229

 Score =  161 bits (410), Expect = 2e-38,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++ + +    GF    A     A      E  P+ +++D    G    
Sbjct: 4   KILIVEDELAIREMLKFVLEQHGFTTTSAEDFDSALNMI-SEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLRQDEFTRRIPIIMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SSPTSSEEPID 133


>gi|330830656|ref|YP_004393608.1| phosphate regulon transcriptional regulatory protein PhoB
           [Aeromonas veronii B565]
 gi|328805792|gb|AEB50991.1| Phosphate regulon transcriptional regulatory protein PhoB
           [Aeromonas veronii B565]
          Length = 229

 Score =  161 bits (408), Expect = 3e-38,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA    +      +E  P  +V+D  M G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQKGYETIEAEDYADGLAKV-REPYPELIVLDWMMPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI  ++Q  +   + V  L    + E  + G  AGA+ ++ KPF+ + L   +  + +
Sbjct: 62  IQFIKQLKQDEVTRQIPVVMLTARGEEEDKVRGLEAGADDYITKPFSPKELTARLHAVMR 121

Query: 120 MQKSKDENQFLD 131
                  ++ ++
Sbjct: 122 RVSPTSVDEVIE 133


>gi|302520777|ref|ZP_07273119.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. SPB78]
 gi|302429672|gb|EFL01488.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. SPB78]
          Length = 244

 Score =  161 bits (408), Expect = 4e-38,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 57/136 (41%), Gaps = 7/136 (5%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  R      G+ V  A    EA +       P+ +V+D  M G+  
Sbjct: 13  QRILVVDDEPAVREALRRSLVFEGYGVEVAADGHEALQKAAATP-PDLVVLDIQMPGMDG 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM- 120
             A  R    G+ V V  L         + G  AGA+ +L+KPF  + L   +R L +  
Sbjct: 72  LTAARRLRATGSTVPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRRS 131

Query: 121 -----QKSKDENQFLD 131
                Q++ D+ + L 
Sbjct: 132 SYAVAQQAADDEETLA 147


>gi|94972307|ref|YP_594347.1| two component transcriptional regulator [Deinococcus geothermalis
           DSM 11300]
 gi|94554358|gb|ABF44273.1| two component transcriptional regulator, winged helix family
           [Deinococcus geothermalis DSM 11300]
          Length = 248

 Score =  160 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 55/132 (41%), Gaps = 2/132 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+V+ +  VR + R    + G+ V  A++  E      +   P+ +++D  M G+ 
Sbjct: 22  MKTVLIVEDNAGVRDMIREYLEEHGYRVRVASNGQEGL-LEARHHRPDLVLLDVMMPGMD 80

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+      V V +L         + G   GA+ ++ KPF+   L   +R   + 
Sbjct: 81  GL-EFLRRFRATEQVPVIFLTARDTELDKVLGLELGADDYVTKPFSMAELLARVRANLRR 139

Query: 121 QKSKDENQFLDA 132
                 N  L A
Sbjct: 140 SSEPLPNAVLRA 151


>gi|85859021|ref|YP_461223.1| response regulator [Syntrophus aciditrophicus SB]
 gi|85722112|gb|ABC77055.1| response regulator with a winged-helix DNA-binding domain
           [Syntrophus aciditrophicus SB]
          Length = 245

 Score =  160 bits (407), Expect = 5e-38,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 51/125 (40%), Gaps = 3/125 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    + ++        GF V +A    EA +       P+ +++D  + G   
Sbjct: 15  KRILVVDDEKDIVELLTFNLEKEGFAVTQAFDGEEALKTIRTNK-PDLVILDLMLPGVSG 73

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+    VR+      + V  L  + +    + G   GA+ ++ KPFN   L   +R + +
Sbjct: 74  LDICRQVRRNEETETLPVIMLTAKGEPLDKVVGLEIGADDYITKPFNVRELVARVRAVLR 133

Query: 120 MQKSK 124
               +
Sbjct: 134 RSSQR 138


>gi|254432209|ref|ZP_05045912.1| regulatory protein, LuxR:Response regulator receiver [Cyanobium sp.
           PCC 7001]
 gi|197626662|gb|EDY39221.1| regulatory protein, LuxR:Response regulator receiver [Cyanobium sp.
           PCC 7001]
          Length = 273

 Score =  160 bits (407), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 34/132 (25%), Positives = 53/132 (40%), Gaps = 4/132 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            LLLVD    +R   +    D GF V  A    E  E   +ELLP+ ++ D  M      
Sbjct: 47  RLLLVDDEPGLRTAVKAYLEDEGFAVTTANDGEEGWEKA-QELLPDVVISDVMMPCCDGY 105

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R         V +L  +      IAG +AG + ++ KPF+ + L   +R   + 
Sbjct: 106 GLLRKLRADERLGGTPVIFLTAKGMTADRIAGFQAGCDDYIPKPFDPDELVARVRNAVRR 165

Query: 121 Q-KSKDENQFLD 131
           Q +   E     
Sbjct: 166 QERLLAEAARFA 177


>gi|157376435|ref|YP_001475035.1| two component transcriptional regulator [Shewanella sediminis
           HAW-EB3]
 gi|157318809|gb|ABV37907.1| two component transcriptional regulator, winged helix family
           [Shewanella sediminis HAW-EB3]
          Length = 229

 Score =  160 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A E    E  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVLEQHGFTTTAAEDFDSALEML-SEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLRQDEFTRQIPIIMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARIKAVMRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SSPTSLEEPID 133


>gi|313902101|ref|ZP_07835512.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter subterraneus DSM 13965]
 gi|313467619|gb|EFR63122.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter subterraneus DSM 13965]
          Length = 294

 Score =  160 bits (406), Expect = 6e-38,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 54/125 (43%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V  + +      GF V  A+S  EA     ++  P+ +++D  M G+   
Sbjct: 73  RILVVDDDPAVTSLLKRGLAYEGFAVDTASSGEEALRIAREQP-PDLVILDIMMPGMDGL 131

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R      ++ V +L         + G  AGA+ +++KPF  E L   +R L +  +
Sbjct: 132 EVLQRLRAADPELPVLFLTARDAPADQVQGLEAGADDYVVKPFTFEVLVARVRALLRRHQ 191

Query: 123 SKDEN 127
           ++   
Sbjct: 192 AERPQ 196


>gi|88811179|ref|ZP_01126435.1| phosphate regulon response regulator PhoB [Nitrococcus mobilis
           Nb-231]
 gi|88791718|gb|EAR22829.1| phosphate regulon response regulator PhoB [Nitrococcus mobilis
           Nb-231]
          Length = 228

 Score =  160 bits (406), Expect = 7e-38,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 61/133 (45%), Gaps = 3/133 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+V+    +R++         + V +A S        + E++P+ +++D  + G+ 
Sbjct: 1   MVKILIVEDEAAIREMIAMALIRSDYSVHQADSGEAGLTLLD-EIVPDLVLLDWMLPGMS 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++F   V++ P   DV +  L    + E  I G   GA+ F+ KPF+   L   ++ + 
Sbjct: 60  GIDFARRVKRHPTYRDVPIIMLTARGEEEDKIRGLEVGADDFVTKPFSPRELLARIKAVL 119

Query: 119 QMQKSKDENQFLD 131
           +       ++ ++
Sbjct: 120 RRAAPLSGDERIE 132


>gi|328952021|ref|YP_004369355.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfobacca acetoxidans DSM 11109]
 gi|328452345|gb|AEB08174.1| response regulator receiver sensor signal transduction histidine
           kinase [Desulfobacca acetoxidans DSM 11109]
          Length = 382

 Score =  159 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 28/137 (20%), Positives = 63/137 (45%), Gaps = 6/137 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+ D +    ++ R   +  G+ +  A    EA +   KE  P+ L++D  M     
Sbjct: 29  KKILIADDNPDNVELLRKRLSAQGYQIAAAFDGEEALQAVLKEN-PDLLILDIMMPKLDG 87

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E +  +++     ++ V  L  + +    + G   GA+ ++ KPFN + L   +R L  
Sbjct: 88  YEVLRRLKKQDEYRNLPVILLTAKKEIPDKLKGLDIGADDYITKPFNPQELLARVRSLMA 147

Query: 120 MQKSKD---ENQFLDAI 133
           +++ ++   +++ L A+
Sbjct: 148 LREEQERRAQDERLSAL 164


>gi|147676580|ref|YP_001210795.1| hypothetical protein PTH_0245 [Pelotomaculum thermopropionicum SI]
 gi|146272677|dbj|BAF58426.1| hypothetical protein [Pelotomaculum thermopropionicum SI]
          Length = 357

 Score =  159 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 31/123 (25%), Positives = 52/123 (42%), Gaps = 6/123 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R+V R    + GF V EAT   EA          + L++D  M GV  
Sbjct: 127 TKILVVDDERKIREVVRMYLENEGFAVGEATDGREALNLL-TGGKWDLLILDLMMPGVDG 185

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 VR+    T + +  L         I G   GA+ +++KPF+   L   ++ + +
Sbjct: 186 WSVCREVRK---TTALPIIMLTARDAEVDRIVGLELGADDYVVKPFSPRELVARVKAVLR 242

Query: 120 MQK 122
             +
Sbjct: 243 RSQ 245


>gi|315181014|gb|ADT87928.1| Response regulator [Vibrio furnissii NCTC 11218]
          Length = 203

 Score =  159 bits (405), Expect = 8e-38,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|110801119|ref|YP_695076.1| DNA-binding response regulator [Clostridium perfringens ATCC 13124]
 gi|110675766|gb|ABG84753.1| DNA-binding response regulator [Clostridium perfringens ATCC 13124]
          Length = 231

 Score =  159 bits (405), Expect = 9e-38,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +R++ +      G+    A +  EA     +E+  + +++D  +     
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEAL-KLIREIKFDLILLDLMLPEIDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+    +D+ V  +  + +    + G   GA+ ++ KPF+   L   ++ L +
Sbjct: 63  LEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLR 122

Query: 120 MQKSKDENQFLD 131
               K E   + 
Sbjct: 123 RSNVKKEENIIK 134


>gi|318059644|ref|ZP_07978367.1| two-component system response regulator [Streptomyces sp. SA3_actG]
 gi|318078239|ref|ZP_07985571.1| two-component system response regulator [Streptomyces sp. SA3_actF]
          Length = 244

 Score =  159 bits (405), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 36/136 (26%), Positives = 56/136 (41%), Gaps = 7/136 (5%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  R      G+ V  A    EA         P+ +V+D  M G+  
Sbjct: 13  QRILVVDDEPAVREALRRSLVFEGYGVEVAADGHEALRKAAATP-PDLVVLDIQMPGMDG 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM- 120
             A  R    G+ V V  L         + G  AGA+ +L+KPF  + L   +R L +  
Sbjct: 72  LTAARRLRATGSTVPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRRS 131

Query: 121 -----QKSKDENQFLD 131
                Q++ D+ + L 
Sbjct: 132 SYAVAQQAADDEETLA 147


>gi|77165864|ref|YP_344389.1| phosphate regulon transcriptional regulatory protein phoB
           [Nitrosococcus oceani ATCC 19707]
 gi|254434533|ref|ZP_05048041.1| phosphate regulon transcriptional regulatory protein PhoB
           [Nitrosococcus oceani AFC27]
 gi|76884178|gb|ABA58859.1| two component transcriptional regulator, winged helix family
           [Nitrosococcus oceani ATCC 19707]
 gi|207090866|gb|EDZ68137.1| phosphate regulon transcriptional regulatory protein PhoB
           [Nitrosococcus oceani AFC27]
          Length = 229

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+VD    +R++        G+    A    +A +    E  P+ +++D  + G+   
Sbjct: 4   TILVVDDEAAIREMLGFALTQEGYYYQAAADGEQAWQRI-NESHPDLILLDWMLPGISGV 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++ P   ++ V  L    + E  + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DLARRLKREPSTRELPVIMLTARDEEEDKVRGLNVGADDYITKPFSPTELIARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + ++
Sbjct: 123 SAPLASGEVIE 133


>gi|110640660|ref|YP_668388.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 536]
 gi|110342252|gb|ABG68489.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 536]
          Length = 243

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|145298254|ref|YP_001141095.1| two-component system response regulator PhoB [Aeromonas salmonicida
           subsp. salmonicida A449]
 gi|142851026|gb|ABO89347.1| two-component system response regulator PhoB [Aeromonas salmonicida
           subsp. salmonicida A449]
          Length = 229

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 55/132 (41%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA    +       E  P  +V+D  M G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQKGYETIEAEDYADGLAKVC-EPYPELIVLDWMMPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI  ++Q  +   + V  L    + E  + G  AGA+ ++ KPF+ + L   +  + +
Sbjct: 62  IQFIKQLKQDEVTRQIPVVMLTARGEEEDKVRGLEAGADDYITKPFSPKELTARLHAVMR 121

Query: 120 MQKSKDENQFLD 131
                  ++ ++
Sbjct: 122 RVSPTSVDEVIE 133


>gi|257129263|gb|ACV42481.1| putative adenylate/guanylate cyclase [Lyngbya majuscula 19L]
          Length = 1156

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 2/122 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   + R+V  +  +   + +  AT+  EA E       P+ +++D  M  +   
Sbjct: 746 KILIVDDEPVNRQVISNYLSMENYAIATATNGLEALEMLSTGFQPDLILLDVMMPRMTGY 805

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E  A +RQ  L +++ V  L        ++ G   G N +L KP ++  L   ++   ++
Sbjct: 806 EVCAKIRQKFLPSELPVIMLTANNQISDLVEGFTFGVNDYLTKPCSKHELLARIKSHLRL 865

Query: 121 QK 122
            K
Sbjct: 866 SK 867


>gi|332712429|ref|ZP_08432355.1| signal transduction histidine kinase [Lyngbya majuscula 3L]
 gi|332348724|gb|EGJ28338.1| signal transduction histidine kinase [Lyngbya majuscula 3L]
          Length = 1156

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 55/122 (45%), Gaps = 2/122 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   + R+V  +  +   + +  AT+  EA E       P+ +++D  M  +   
Sbjct: 746 KILIVDDEPVNRQVISNYLSMENYAIATATNGLEALEMLSTGFQPDLILLDVMMPRMTGY 805

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E  A +RQ  L +++ V  L        ++ G   G N +L KP ++  L   ++   ++
Sbjct: 806 EVCAKIRQKFLPSELPVIMLTANNQISDLVEGFTFGVNDYLTKPCSKHELLARIKSHLRL 865

Query: 121 QK 122
            K
Sbjct: 866 SK 867


>gi|302389531|ref|YP_003825352.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
 gi|302200159|gb|ADL07729.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
          Length = 232

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 60/133 (45%), Gaps = 4/133 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++ R    + GF V  A+   +A +  +KE  P+ +++D  + G+   
Sbjct: 5   KILVVDDEPNIVELVRFNLENSGFKVITASDGQQALDLVQKE-QPDLVILDIMLPGIDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R+     D+ V  L  + +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 64  EVCRIFRRQRATRDIPVILLTAKTEEIDKVLGLEMGADDYITKPFSPRELVARVKAVLRR 123

Query: 121 Q-KSKDENQFLDA 132
             K +  ++ + A
Sbjct: 124 ADKVERSDKIIKA 136


>gi|18309624|ref|NP_561558.1| DNA-binding response regulator [Clostridium perfringens str. 13]
 gi|18144301|dbj|BAB80348.1| two-component response regulator [Clostridium perfringens str. 13]
          Length = 231

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +R++ +      G+    A +  EA     +E+  + +++D  +     
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEAL-KVIREIKFDLILLDLMLPEIDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+    +D+ V  +  + +    + G   GA+ ++ KPF+   L   ++ L +
Sbjct: 63  LEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLR 122

Query: 120 MQKSKDENQFLD 131
               K E   + 
Sbjct: 123 RSNVKKEENIIK 134


>gi|168206757|ref|ZP_02632762.1| DNA-binding response regulator [Clostridium perfringens E str.
           JGS1987]
 gi|168211944|ref|ZP_02637569.1| DNA-binding response regulator [Clostridium perfringens B str. ATCC
           3626]
 gi|182625729|ref|ZP_02953497.1| DNA-binding response regulator [Clostridium perfringens D str.
           JGS1721]
 gi|170661839|gb|EDT14522.1| DNA-binding response regulator [Clostridium perfringens E str.
           JGS1987]
 gi|170710113|gb|EDT22295.1| DNA-binding response regulator [Clostridium perfringens B str. ATCC
           3626]
 gi|177908991|gb|EDT71473.1| DNA-binding response regulator [Clostridium perfringens D str.
           JGS1721]
          Length = 231

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +R++ +      G+    A +  EA +   +E+  + +++D  +     
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKII-REIKFDLILLDLMLPEIDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+    +D+ V  +  + +    + G   GA+ ++ KPF+   L   ++ L +
Sbjct: 63  LEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLR 122

Query: 120 MQKSKDENQFLD 131
               K E   + 
Sbjct: 123 RSNVKKEENIIK 134


>gi|295837513|ref|ZP_06824446.1| DNA-binding response regulator [Streptomyces sp. SPB74]
 gi|295826557|gb|EFG64921.1| DNA-binding response regulator [Streptomyces sp. SPB74]
          Length = 244

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 33/119 (27%), Positives = 49/119 (41%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  R      G+ V  A    EA         P+ +V+D  M G+  
Sbjct: 13  QRILVVDDEPAVREALRRSLVFEGYGVEVAADGHEALRQAAATP-PDLVVLDIQMPGMDG 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+ V V  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 72  LTAARRLRATGSTVPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 130


>gi|169344709|ref|ZP_02630248.2| DNA-binding response regulator [Clostridium perfringens C str.
           JGS1495]
 gi|169297144|gb|EDS79259.1| DNA-binding response regulator [Clostridium perfringens C str.
           JGS1495]
          Length = 231

 Score =  159 bits (404), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +R++ +      G+    A +  EA +   +E+  + +++D  +     
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKII-REIKFDLILLDLMLPEIDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+    +D+ V  +  + +    + G   GA+ ++ KPF+   L   ++ L +
Sbjct: 63  LEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLR 122

Query: 120 MQKSKDENQFLD 131
               K E   + 
Sbjct: 123 RSNVKKEENIIK 134


>gi|212634120|ref|YP_002310645.1| transcriptional regulatory protein [Shewanella piezotolerans WP3]
 gi|212555604|gb|ACJ28058.1| Response regulator receiver:Transcriptional regulatory protein
           [Shewanella piezotolerans WP3]
          Length = 229

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 48/120 (40%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A +    E  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVLEQHGFTTTAAEDYDSALDML-TEPYPDLVLLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + +  L    + E  + G   GA+ F+ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLRQDEFTRHIPIIMLTARGEEEDKVRGLEVGADDFITKPFSPKELVARIKAVMRR 122


>gi|86605678|ref|YP_474441.1| response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86554220|gb|ABC99178.1| response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 374

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 33/138 (23%), Positives = 55/138 (39%), Gaps = 7/138 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+VD    +R V +      G+ V  A+   E  E     L P  ++ D  M  + 
Sbjct: 1   MTAILIVDDDPTIRLVLKRSLERQGYTVEMASGGLEGLEKAHL-LTPGLIICDWMMPDMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  ++  P  +  F   L    + E  I G  AGA+ FL KP +   LR  +R   
Sbjct: 60  GLEVCRRIKADPKFSTTFFILLTARTEVEDRIQGLDAGADEFLSKPIDPNELRARVRAGL 119

Query: 119 QMQK----SKDENQFLDA 132
           ++ +     + +   L A
Sbjct: 120 RLHQLSYDLQQQTARLRA 137


>gi|300113425|ref|YP_003760000.1| winged helix family two component transcriptional regulator
           [Nitrosococcus watsonii C-113]
 gi|299539362|gb|ADJ27679.1| two component transcriptional regulator, winged helix family
           [Nitrosococcus watsonii C-113]
          Length = 231

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 23/136 (16%), Positives = 56/136 (41%), Gaps = 6/136 (4%)

Query: 1   MD---SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
           M    ++L+VD    +R++        G+    A    +A +    E  P+ +++D  + 
Sbjct: 1   MKMAATILIVDDEAAIREMLGFALTQEGYHYQVAADGEQAWQQI-NEFRPDLILLDWMLP 59

Query: 58  GVLE--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           G+        +++ P   ++ V  L    + E  + G   GA+ ++ KPF+   L   ++
Sbjct: 60  GISGVDLARRLKREPSTRELPVIMLTARDEEEDKVRGLNVGADDYITKPFSPMELIARIK 119

Query: 116 ELPQMQKSKDENQFLD 131
            + +        + ++
Sbjct: 120 AVLRRSAPLLSGEVIE 135


>gi|147678166|ref|YP_001212381.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146274263|dbj|BAF60012.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 239

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 28/135 (20%), Positives = 58/135 (42%), Gaps = 4/135 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD    + ++ R      G+ V  A    +  E    E  P+ +V+D  + G+ 
Sbjct: 1   MPKILVVDDEKNILELVRFNLEREGYQVLTALDGPQGLELARAE-RPDLIVLDVMLPGMN 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    + +     ++ V  L    +    + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCREMHRDAATKNIPVIMLSARAEELDRVLGLEMGADDYITKPFSPRELVARIKARL 119

Query: 119 QMQKSKDENQFLDAI 133
           +  + K+E +  +A+
Sbjct: 120 RRIQ-KEEGREREAV 133


>gi|168218156|ref|ZP_02643781.1| DNA-binding response regulator [Clostridium perfringens NCTC 8239]
 gi|182379830|gb|EDT77309.1| DNA-binding response regulator [Clostridium perfringens NCTC 8239]
          Length = 231

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +R++ +      G+    A +  EA     +E+  + +++D  +     
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALNII-REIKFDLILLDLMLPEIDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+    +D+ V  +  + +    + G   GA+ ++ KPF+   L   ++ L +
Sbjct: 63  LEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLR 122

Query: 120 MQKSKDENQFLD 131
               K E   + 
Sbjct: 123 RSNVKKEENIIK 134


>gi|308050509|ref|YP_003914075.1| two component transcriptional regulator, winged helix family
           [Ferrimonas balearica DSM 9799]
 gi|307632699|gb|ADN77001.1| two component transcriptional regulator, winged helix family
           [Ferrimonas balearica DSM 9799]
          Length = 229

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 53/131 (40%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+V+    +R++   + +  GF    A    +       E  P+ +++D  + G    
Sbjct: 4   NILIVEDESAIREMLTFVLDQHGFRTTSAADYDQGLNAI-SEPYPDLVLLDWMLPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKALRQDEHTRQIPIIMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + ++
Sbjct: 123 SAPTRLEEAVE 133


>gi|91779864|ref|YP_555072.1| GAF sensor hybrid histidine kinase [Burkholderia xenovorans LB400]
 gi|91692524|gb|ABE35722.1| GAF sensor hybrid histidine kinase [Burkholderia xenovorans LB400]
          Length = 1651

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 51/128 (39%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            LL+VD +  +R+    +    G  V  AT    A E   +E  P+ ++ D  M      
Sbjct: 661 RLLVVDDNADLREYMSRILRAAGHEVRLATDGQAALEAARQE-RPDLVLSDVMMPRLDGF 719

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R  P   D  V  L      E  + G   GA+ +L KPF+   L   +    Q+
Sbjct: 720 GLLRALRADPELRDTPVLMLSARAGEEARVDGIEHGADDYLTKPFSARELLARVSGNLQL 779

Query: 121 QKSKDENQ 128
            + + E +
Sbjct: 780 ARLRRETE 787



 Score = 87.6 bits (217), Expect = 5e-16,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 47/127 (37%), Gaps = 7/127 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
            ++L+V+    VR     + +D G+ V +A     A    E  +  + L  D  M G L  
Sbjct: 1378 TVLVVEDDEEVRTTVVEMLSDLGYRVLKAKDAQSALAIVESGVPIDVLFTDVVMPGPLRS 1437

Query: 61   -EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAG-ARAGANSFLLKPFNRETLRFAMRELP 118
             E     +       + V +     D   + +G    G    L KP+  E L   +R + 
Sbjct: 1438 TELAR--KARERLPAIAVLFTSGYTDNAIVHSGRLDEGI-ELLSKPYTHEALARKIRYVL 1494

Query: 119  QMQKSKD 125
            Q Q  + 
Sbjct: 1495 QTQNPQA 1501



 Score = 62.1 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 42/123 (34%), Gaps = 13/123 (10%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
             +LLV+   +VR     L   F F + EA    +A +    E   + ++ D  + G    
Sbjct: 1536 RILLVEDDELVRASTAELLRMFEFDILEAEGEHDA-KQILSEHAISVMLTDVGLAGKSGV 1594

Query: 63   IAHVRQMPLGTDVFVYYLLMEV---DFEKMI---AGARAGANSFLLKPFNRETLRFAMRE 116
               +       D+ V +L         E+               L KP++   L  A++ 
Sbjct: 1595 DLALEVCAGRPDLRVIFLTGYDLVLTPEQRKVLPHAI------LLRKPYDLLDLIDALKT 1648

Query: 117  LPQ 119
              +
Sbjct: 1649 PLR 1651


>gi|168214874|ref|ZP_02640499.1| DNA-binding response regulator [Clostridium perfringens CPE str.
           F4969]
 gi|170713701|gb|EDT25883.1| DNA-binding response regulator [Clostridium perfringens CPE str.
           F4969]
          Length = 231

 Score =  159 bits (403), Expect = 1e-37,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +R++ +      G+    A +  EA +   +E+  + +++D  +     
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDTEVAVNGTEALKII-REIKFDLILLDLMLPEIDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+    +D+ V  +  + +    + G   GA+ ++ KPF+   L   ++ L +
Sbjct: 63  LEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLR 122

Query: 120 MQKSKDENQFLD 131
               K E   + 
Sbjct: 123 RSNVKKEENIIK 134


>gi|317154759|ref|YP_004122807.1| response regulator receiver [Desulfovibrio aespoeensis Aspo-2]
 gi|316945010|gb|ADU64061.1| response regulator receiver [Desulfovibrio aespoeensis Aspo-2]
          Length = 228

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 51/125 (40%), Gaps = 3/125 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+     R++ ++     GF V  A          E    P+ +++D  M G+   
Sbjct: 5   KILVVEDHKDTRELLKYNLTAAGFDVAAAEDGASGLALAEA-FKPDIVLLDLMMPGMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++     + + V  L  + +    I G   GA+ +++KPF+   L   ++ + + 
Sbjct: 64  EVCRQIKGNSSLSRIPVIMLTAKGEEIDKIVGLELGADDYIVKPFSPRELVLRIKAVLRR 123

Query: 121 QKSKD 125
              ++
Sbjct: 124 AGGRE 128


>gi|291568228|dbj|BAI90500.1| two-component hybrid sensor and regulator [Arthrospira platensis
           NIES-39]
          Length = 1336

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 58/126 (46%), Gaps = 2/126 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   I  +V  +      + V +AT+  EA E  E   +P+ +++D  M  +   
Sbjct: 872 KILIVDDDPINLQVLANYLYLENYAVTQATNGMEALEILESGFIPDLILLDVMMPRMTGY 931

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+      + +  L  +     ++ G   GAN +L KP N+E L   ++   ++
Sbjct: 932 EVTEKIREDWPPHQLPIMMLTAKNRISDLVVGLELGANDYLSKPLNKEELLARIKTHIRI 991

Query: 121 QKSKDE 126
           +K + E
Sbjct: 992 KKLRTE 997


>gi|328948860|ref|YP_004366197.1| transcriptional regulator [Treponema succinifaciens DSM 2489]
 gi|328449184|gb|AEB14900.1| two component transcriptional regulator, winged helix family
           [Treponema succinifaciens DSM 2489]
          Length = 231

 Score =  159 bits (403), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 56/123 (45%), Gaps = 4/123 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++ ++      +  F A +  +A E C +   P+ +++D  +  + 
Sbjct: 1   MK-ILIVDDEEPIRELIKYNVEKQKYETFTAENGQQALELC-RNKNPDLVILDLMLPDMS 58

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R      ++ +  +  + +   ++ G   GA+ ++ KPF+ + L   ++ + 
Sbjct: 59  GLDICRIIRNDSSIKNIPIIMVTAKTEDSDIVTGLELGADDYVTKPFSPKVLLARIQSVL 118

Query: 119 QMQ 121
           + +
Sbjct: 119 RRK 121


>gi|95929117|ref|ZP_01311862.1| two component transcriptional regulator, winged helix family
           [Desulfuromonas acetoxidans DSM 684]
 gi|95135018|gb|EAT16672.1| two component transcriptional regulator, winged helix family
           [Desulfuromonas acetoxidans DSM 684]
          Length = 231

 Score =  158 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 59/129 (45%), Gaps = 3/129 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+V+    +  +  +  +  GF V  AT+  +  E   KE  P+ +++D  + G+  
Sbjct: 3   KNILIVEDEEDILALVHYNLSRDGFEVTTATTGEDGVEQARKEH-PDLMILDLMLPGMDG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +++     D+ +  L  + +   ++ G   GA  ++ KPF+ + L   ++ + +
Sbjct: 62  LEVCETLKKDRELRDIPIVMLTAKGEESDIVKGLEMGAADYVTKPFSPKVLLARVKAVLR 121

Query: 120 MQKSKDENQ 128
             +  DE +
Sbjct: 122 RYEQGDETE 130


>gi|329937264|ref|ZP_08286863.1| response regulator [Streptomyces griseoaurantiacus M045]
 gi|329303545|gb|EGG47431.1| response regulator [Streptomyces griseoaurantiacus M045]
          Length = 277

 Score =  158 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 49/121 (40%), Gaps = 2/121 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    V +V     +  G++V  A     A +       P+ +V+D  + G+  
Sbjct: 20  TRILVVDDDPTVAEVVSGYLDRAGYVVDRAEDGPAALDRAAAH-RPDLVVLDLMLPGMDG 78

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R    G  V V  L    D +  I G   GA+ ++ KPF+   L   ++ + +  
Sbjct: 79  LEVCRRLRENGP-VPVVMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVQSVLRRA 137

Query: 122 K 122
           +
Sbjct: 138 R 138


>gi|157962787|ref|YP_001502821.1| two component transcriptional regulator [Shewanella pealeana ATCC
           700345]
 gi|157847787|gb|ABV88286.1| two component transcriptional regulator, winged helix family
           [Shewanella pealeana ATCC 700345]
          Length = 229

 Score =  158 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 48/120 (40%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    G+    A     A +    E  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVLEQHGYTTVAAEDYDSALDML-TEPYPDLVLLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + +  L    + E  + G   GA+ F+ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLRQDEFTRHIPIIMLTARGEEEDKVRGLEVGADDFMTKPFSPKELVARIKAVMRR 122


>gi|220935638|ref|YP_002514537.1| response regulator receiver protein [Thioalkalivibrio sp. HL-EbGR7]
 gi|219996948|gb|ACL73550.1| response regulator receiver protein [Thioalkalivibrio sp. HL-EbGR7]
          Length = 216

 Score =  158 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 62/132 (46%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+V+    +R++        GF V EA    EA+E      LP+ +++D  + G   
Sbjct: 8   KTVLIVEDEPAIREMVSFALARAGFEVDEAVDGGEAQERI-ASRLPDMILLDWMLPGTSG 66

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           ++    +++     DV +  L    + +  + G  AG + ++ KPF+   L   ++ + +
Sbjct: 67  IDLARRLKRDEYTRDVPIIMLTARGEEDDRVGGLEAGVDDYVTKPFSPRELVARIKAVMR 126

Query: 120 MQKSKDENQFLD 131
               ++E++ L+
Sbjct: 127 RTVPENEDKPLE 138


>gi|220932997|ref|YP_002509905.1| two component transcriptional regulator, winged helix family
           [Halothermothrix orenii H 168]
 gi|219994307|gb|ACL70910.1| two component transcriptional regulator, winged helix family
           [Halothermothrix orenii H 168]
          Length = 226

 Score =  158 bits (402), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 53/128 (41%), Gaps = 4/128 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+ +L++D    +R++ +      G+ V  A    E  +        + +++D  +  + 
Sbjct: 1   MEKILVIDDEENIRELIKFNLETAGYRVELAADGEEGWDRL--NDSIDLIILDLMLPRID 58

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
              F   VR      D+ +  L  + +    I G   GA+ ++ KPF+   L   ++ + 
Sbjct: 59  GLSFCRQVRSNNRFKDIPIIMLTAKGEEVDKIIGLEMGADDYITKPFSPRELVARIKAVL 118

Query: 119 QMQKSKDE 126
           +  +  +E
Sbjct: 119 RRVQKNEE 126


>gi|108803229|ref|YP_643166.1| two component transcriptional regulator [Rubrobacter xylanophilus
           DSM 9941]
 gi|108764472|gb|ABG03354.1| two component transcriptional regulator, winged helix family
           [Rubrobacter xylanophilus DSM 9941]
          Length = 234

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 28/138 (20%), Positives = 51/138 (36%), Gaps = 7/138 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+    VR V  H  +  G           A E        + +++D  + G+ 
Sbjct: 1   MARVLIVEDDPAVRDVVEHTLSREGIETETVPDGETALELLSDSKPFDLVLLDVMLPGMD 60

Query: 61  E--FIAHVRQ-MPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                  +R+       V V  L    D   ++ G   GA+ ++ KPF+   L   +R  
Sbjct: 61  GISVCRELRESHSPHRTVPVVMLTARDDETSIVVGLEVGADDYITKPFSPRQLASRVRAQ 120

Query: 118 PQMQKSKD----ENQFLD 131
            + Q+       E + L+
Sbjct: 121 LRRQRMNAQASPEQRKLE 138


>gi|89072496|ref|ZP_01159068.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium sp. SKA34]
 gi|89051600|gb|EAR57053.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium sp. SKA34]
          Length = 1132

 Score =  158 bits (401), Expect = 2e-37,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 59/128 (46%), Gaps = 3/128 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   +  ++  +     G+ V  A S  +A +  +++  P+ +++D  M  +   E
Sbjct: 721 ILVVDDEPVNLQILNNFLRLAGYRVKTAESGHQAIDIVQQQ-RPDLILLDIMMPEMSGYE 779

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+     ++ +  L      +  I G   GAN +L KPFN+E L   ++   Q  
Sbjct: 780 VCTLLRKQYSIFELPIMMLSALGQIQDRIKGFECGANDYLTKPFNKEELIARIQAYLQAS 839

Query: 122 KSKDENQF 129
           K++ E Q 
Sbjct: 840 KTEQEKQR 847


>gi|238765163|ref|ZP_04626095.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           kristensenii ATCC 33638]
 gi|238696597|gb|EEP89382.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           kristensenii ATCC 33638]
          Length = 279

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 53  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPYPDLVLLDWMLPGGSG 111

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 112 IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 171

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 172 RISPMAVEEVIE 183


>gi|320181620|gb|EFW56535.1| transcriptional regulator PhoB [Shigella boydii ATCC 9905]
          Length = 229

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 58/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
              S    + ++
Sbjct: 122 RISSMAVEEVIE 133


>gi|77918267|ref|YP_356082.1| two-component response regulator PhoB [Pelobacter carbinolicus DSM
           2380]
 gi|77544350|gb|ABA87912.1| two-component response regulator PhoB [Pelobacter carbinolicus DSM
           2380]
          Length = 230

 Score =  158 bits (401), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 57/127 (44%), Gaps = 3/127 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +  +  +     GF V  A +  E  E    E  P+ +V+D  + G+  
Sbjct: 4   KHILVVEDEEDILALLHYNLVREGFRVSLAGTGEEGLETL-AEDPPDLVVLDLMLPGMDG 62

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +++      + V  +  + +   ++AG   GA+ ++ KPF+ + L   +R + +
Sbjct: 63  LQVCRALKENADTRHIAVVMVTAKGEEADVVAGLELGADDYVTKPFSPKILIARIRSVLR 122

Query: 120 MQKSKDE 126
            ++S DE
Sbjct: 123 RRESADE 129


>gi|297569540|ref|YP_003690884.1| two component transcriptional regulator, winged helix family
           [Desulfurivibrio alkaliphilus AHT2]
 gi|296925455|gb|ADH86265.1| two component transcriptional regulator, winged helix family
           [Desulfurivibrio alkaliphilus AHT2]
          Length = 237

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 61/128 (47%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+V+    ++++  +     GF V  A +  +A    ++E  P+ +V+D  + G+   
Sbjct: 11  TILIVEDDENIQQLVGYNLVKAGFQVIYADNGEQALALVQRE-APDLVVLDVMLPGMDGY 69

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+ P    + +  L    D + + AG   GA+ ++ KPF+ + L   ++   + 
Sbjct: 70  QICKTLRRDPRHRWLPIIMLTARSDDDDVTAGLDQGADDYITKPFSPKILVSRVKSALRR 129

Query: 121 QKSKDENQ 128
            +  D+++
Sbjct: 130 SRELDQDE 137


>gi|197250808|ref|YP_002145379.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Agona str. SL483]
 gi|197214511|gb|ACH51908.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Agona str.
           SL483]
          Length = 229

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREALTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|284051798|ref|ZP_06382008.1| adenylate/guanylate cyclase [Arthrospira platensis str. Paraca]
          Length = 558

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 58/126 (46%), Gaps = 2/126 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   I  +V  +      + V +AT+  EA E  E   +P+ +++D  M  +   
Sbjct: 94  KILIVDDDPINLQVLANYLYLENYAVTQATNGMEALEILESGFIPDLILLDVMMPRMTGY 153

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+      + +  L  +     ++ G   GAN +L KP N+E L   ++   ++
Sbjct: 154 EVTEKIREDWPPHQLPIMMLTAKNRISDLVVGLELGANDYLSKPLNKEELLARIKTHIRI 213

Query: 121 QKSKDE 126
           +K + E
Sbjct: 214 KKLRTE 219


>gi|296132738|ref|YP_003639985.1| two component transcriptional regulator, winged helix family
           [Thermincola sp. JR]
 gi|296031316|gb|ADG82084.1| two component transcriptional regulator, winged helix family
           [Thermincola potens JR]
          Length = 230

 Score =  158 bits (400), Expect = 3e-37,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 50/122 (40%), Gaps = 6/122 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+ D    V ++ +      G+ VF A +  EA +       P+ +V+D  M    
Sbjct: 1   MSKILVADDDPNVIELLKIYLQKEGYEVFFAENGREAVDKA-NSTKPDLIVLDLMMPEID 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    +R       V +  L  + +    I G   GA+ ++ KPFN   +   ++ + 
Sbjct: 60  GLEVCRQIRMHSR---VPIIMLTAKDEDMDKILGLEMGADDYITKPFNPREVVARIKAVL 116

Query: 119 QM 120
           + 
Sbjct: 117 RR 118


>gi|161504418|ref|YP_001571530.1| transcriptional regulator PhoB [Salmonella enterica subsp. arizonae
           serovar 62:z4,z23:-- str. RSK2980]
 gi|160865765|gb|ABX22388.1| hypothetical protein SARI_02529 [Salmonella enterica subsp.
           arizonae serovar 62:z4,z23:--]
          Length = 229

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|237707608|ref|ZP_04538089.1| transcriptional regulator PhoB [Escherichia sp. 3_2_53FAA]
 gi|226898818|gb|EEH85077.1| transcriptional regulator PhoB [Escherichia sp. 3_2_53FAA]
 gi|315289887|gb|EFU49277.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 110-3]
 gi|323958591|gb|EGB54294.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H263]
          Length = 229

 Score =  158 bits (400), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|110801877|ref|YP_697936.1| DNA-binding response regulator [Clostridium perfringens SM101]
 gi|110682378|gb|ABG85748.1| DNA-binding response regulator [Clostridium perfringens SM101]
          Length = 231

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +R++ +      G+ +  A +  EA     +E+  + +++D  +     
Sbjct: 4   KKVLIVDDEEHIRELIKFNLKKEGYDIEVAVNGTEALNII-REIKFDLILLDLMLPEIDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+    +D+ V  +  + +    + G   GA+ ++ KPF+   L   ++ L +
Sbjct: 63  LEVCKEIRRNEETSDIPVMMITAKGEEFDKVLGLELGADDYITKPFSIRELMARVKALLR 122

Query: 120 MQKSKDENQFLD 131
               K E   + 
Sbjct: 123 RSNFKKEENIIK 134


>gi|242281151|ref|YP_002993280.1| transcriptional regulator [Desulfovibrio salexigens DSM 2638]
 gi|242124045|gb|ACS81741.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio salexigens DSM 2638]
          Length = 230

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 21/129 (16%), Positives = 55/129 (42%), Gaps = 3/129 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+  +   ++ ++     G+ V  A    +A +   KE  P+ +++D  + G+   
Sbjct: 5   KILVVEDHNDTIELLKYNLTSSGYEVVTAMDGHKALDQARKEN-PDLILLDLMLPGIDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + V  L  + +    + G   G + +++KPF+   L   ++ + + 
Sbjct: 64  EVCRRLKQEVATQHIPVIMLTAKGEEVDRVVGLELGVDDYIVKPFSPRELVLRVKAVLRR 123

Query: 121 QKSKDENQF 129
              + E + 
Sbjct: 124 STEQPEPRR 132


>gi|254410153|ref|ZP_05023933.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196183189|gb|EDX78173.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 237

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 32/124 (25%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R        + G+ V + +S  EA E C K   P+ +V D  M  + 
Sbjct: 1   MKKILVVDDDRTLRITLTRALENMGYQVQQVSSGAEALEACVKNP-PDLVVSDVMMPEMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
              F   +R  P G  +   +L  + + E  I G   GA+ +L+KP N   L   +    
Sbjct: 60  GIEFCRRLRATPSGQLMPFIFLSGKGELEDRIHGHSIGADDYLIKPVNPRELAAKIEAQL 119

Query: 119 QMQK 122
           +  +
Sbjct: 120 ERTR 123


>gi|302554749|ref|ZP_07307091.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces viridochromogenes DSM 40736]
 gi|302472367|gb|EFL35460.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces viridochromogenes DSM 40736]
          Length = 249

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 49/130 (37%), Gaps = 2/130 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V +V     +  G++V  A     A         P+ +V+D  + G+   
Sbjct: 16  RILVVDDDPTVAEVVAGYLDRAGYLVDRADDGPTALTRAAAHW-PDLVVLDLMLPGMDGL 74

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V  L    D +  I G   GA+ ++ KPF+   L   +  + +  +
Sbjct: 75  EVCRRMRGHGP-VPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRSR 133

Query: 123 SKDENQFLDA 132
                  L A
Sbjct: 134 PAAPGHRLGA 143


>gi|163846454|ref|YP_001634498.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222524229|ref|YP_002568700.1| winged helix family two component transcriptional regulator
           [Chloroflexus sp. Y-400-fl]
 gi|163667743|gb|ABY34109.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222448108|gb|ACM52374.1| two component transcriptional regulator, winged helix family
           [Chloroflexus sp. Y-400-fl]
          Length = 233

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+VD    + K+ R      GF V  A     A     +E  P  +V+D  + G+  
Sbjct: 3   RTILVVDDEPGIVKIARDYLERAGFQVISAGDGPTALRLARQEH-PALMVLDLMLPGMDG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +RQ PL   + +  L   V+    + G   GA+ ++ KPF+   L   +R + +
Sbjct: 62  LDVTRALRQDPLTARLPIIMLTARVEETDRLIGLELGADDYITKPFSPRELVARVRAVLR 121

Query: 120 MQK 122
             +
Sbjct: 122 RSE 124


>gi|296162067|ref|ZP_06844865.1| multi-sensor hybrid histidine kinase [Burkholderia sp. Ch1-1]
 gi|295887688|gb|EFG67508.1| multi-sensor hybrid histidine kinase [Burkholderia sp. Ch1-1]
          Length = 1648

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 51/128 (39%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            LL+VD +  +R+    +    G  V  AT    A E   +E  P+ ++ D  M      
Sbjct: 661 RLLVVDDNADLREYMSRILRAAGHDVRLATDGQAALEAARQE-RPDLVLSDVMMPRLDGF 719

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R  P   D  V  L      E  + G   GA+ +L KPF+   L   +    Q+
Sbjct: 720 GLLRALRADPELRDTPVLMLSARAGEEARVDGIEHGADDYLTKPFSARELLARVSGNLQL 779

Query: 121 QKSKDENQ 128
            + + E +
Sbjct: 780 ARLRRETE 787



 Score = 87.2 bits (216), Expect = 7e-16,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 47/127 (37%), Gaps = 7/127 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL-- 60
            ++L+V+    VR     + +D G+ V +A     A    E  +  + L  D  M G L  
Sbjct: 1378 TVLVVEDDEEVRTTVVEMLSDLGYRVLKAKDAQSALAIVESGVPIDVLFTDVVMPGPLRS 1437

Query: 61   -EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAG-ARAGANSFLLKPFNRETLRFAMRELP 118
             E     +       + V +     D   + +G    G    L KP+  E L   +R + 
Sbjct: 1438 TELAR--KARERLPAIAVLFTSGYTDNAIVHSGRLDEGI-ELLSKPYTHEALARKIRYVL 1494

Query: 119  QMQKSKD 125
            Q Q  + 
Sbjct: 1495 QTQNPQA 1501



 Score = 62.1 bits (151), Expect = 2e-08,   Method: Composition-based stats.
 Identities = 21/123 (17%), Positives = 42/123 (34%), Gaps = 13/123 (10%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
             +LLV+   ++R     L   F F + EA    +A +    E   + ++ D  + G    
Sbjct: 1533 RILLVEDDELIRASTAELLRMFDFDILEAEGEHDA-KQILSEHAISVMLTDVGLAGKSGV 1591

Query: 63   IAHVRQMPLGTDVFVYYLLMEV---DFEKMI---AGARAGANSFLLKPFNRETLRFAMRE 116
               +    +  D+ V +L          +               L KP++   L  A++ 
Sbjct: 1592 DLALEVCAVRPDLRVIFLTGYDLVLTPAQRKVLPHAI------LLRKPYDLLDLIDALKT 1645

Query: 117  LPQ 119
              +
Sbjct: 1646 PLR 1648


>gi|260596767|ref|YP_003209338.1| transcriptional regulator PhoB [Cronobacter turicensis z3032]
 gi|260215944|emb|CBA28550.1| Phosphate regulon transcriptional regulatory protein phoB
           [Cronobacter turicensis z3032]
          Length = 229

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 58/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHIKREALTREIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                  ++ ++
Sbjct: 122 RISPMAVDEVIE 133


>gi|168232366|ref|ZP_02657424.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
 gi|194471011|ref|ZP_03076995.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|204927311|ref|ZP_03218513.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|238911469|ref|ZP_04655306.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Tennessee str. CDC07-0191]
 gi|194457375|gb|EDX46214.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CVM29188]
 gi|204323976|gb|EDZ09171.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Javiana
           str. GA_MM04042433]
 gi|205333497|gb|EDZ20261.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Kentucky
           str. CDC 191]
          Length = 229

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREALTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|219849580|ref|YP_002464013.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219543839|gb|ACL25577.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 236

 Score =  157 bits (399), Expect = 4e-37,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 4/125 (3%)

Query: 1   MDS-LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M   +L+VD    + K+ R      GF V  A     A     +E  P+ +V+D  + G+
Sbjct: 1   MKRTILVVDDEPGIVKIARDYLERAGFHVISAGDGPSALRLARQEH-PSLIVLDLMLPGM 59

Query: 60  LEF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                   +RQ PL   V +  L   V+    + G   GA+ ++ KPF+   L   +R +
Sbjct: 60  DGLDVTRALRQDPLTAGVPIIMLTARVEETDRLIGLELGADDYITKPFSPRELVARVRAV 119

Query: 118 PQMQK 122
            +  +
Sbjct: 120 LRRIE 124


>gi|82775697|ref|YP_402044.1| transcriptional regulator PhoB [Shigella dysenteriae Sd197]
 gi|309786981|ref|ZP_07681593.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 1617]
 gi|1172482|sp|P45606|PHOB_SHIDY RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|152773|gb|AAA26535.1| phosphate regulatory protein phoB [Shigella dysenteriae]
 gi|81239845|gb|ABB60555.1| positive response regulator for pho regulon [Shigella dysenteriae
           Sd197]
 gi|308924559|gb|EFP70054.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 1617]
          Length = 229

 Score =  157 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|156935054|ref|YP_001438970.1| transcriptional regulator PhoB [Cronobacter sakazakii ATCC BAA-894]
 gi|156533308|gb|ABU78134.1| hypothetical protein ESA_02905 [Cronobacter sakazakii ATCC BAA-894]
          Length = 229

 Score =  157 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 58/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHIKREALTREIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                  ++ ++
Sbjct: 122 RISPMAVDEVIE 133


>gi|119774211|ref|YP_926951.1| response regulator receiver protein [Shewanella amazonensis SB2B]
 gi|119766711|gb|ABL99281.1| two component transcriptional regulator, winged helix family
           [Shewanella amazonensis SB2B]
          Length = 229

 Score =  157 bits (399), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A     +E  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVMEQHGFTTSVAEDFDSALGQL-QEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLKQDEFTRQIPVIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 AAPTRLEETID 133


>gi|332968094|gb|EGK07181.1| DNA-binding response regulator [Desmospora sp. 8437]
          Length = 237

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 51/126 (40%), Gaps = 1/126 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + K+ +      GF V  A+    A E   +   P+ +V+D  +  +  
Sbjct: 4   KKVLVVDDEPSIVKLVQFNLEKEGFSVEVASDGQTALEKVNEHP-PDLIVLDLMLPKMDG 62

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                +     + + +  L  + +    + G   GA+ ++ KPF+   L   ++ + +  
Sbjct: 63  LEVCKQIRKENSHLPILMLTAKNEEFDKVLGLELGADDYMTKPFSPRELVARVKAILRRM 122

Query: 122 KSKDEN 127
           ++  + 
Sbjct: 123 EALRDQ 128


>gi|209695880|ref|YP_002263810.1| response regulator homolog PhoB (phosphate regulon transcriptional
           regulatory protein) [Aliivibrio salmonicida LFI1238]
 gi|208009833|emb|CAQ80141.1| response regulator homolog PhoB (phosphate regulon transcriptional
           regulatory protein) [Aliivibrio salmonicida LFI1238]
          Length = 230

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 54/132 (40%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYEPIEAEDYDTALALLC-EPYPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++      + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDEFTKKIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVIR 121

Query: 120 MQKSKDENQFLD 131
                   + +D
Sbjct: 122 RVSPTSVEELID 133


>gi|218549942|ref|YP_002383733.1| transcriptional regulator PhoB [Escherichia fergusonii ATCC 35469]
 gi|218357483|emb|CAQ90122.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia fergusonii ATCC 35469]
 gi|324114618|gb|EGC08586.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia fergusonii B253]
 gi|325498318|gb|EGC96177.1| transcriptional regulator PhoB [Escherichia fergusonii ECD227]
          Length = 229

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREALTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|167624972|ref|YP_001675266.1| two component transcriptional regulator [Shewanella halifaxensis
           HAW-EB4]
 gi|167354994|gb|ABZ77607.1| two component transcriptional regulator, winged helix family
           [Shewanella halifaxensis HAW-EB4]
          Length = 229

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 47/120 (39%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A      E  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVLEQHGFTTAAAEDYDSALAML-TEPYPDLVLLDWMFPGGNGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + +  L    + E  + G   GA+ F+ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLRQDEFTRHIPIIMLTARGEEEDKVRGLEVGADDFMTKPFSPKELVARIKAVMRR 122


>gi|302535811|ref|ZP_07288153.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. C]
 gi|302444706|gb|EFL16522.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. C]
          Length = 244

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 30/119 (25%), Positives = 48/119 (40%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  R      G+ V  A    +A +       P+ +V+D  M  +  
Sbjct: 9   QRILVVDDEPAVREALRRSLAFEGYEVRTAVDGLDALDQAAA-YAPDLIVLDIQMPRMDG 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+   V  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 68  LTAARRLRASGSVTPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARVRALLRR 126


>gi|119483445|ref|ZP_01618859.1| adenylate cyclase [Lyngbya sp. PCC 8106]
 gi|119458212|gb|EAW39334.1| adenylate cyclase [Lyngbya sp. PCC 8106]
          Length = 1361

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 29/126 (23%), Positives = 59/126 (46%), Gaps = 2/126 (1%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
             +L+VD   I  +V  +      + V +A+S  EA E  E   +P+ +++D  M  +   
Sbjct: 891  KILIVDDDPINLQVLVNYLCLQNYAVTQASSGIEAMEILEAGYIPDLILLDVMMPRMTGY 950

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            E    +R+      + +  L  +     ++AG   GAN +L KP N++ L   ++   ++
Sbjct: 951  EVTRRIRETWPPHQLPIMMLTAKNQVSDLVAGLEVGANDYLSKPLNKDELLARIKTHIRI 1010

Query: 121  QKSKDE 126
            ++ + E
Sbjct: 1011 KQLRTE 1016


>gi|24373128|ref|NP_717171.1| phosphate regulon response regulator PhoB [Shewanella oneidensis
           MR-1]
 gi|24347327|gb|AAN54615.1|AE015602_1 phosphate regulon response regulator PhoB [Shewanella oneidensis
           MR-1]
          Length = 239

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A     KE  P+ +++D    G    
Sbjct: 14  RILIVEDELAIREMLTFVMEQHGFTTSAAEDFDSAIALL-KEPYPDLILLDWMFPGGSGI 72

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 73  QLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVLRR 132

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 133 SAPTRLEETID 143


>gi|283784214|ref|YP_003364079.1| phosphate regulon two-component system, response regulator
           [Citrobacter rodentium ICC168]
 gi|212380327|gb|ACJ24903.1| PhoB [Citrobacter rodentium]
 gi|282947668|emb|CBG87223.1| phosphate regulon two-component system, response regulator
           [Citrobacter rodentium ICC168]
          Length = 229

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAAIREMVCFVLEQNGFQPVEAEDYDTAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|146310528|ref|YP_001175602.1| transcriptional regulator PhoB [Enterobacter sp. 638]
 gi|145317404|gb|ABP59551.1| two component transcriptional regulator, winged helix family
           [Enterobacter sp. 638]
          Length = 229

 Score =  157 bits (398), Expect = 5e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPIEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHIKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|307152445|ref|YP_003887829.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
 gi|306982673|gb|ADN14554.1| PAS/PAC sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
          Length = 1566

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 30/131 (22%), Positives = 57/131 (43%), Gaps = 4/131 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +LL D +  +R   + L  D  + V   +      E   +E LP+ ++ D  M G+  F
Sbjct: 397 RILLADDNADMRDYIKRLLTDL-YEVETVSDGIAVLEALARE-LPDLVLTDVMMPGLDGF 454

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R  P    + +  L         + G +AGA+ +L+KPF+   L   +    +M
Sbjct: 455 ELLRELRANPNTRQIPIILLSARAGEPSRVEGLKAGADDYLIKPFSARELLARVETHLKM 514

Query: 121 QKSKDENQFLD 131
            + ++EN   +
Sbjct: 515 AQIREENAHRE 525



 Score =  100 bits (251), Expect = 6e-20,   Method: Composition-based stats.
 Identities = 24/113 (21%), Positives = 36/113 (31%), Gaps = 6/113 (5%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
            +L+VD     R     L  + G  V    S  EA +       P+ L+ D  M  +    
Sbjct: 1447 ILVVDDDADTRDFLGFLLREAGAKVVTLASATEALQVL-AGSKPDVLLCDIGMPEIDGYM 1505

Query: 62   FIAHVRQMPLGT-DVFV--YYLLMEVDFEKMIAGARAGANSFLLKPFNRETLR 111
             I  VR     + +  +    L             +AG    + KP   E L 
Sbjct: 1506 LIKQVRIWENQSGEKPILAIALTAYAGDLNHEKALKAGFQHHISKPIKPEELL 1558


>gi|72383373|ref|YP_292728.1| two component LuxR family transcriptional regulator
           [Prochlorococcus marinus str. NATL2A]
 gi|72003223|gb|AAZ59025.1| two component transcriptional regulator, LuxR family
           [Prochlorococcus marinus str. NATL2A]
          Length = 242

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LLVD    +R   +    D GF V  A    E  E  +K ++P+ ++ D  M      
Sbjct: 16  RILLVDDEPGLRTAVQAYLEDEGFQVTTAVDGEEGWEKAQK-MIPDVIISDVMMPRCDGY 74

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+        V +L  +        G +AG + ++ KPF+ + L   ++ + Q 
Sbjct: 75  GLLKKIREDERLGGTPVIFLTAKGMTADRTQGYQAGVDDYMPKPFDPDELVARVKNVVQR 134

Query: 121 QK 122
           Q+
Sbjct: 135 QE 136


>gi|24111777|ref|NP_706287.1| transcriptional regulator PhoB [Shigella flexneri 2a str. 301]
 gi|30061895|ref|NP_836066.1| transcriptional regulator PhoB [Shigella flexneri 2a str. 2457T]
 gi|110804422|ref|YP_687942.1| transcriptional regulator PhoB [Shigella flexneri 5 str. 8401]
 gi|27735236|sp|P45607|PHOB_SHIFL RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|24050564|gb|AAN41994.1| positive response regulator for pho regulon [Shigella flexneri 2a
           str. 301]
 gi|30040139|gb|AAP15872.1| positive response regulator for pho regulon [Shigella flexneri 2a
           str. 2457T]
 gi|110613970|gb|ABF02637.1| positive response regulator for pho regulon [Shigella flexneri 5
           str. 8401]
 gi|281599731|gb|ADA72715.1| Phosphate regulon transcriptional regulatory protein phoB [Shigella
           flexneri 2002017]
 gi|313646986|gb|EFS11443.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri 2a str. 2457T]
 gi|332761723|gb|EGJ92002.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri 2747-71]
 gi|332764273|gb|EGJ94509.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri K-671]
 gi|332768503|gb|EGJ98686.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri 2930-71]
 gi|333022012|gb|EGK41257.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri K-304]
          Length = 229

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|124024957|ref|YP_001014073.1| two-component response regulator [Prochlorococcus marinus str.
           NATL1A]
 gi|123960025|gb|ABM74808.1| two-component response regulator [Prochlorococcus marinus str.
           NATL1A]
          Length = 242

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LLVD    +R   +    D GF V  A    E  E  +K ++P+ ++ D  M      
Sbjct: 16  RILLVDDEPGLRTAVQAYLEDEGFQVTTAVDGEEGWEKAQK-MIPDVIISDVMMPRCDGY 74

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+        V +L  +        G +AG + ++ KPF+ + L   ++ + Q 
Sbjct: 75  GLLKKIREDERLGGTPVIFLTAKGMTADRTQGYQAGVDDYMPKPFDPDELVARVKNVVQR 134

Query: 121 QK 122
           Q+
Sbjct: 135 QE 136


>gi|16759374|ref|NP_454991.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. CT18]
 gi|16763777|ref|NP_459392.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. LT2]
 gi|29142855|ref|NP_806197.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. Ty2]
 gi|62179008|ref|YP_215425.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. SC-B67]
 gi|161615421|ref|YP_001589386.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Paratyphi B str. SPB7]
 gi|167551797|ref|ZP_02345550.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|167992242|ref|ZP_02573340.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|168237507|ref|ZP_02662565.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|168240215|ref|ZP_02665147.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|168261175|ref|ZP_02683148.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|168465482|ref|ZP_02699364.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|168818997|ref|ZP_02830997.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|194450960|ref|YP_002044430.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Heidelberg str. SL476]
 gi|194736716|ref|YP_002113428.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Schwarzengrund str. CVM19633]
 gi|197264166|ref|ZP_03164240.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|198244456|ref|YP_002214351.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Dublin str. CT_02021853]
 gi|200390991|ref|ZP_03217602.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|207855879|ref|YP_002242530.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Enteritidis str. P125109]
 gi|213051513|ref|ZP_03344391.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E00-7866]
 gi|213417376|ref|ZP_03350518.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E01-6750]
 gi|213582091|ref|ZP_03363917.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-0664]
 gi|213620466|ref|ZP_03373292.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-2068]
 gi|213647670|ref|ZP_03377723.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. J185]
 gi|213855581|ref|ZP_03383821.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. M223]
 gi|224582234|ref|YP_002636032.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Paratyphi C strain RKS4594]
 gi|289828482|ref|ZP_06546340.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhi str. E98-3139]
 gi|25300971|pir||AD0551 phosphate regulon transcription regulatory protein PhoB STY0432
           [imported] - Salmonella enterica subsp. enterica serovar
           Typhi (strain CT18)
 gi|16418901|gb|AAL19351.1| response regulator in two-component regulatory system with PhoR (or
           CreC) [Salmonella enterica subsp. enterica serovar
           Typhimurium str. LT2]
 gi|16501665|emb|CAD08852.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Typhi]
 gi|29138487|gb|AAO70057.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Typhi str.
           Ty2]
 gi|62126641|gb|AAX64344.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulates pho regulon (OmpR family) [Salmonella
           enterica subsp. enterica serovar Choleraesuis str.
           SC-B67]
 gi|161364785|gb|ABX68553.1| hypothetical protein SPAB_03192 [Salmonella enterica subsp.
           enterica serovar Paratyphi B str. SPB7]
 gi|194409264|gb|ACF69483.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL476]
 gi|194712218|gb|ACF91439.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. CVM19633]
 gi|195631850|gb|EDX50370.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL317]
 gi|197242421|gb|EDY25041.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA23]
 gi|197289486|gb|EDY28849.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           Schwarzengrund str. SL480]
 gi|197938972|gb|ACH76305.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Dublin str.
           CT_02021853]
 gi|199603436|gb|EDZ01982.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Virchow
           str. SL491]
 gi|205323482|gb|EDZ11321.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Saintpaul
           str. SARA29]
 gi|205329543|gb|EDZ16307.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar
           4,[5],12:i:- str. CVM23701]
 gi|205340400|gb|EDZ27164.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Heidelberg
           str. SL486]
 gi|205344060|gb|EDZ30824.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. HI_N05-537]
 gi|205349830|gb|EDZ36461.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Hadar str.
           RI_05P066]
 gi|206707682|emb|CAR31966.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Enteritidis
           str. P125109]
 gi|224466761|gb|ACN44591.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Paratyphi C
           strain RKS4594]
 gi|261245680|emb|CBG23476.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. D23580]
 gi|267992105|gb|ACY86990.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 14028S]
 gi|301157009|emb|CBW16492.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. SL1344]
 gi|312911430|dbj|BAJ35404.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. T000240]
 gi|320084671|emb|CBY94462.1| Phosphate regulon transcriptional regulatory protein phoB
           [Salmonella enterica subsp. enterica serovar Weltevreden
           str. 2007-60-3289-1]
 gi|321225121|gb|EFX50182.1| Phosphate regulon transcriptional regulatory protein PhoB SphR
           [Salmonella enterica subsp. enterica serovar Typhimurium
           str. TN061786]
 gi|322614680|gb|EFY11609.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315996572]
 gi|322618786|gb|EFY15674.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-1]
 gi|322623493|gb|EFY20332.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-3]
 gi|322629209|gb|EFY25988.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 495297-4]
 gi|322631929|gb|EFY28683.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-1]
 gi|322637333|gb|EFY34035.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 515920-2]
 gi|322642019|gb|EFY38629.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 531954]
 gi|322646219|gb|EFY42733.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. NC_MB110209-0054]
 gi|322652515|gb|EFY48869.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. OH_2009072675]
 gi|322653322|gb|EFY49655.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. CASC_09SCPH15965]
 gi|322660529|gb|EFY56765.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 19N]
 gi|322664681|gb|EFY60874.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 81038-01]
 gi|322669266|gb|EFY65416.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MD_MDA09249507]
 gi|322670812|gb|EFY66945.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 414877]
 gi|322678950|gb|EFY75005.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 366867]
 gi|322681978|gb|EFY78003.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 413180]
 gi|322685193|gb|EFY81190.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 446600]
 gi|322713467|gb|EFZ05038.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Choleraesuis str. A50]
 gi|323128714|gb|ADX16144.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. 4/74]
 gi|323194459|gb|EFZ79654.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609458-1]
 gi|323197005|gb|EFZ82147.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556150-1]
 gi|323203989|gb|EFZ89006.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 609460]
 gi|323206925|gb|EFZ91878.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 507440-20]
 gi|323211059|gb|EFZ95915.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 556152]
 gi|323214547|gb|EFZ99298.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB101509-0077]
 gi|323223104|gb|EGA07447.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB102109-0047]
 gi|323227053|gb|EGA11234.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB110209-0055]
 gi|323230129|gb|EGA14249.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. MB111609-0052]
 gi|323233867|gb|EGA17956.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009083312]
 gi|323238439|gb|EGA22497.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 2009085258]
 gi|323244127|gb|EGA28136.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. 315731156]
 gi|323246287|gb|EGA30270.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2009159199]
 gi|323251913|gb|EGA35776.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008282]
 gi|323257910|gb|EGA41589.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008283]
 gi|323261077|gb|EGA44669.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008284]
 gi|323264993|gb|EGA48492.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008285]
 gi|323272556|gb|EGA55963.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Montevideo str. IA_2010008287]
 gi|326622099|gb|EGE28444.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Dublin str. 3246]
 gi|332987345|gb|AEF06328.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Typhimurium str. UK-1]
          Length = 229

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|15800125|ref|NP_286137.1| transcriptional regulator PhoB [Escherichia coli O157:H7 EDL933]
 gi|15829703|ref|NP_308476.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           Sakai]
 gi|16128384|ref|NP_414933.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           MG1655]
 gi|82542888|ref|YP_406835.1| transcriptional regulator PhoB [Shigella boydii Sb227]
 gi|89107269|ref|AP_001049.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           W3110]
 gi|91209466|ref|YP_539452.1| transcriptional regulator PhoB [Escherichia coli UTI89]
 gi|117622660|ref|YP_851573.1| transcriptional regulator PhoB [Escherichia coli APEC O1]
 gi|157154834|ref|YP_001461578.1| transcriptional regulator PhoB [Escherichia coli E24377A]
 gi|157159917|ref|YP_001457235.1| transcriptional regulator PhoB [Escherichia coli HS]
 gi|168749852|ref|ZP_02774874.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4113]
 gi|168756932|ref|ZP_02781939.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4401]
 gi|168761596|ref|ZP_02786603.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4501]
 gi|168768341|ref|ZP_02793348.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4486]
 gi|168776304|ref|ZP_02801311.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4196]
 gi|168783256|ref|ZP_02808263.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4076]
 gi|168786237|ref|ZP_02811244.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC869]
 gi|168800273|ref|ZP_02825280.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC508]
 gi|170021229|ref|YP_001726183.1| transcriptional regulator PhoB [Escherichia coli ATCC 8739]
 gi|170079985|ref|YP_001729305.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170684203|ref|YP_001742532.1| transcriptional regulator PhoB [Escherichia coli SMS-3-5]
 gi|170768000|ref|ZP_02902453.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia albertii TW07627]
 gi|187733926|ref|YP_001879107.1| transcriptional regulator PhoB [Shigella boydii CDC 3083-94]
 gi|188493884|ref|ZP_03001154.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 53638]
 gi|191166743|ref|ZP_03028570.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B7A]
 gi|191173531|ref|ZP_03035058.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli F11]
 gi|193065166|ref|ZP_03046239.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E22]
 gi|193068711|ref|ZP_03049672.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E110019]
 gi|194428827|ref|ZP_03061362.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B171]
 gi|194432677|ref|ZP_03064963.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 1012]
 gi|194438843|ref|ZP_03070928.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 101-1]
 gi|195938540|ref|ZP_03083922.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           EC4024]
 gi|208807385|ref|ZP_03249722.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4206]
 gi|208815127|ref|ZP_03256306.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4045]
 gi|208823163|ref|ZP_03263481.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4042]
 gi|209398675|ref|YP_002269037.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4115]
 gi|209917610|ref|YP_002291694.1| transcriptional regulator PhoB [Escherichia coli SE11]
 gi|215485480|ref|YP_002327911.1| transcriptional regulator PhoB [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217326124|ref|ZP_03442208.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. TW14588]
 gi|218552961|ref|YP_002385874.1| transcriptional regulator PhoB [Escherichia coli IAI1]
 gi|218557308|ref|YP_002390221.1| transcriptional regulator PhoB [Escherichia coli S88]
 gi|218688261|ref|YP_002396473.1| transcriptional regulator PhoB [Escherichia coli ED1a]
 gi|218693859|ref|YP_002401526.1| transcriptional regulator PhoB [Escherichia coli 55989]
 gi|218698697|ref|YP_002406326.1| transcriptional regulator PhoB [Escherichia coli IAI39]
 gi|218703680|ref|YP_002411199.1| transcriptional regulator PhoB [Escherichia coli UMN026]
 gi|227884595|ref|ZP_04002400.1| transcriptional regulator PhoB [Escherichia coli 83972]
 gi|238899687|ref|YP_002925483.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli BW2952]
 gi|253774616|ref|YP_003037447.1| transcriptional regulator PhoB [Escherichia coli
           'BL21-Gold(DE3)pLysS AG']
 gi|254160466|ref|YP_003043574.1| transcriptional regulator PhoB [Escherichia coli B str. REL606]
 gi|254791577|ref|YP_003076414.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           TW14359]
 gi|256020366|ref|ZP_05434231.1| transcriptional regulator PhoB [Shigella sp. D9]
 gi|256023984|ref|ZP_05437849.1| transcriptional regulator PhoB [Escherichia sp. 4_1_40B]
 gi|260842597|ref|YP_003220375.1| DNA-binding response regulator PhoB [Escherichia coli O103:H2 str.
           12009]
 gi|260853619|ref|YP_003227510.1| DNA-binding response regulator PhoB [Escherichia coli O26:H11 str.
           11368]
 gi|260866558|ref|YP_003232960.1| DNA-binding response regulator PhoB [Escherichia coli O111:H- str.
           11128]
 gi|261223875|ref|ZP_05938156.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli O157:H7 str.
           FRIK2000]
 gi|261256411|ref|ZP_05948944.1| DNA-binding response regulator PhoB [Escherichia coli O157:H7 str.
           FRIK966]
 gi|291281302|ref|YP_003498120.1| Positive response regulator for pho regulon [Escherichia coli
           O55:H7 str. CB9615]
 gi|293403516|ref|ZP_06647607.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli FVEC1412]
 gi|293408543|ref|ZP_06652382.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B354]
 gi|293413651|ref|ZP_06656300.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B185]
 gi|293418465|ref|ZP_06660900.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B088]
 gi|298379128|ref|ZP_06989009.1| transcriptional regulator PhoB [Escherichia coli FVEC1302]
 gi|300820364|ref|ZP_07100516.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 119-7]
 gi|300900462|ref|ZP_07118630.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 198-1]
 gi|300903338|ref|ZP_07121266.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 84-1]
 gi|300918223|ref|ZP_07134829.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 115-1]
 gi|300924116|ref|ZP_07140109.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 182-1]
 gi|300930309|ref|ZP_07145721.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 187-1]
 gi|300936383|ref|ZP_07151311.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 21-1]
 gi|300947953|ref|ZP_07162099.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 116-1]
 gi|300957961|ref|ZP_07170127.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 175-1]
 gi|300988101|ref|ZP_07178538.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 45-1]
 gi|300997414|ref|ZP_07181754.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 200-1]
 gi|301025440|ref|ZP_07188990.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 69-1]
 gi|301025776|ref|ZP_07189288.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 196-1]
 gi|301049597|ref|ZP_07196549.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 185-1]
 gi|301301545|ref|ZP_07207680.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 124-1]
 gi|301330743|ref|ZP_07223344.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 78-1]
 gi|301647317|ref|ZP_07247131.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 146-1]
 gi|306813135|ref|ZP_07447328.1| transcriptional regulator PhoB [Escherichia coli NC101]
 gi|307137041|ref|ZP_07496397.1| transcriptional regulator PhoB [Escherichia coli H736]
 gi|307312226|ref|ZP_07591862.1| two component transcriptional regulator, winged helix family
           [Escherichia coli W]
 gi|309794878|ref|ZP_07689299.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 145-7]
 gi|312964580|ref|ZP_07778836.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 2362-75]
 gi|312970492|ref|ZP_07784673.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 1827-70]
 gi|331640913|ref|ZP_08342048.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H736]
 gi|331645570|ref|ZP_08346674.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M605]
 gi|331651327|ref|ZP_08352352.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M718]
 gi|331661771|ref|ZP_08362694.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA143]
 gi|331666746|ref|ZP_08367620.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA271]
 gi|331671945|ref|ZP_08372741.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA280]
 gi|331676064|ref|ZP_08376776.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H591]
 gi|331681792|ref|ZP_08382425.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H299]
 gi|332281544|ref|ZP_08393957.1| transcriptional regulator PhoB [Shigella sp. D9]
 gi|84029275|sp|P0AFJ6|PHOB_ECO57 RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|84029276|sp|P0AFJ5|PHOB_ECOLI RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|12513245|gb|AAG54745.1|AE005219_1 positive response regulator for pho regulon, sensor is PhoR (or
           CreC) [Escherichia coli O157:H7 str. EDL933]
 gi|42388|emb|CAA27659.1| unnamed protein product [Escherichia coli]
 gi|1657595|gb|AAB18123.1| phosphate regulon transcriptional regulatory protein phoB
           [Escherichia coli str. K-12 substr. MG1655]
 gi|1786599|gb|AAC73502.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           MG1655]
 gi|13359906|dbj|BAB33872.1| positive response regulator for pho regulon PhoB [Escherichia coli
           O157:H7 str. Sakai]
 gi|16209152|gb|AAL09901.1| PhoB [CRIM plasmid pAH150]
 gi|81244299|gb|ABB65007.1| positive response regulator for pho regulon [Shigella boydii Sb227]
 gi|85674539|dbj|BAE76179.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K12 substr.
           W3110]
 gi|91071040|gb|ABE05921.1| positive response regulator for pho regulon [Escherichia coli
           UTI89]
 gi|115511784|gb|ABI99858.1| positive response regulator for pho regulon [Escherichia coli APEC
           O1]
 gi|157065597|gb|ABV04852.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli HS]
 gi|157076864|gb|ABV16572.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E24377A]
 gi|169756157|gb|ACA78856.1| two component transcriptional regulator, winged helix family
           [Escherichia coli ATCC 8739]
 gi|169887820|gb|ACB01527.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli str. K-12 substr.
           DH10B]
 gi|170123488|gb|EDS92419.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia albertii TW07627]
 gi|170521921|gb|ACB20099.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli SMS-3-5]
 gi|187430918|gb|ACD10192.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           boydii CDC 3083-94]
 gi|187768306|gb|EDU32150.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4196]
 gi|188015917|gb|EDU54039.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4113]
 gi|188489083|gb|EDU64186.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 53638]
 gi|188999370|gb|EDU68356.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4076]
 gi|189356009|gb|EDU74428.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4401]
 gi|189362392|gb|EDU80811.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4486]
 gi|189368045|gb|EDU86461.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4501]
 gi|189373726|gb|EDU92142.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC869]
 gi|189377396|gb|EDU95812.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC508]
 gi|190903254|gb|EDV62976.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B7A]
 gi|190906240|gb|EDV65852.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli F11]
 gi|192927140|gb|EDV81761.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E22]
 gi|192958074|gb|EDV88516.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E110019]
 gi|194413130|gb|EDX29417.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B171]
 gi|194419238|gb|EDX35321.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 1012]
 gi|194422137|gb|EDX38139.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 101-1]
 gi|208727186|gb|EDZ76787.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4206]
 gi|208731775|gb|EDZ80463.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4045]
 gi|208737356|gb|EDZ85040.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4042]
 gi|209160075|gb|ACI37508.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. EC4115]
 gi|209744234|gb|ACI70424.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209744236|gb|ACI70425.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209744238|gb|ACI70426.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209744240|gb|ACI70427.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209744242|gb|ACI70428.1| positive response regulator for pho regulon PhoB [Escherichia coli]
 gi|209910869|dbj|BAG75943.1| two-component response regulator [Escherichia coli SE11]
 gi|213521171|gb|ACJ50526.1| PhoB [Escherichia coli]
 gi|215263552|emb|CAS07882.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli O127:H6 str.
           E2348/69]
 gi|217322345|gb|EEC30769.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli O157:H7 str. TW14588]
 gi|218350591|emb|CAU96281.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli 55989]
 gi|218359729|emb|CAQ97270.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli IAI1]
 gi|218364077|emb|CAR01742.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli S88]
 gi|218368683|emb|CAR16423.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli IAI39]
 gi|218425825|emb|CAR06631.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli ED1a]
 gi|218430777|emb|CAR11651.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli UMN026]
 gi|222032194|emb|CAP74933.1| Phosphate regulon transcriptional regulatory protein [Escherichia
           coli LF82]
 gi|227838681|gb|EEJ49147.1| transcriptional regulator PhoB [Escherichia coli 83972]
 gi|238860869|gb|ACR62867.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli BW2952]
 gi|242376177|emb|CAQ30868.1| PhoB transcriptional dual regulator [Escherichia coli BL21(DE3)]
 gi|253325660|gb|ACT30262.1| two component transcriptional regulator PhoB, winged helix family
           [Escherichia coli 'BL21-Gold(DE3)pLysS AG']
 gi|253972367|gb|ACT38038.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli B str. REL606]
 gi|253976576|gb|ACT42246.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli BL21(DE3)]
 gi|254590977|gb|ACT70338.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli O157:H7 str.
           TW14359]
 gi|257752268|dbj|BAI23770.1| DNA-binding response regulator PhoB [Escherichia coli O26:H11 str.
           11368]
 gi|257757744|dbj|BAI29241.1| DNA-binding response regulator PhoB [Escherichia coli O103:H2 str.
           12009]
 gi|257762914|dbj|BAI34409.1| DNA-binding response regulator PhoB [Escherichia coli O111:H- str.
           11128]
 gi|260450414|gb|ACX40836.1| two component transcriptional regulator PhoB, winged helix family
           [Escherichia coli DH1]
 gi|281177569|dbj|BAI53899.1| two-component response regulator [Escherichia coli SE15]
 gi|284920205|emb|CBG33264.1| phosphate regulon two-component system, response regulator
           [Escherichia coli 042]
 gi|290761175|gb|ADD55136.1| Positive response regulator for pho regulon [Escherichia coli
           O55:H7 str. CB9615]
 gi|291324993|gb|EFE64408.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B088]
 gi|291429369|gb|EFF02389.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli FVEC1412]
 gi|291433709|gb|EFF06682.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B185]
 gi|291471721|gb|EFF14204.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli B354]
 gi|294490411|gb|ADE89167.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli IHE3034]
 gi|298280241|gb|EFI21745.1| transcriptional regulator PhoB [Escherichia coli FVEC1302]
 gi|299879979|gb|EFI88190.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 196-1]
 gi|300298642|gb|EFJ55027.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 185-1]
 gi|300304233|gb|EFJ58753.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 200-1]
 gi|300315335|gb|EFJ65119.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 175-1]
 gi|300356031|gb|EFJ71901.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 198-1]
 gi|300396025|gb|EFJ79563.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 69-1]
 gi|300404633|gb|EFJ88171.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 84-1]
 gi|300407515|gb|EFJ91053.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 45-1]
 gi|300414608|gb|EFJ97918.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 115-1]
 gi|300419669|gb|EFK02980.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 182-1]
 gi|300452489|gb|EFK16109.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 116-1]
 gi|300458489|gb|EFK21982.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 21-1]
 gi|300461769|gb|EFK25262.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 187-1]
 gi|300527149|gb|EFK48218.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 119-7]
 gi|300843042|gb|EFK70802.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 124-1]
 gi|300843315|gb|EFK71075.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 78-1]
 gi|301074542|gb|EFK89348.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 146-1]
 gi|305853898|gb|EFM54337.1| transcriptional regulator PhoB [Escherichia coli NC101]
 gi|306907728|gb|EFN38230.1| two component transcriptional regulator, winged helix family
           [Escherichia coli W]
 gi|307552303|gb|ADN45078.1| positive response regulator for pho regulon [Escherichia coli ABU
           83972]
 gi|307628132|gb|ADN72436.1| transcriptional regulator PhoB [Escherichia coli UM146]
 gi|308121531|gb|EFO58793.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 145-7]
 gi|309700660|emb|CBI99956.1| phosphate regulon two-component system, response regulator
           [Escherichia coli ETEC H10407]
 gi|310337141|gb|EFQ02279.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 1827-70]
 gi|312290814|gb|EFR18691.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 2362-75]
 gi|312944976|gb|ADR25803.1| transcriptional regulator PhoB [Escherichia coli O83:H1 str. NRG
           857C]
 gi|315059676|gb|ADT74003.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Escherichia coli W]
 gi|315135081|dbj|BAJ42240.1| positive response regulator for pho regulon [Escherichia coli DH1]
 gi|315256222|gb|EFU36190.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 85-1]
 gi|315294171|gb|EFU53522.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 153-1]
 gi|315616662|gb|EFU97279.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 3431]
 gi|320173784|gb|EFW48967.1| transcriptional regulator PhoB [Shigella dysenteriae CDC 74-1112]
 gi|320186028|gb|EFW60773.1| transcriptional regulator PhoB [Shigella flexneri CDC 796-83]
 gi|320192810|gb|EFW67450.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           EC1212]
 gi|320197165|gb|EFW71782.1| transcriptional regulator PhoB [Escherichia coli WV_060327]
 gi|320201640|gb|EFW76216.1| transcriptional regulator PhoB [Escherichia coli EC4100B]
 gi|320638387|gb|EFX08101.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           G5101]
 gi|320643767|gb|EFX12890.1| transcriptional regulator PhoB [Escherichia coli O157:H- str.
           493-89]
 gi|320649118|gb|EFX17696.1| transcriptional regulator PhoB [Escherichia coli O157:H- str. H
           2687]
 gi|320656011|gb|EFX23927.1| transcriptional regulator PhoB [Escherichia coli O55:H7 str.
           3256-97 TW 07815]
 gi|320662568|gb|EFX29957.1| transcriptional regulator PhoB [Escherichia coli O55:H7 str. USDA
           5905]
 gi|320665138|gb|EFX32231.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str.
           LSU-61]
 gi|323152134|gb|EFZ38427.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli EPECa14]
 gi|323160495|gb|EFZ46443.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E128010]
 gi|323164189|gb|EFZ49996.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           sonnei 53G]
 gi|323170479|gb|EFZ56129.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli LT-68]
 gi|323178339|gb|EFZ63917.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli 1180]
 gi|323191316|gb|EFZ76579.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli RN587/1]
 gi|323379758|gb|ADX52026.1| two component transcriptional regulator PhoB, winged helix family
           [Escherichia coli KO11]
 gi|323938583|gb|EGB34832.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E1520]
 gi|323943204|gb|EGB39360.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E482]
 gi|323945298|gb|EGB41354.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H120]
 gi|323952990|gb|EGB48858.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H252]
 gi|323963384|gb|EGB58946.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H489]
 gi|323965348|gb|EGB60806.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M863]
 gi|323972248|gb|EGB67458.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA007]
 gi|323976121|gb|EGB71214.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TW10509]
 gi|324010107|gb|EGB79326.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 57-2]
 gi|324010710|gb|EGB79929.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 60-1]
 gi|324016661|gb|EGB85880.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 117-3]
 gi|324116882|gb|EGC10795.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli E1167]
 gi|326341157|gb|EGD64949.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str. 1044]
 gi|326346067|gb|EGD69806.1| transcriptional regulator PhoB [Escherichia coli O157:H7 str. 1125]
 gi|327254715|gb|EGE66331.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli STEC_7v]
 gi|330910192|gb|EGH38702.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Escherichia coli AA86]
 gi|331037711|gb|EGI09931.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H736]
 gi|331045732|gb|EGI17858.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M605]
 gi|331051068|gb|EGI23120.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli M718]
 gi|331060193|gb|EGI32157.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA143]
 gi|331065970|gb|EGI37854.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA271]
 gi|331070934|gb|EGI42293.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA280]
 gi|331076122|gb|EGI47404.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H591]
 gi|331080994|gb|EGI52159.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli H299]
 gi|332085836|gb|EGI91000.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           dysenteriae 155-74]
 gi|332094547|gb|EGI99593.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           boydii 5216-82]
 gi|332098617|gb|EGJ03583.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           boydii 3594-74]
 gi|332103896|gb|EGJ07242.1| transcriptional regulator PhoB [Shigella sp. D9]
 gi|332341761|gb|AEE55095.1| transcriptional regulator protein PhoB [Escherichia coli UMNK88]
          Length = 229

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|149909265|ref|ZP_01897921.1| Response regulator [Moritella sp. PE36]
 gi|149807582|gb|EDM67530.1| Response regulator [Moritella sp. PE36]
          Length = 228

 Score =  157 bits (398), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++        GF V EA    EA +    E  PN +++D  + G   
Sbjct: 3   KRILVVEDELAIREMLCFALEQKGFDVVEAGDYNEAVDRLV-EPYPNLILLDWMLPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H++  P  + + V  L    + E  + G   GA+ ++ KPF+ + L   +  + +
Sbjct: 62  IKYIKHLKSQPHLSAIPVVMLTARGEEEDKVKGLEVGADDYITKPFSPKELIARLNAVMR 121

Query: 120 MQKSKDENQFLD 131
                 ++  +D
Sbjct: 122 RVAPMTQDTVID 133


>gi|318604580|emb|CBY26078.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Yersinia enterocolitica subsp. palearctica Y11]
          Length = 279

 Score =  156 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 53  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPYPDLVLLDWMLPGGSG 111

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 112 IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 171

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 172 RISPMAVEEVIE 183


>gi|83310469|ref|YP_420733.1| response regulator [Magnetospirillum magneticum AMB-1]
 gi|82945310|dbj|BAE50174.1| Response regulator [Magnetospirillum magneticum AMB-1]
          Length = 240

 Score =  156 bits (397), Expect = 6e-37,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 53/125 (42%), Gaps = 3/125 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+V+    +  + R+     G+ V EA    EA      E  P+ +++D  +     +E
Sbjct: 14  VLVVEDEAALATMLRYNLEKEGYRVAEAADGEEALTVL-AERKPDLVLLDWMLPSLSGIE 72

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+ P   ++ +  L    +    I G   GA+ +L KPF+   L   +R L +  
Sbjct: 73  ICRQIRRKPATRELPIIMLTARGEEGDKIRGLNTGADDYLTKPFSLPELMARVRALLRRA 132

Query: 122 KSKDE 126
           +   +
Sbjct: 133 QPVSQ 137


>gi|168182605|ref|ZP_02617269.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum Bf]
 gi|170761342|ref|YP_001787844.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A3 str. Loch Maree]
 gi|237795967|ref|YP_002863519.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum Ba4 str. 657]
 gi|169408331|gb|ACA56742.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A3 str. Loch Maree]
 gi|182674265|gb|EDT86226.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum Bf]
 gi|229260789|gb|ACQ51822.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum Ba4 str. 657]
          Length = 232

 Score =  156 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+ +L+VD    + ++ +    + G+    A +  EA     KE  P+ +++D  + G+ 
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYNCICALNGIEALNIA-KEEKPDLILLDLMLPGMD 61

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+        +  +  + +    + G   GA+ ++ KPF+   +   ++ + 
Sbjct: 62  GYEVCKEIRKDNNTATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVL 121

Query: 119 QMQ 121
           + +
Sbjct: 122 RRR 124


>gi|22299907|ref|NP_683154.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22296092|dbj|BAC09916.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 251

 Score =  156 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA     +E  P+ +V+D  M      
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYTVVTAADGEEALTKFRQE-QPDLVVLDVMMPKLDGY 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 70  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126

Query: 121 QK 122
            +
Sbjct: 127 IE 128


>gi|295096819|emb|CBK85909.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacter cloacae subsp. cloacae NCTC 9394]
          Length = 229

 Score =  156 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHIKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|229065726|ref|ZP_04200950.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus AH603]
 gi|228715544|gb|EEL67345.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus AH603]
          Length = 237

 Score =  156 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 53/121 (43%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+V+    +R+V +      G+ V+ A +  E  +    +  P+ +++D  M     
Sbjct: 3   KRILIVEDEENIREVCKRYLEREGYEVYTAMNGMEGWDVF-HQYQPDLIILDLMMPKKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +RQ    ++V +  L  + +    I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 62  WELCEEIRQQ---SNVPIIMLTAKGEERDRILGLTMGADDYVTKPFSPRELVLRVQIILR 118

Query: 120 M 120
            
Sbjct: 119 R 119


>gi|333010839|gb|EGK30265.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri K-272]
 gi|333021338|gb|EGK40591.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri K-227]
          Length = 229

 Score =  156 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|28210824|ref|NP_781768.1| transcriptional regulatory protein [Clostridium tetani E88]
 gi|28203262|gb|AAO35705.1| transcriptional regulatory protein [Clostridium tetani E88]
          Length = 232

 Score =  156 bits (397), Expect = 7e-37,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 55/128 (42%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    +R++ R+     G+ +F A +  EA E   KE  P  +++D  +  +   
Sbjct: 5   KILIVDDEEHIRELLRYNLEKEGYKIFCAENGKEALEIA-KEKKPTLILLDVMLPQMDGY 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +   +  +  + +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 64  DVCKEIRKDNSISTTPIIMITAKGEELDKVLGLELGADDYITKPFSIRELIARIKAVLRR 123

Query: 121 QKSKDENQ 128
              K   +
Sbjct: 124 TLLKSTEE 131


>gi|300721765|ref|YP_003711043.1| response regulator in two-component regulatory system with PhoR
           [Xenorhabdus nematophila ATCC 19061]
 gi|297628260|emb|CBJ88819.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulation of Pi uptake (OmpR family)
           [Xenorhabdus nematophila ATCC 19061]
          Length = 229

 Score =  156 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 55/132 (41%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEVPIREMVCFVLEQNGYQAIEAEDYDTAIRRL-SEPYPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++      + V  +    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQLIKHMKRDHNTKTIPVIMVTARAEEEDRVRGLDVGADDYITKPFSPKELIARVKAVLR 121

Query: 120 MQKSKDENQFLD 131
                +  + ++
Sbjct: 122 RISPMEAEEVIN 133


>gi|259909297|ref|YP_002649653.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia pyrifoliae Ep1/96]
 gi|224964919|emb|CAX56442.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia pyrifoliae Ep1/96]
 gi|283479352|emb|CAY75268.1| Phosphate regulon transcriptional regulatory protein phoB [Erwinia
           pyrifoliae DSM 12163]
          Length = 229

 Score =  156 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQNDYQPIEAADYDRAVNLLI-EPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G  AGA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLEAGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|194445785|ref|YP_002039637.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Newport str. SL254]
 gi|194404448|gb|ACF64670.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Newport
           str. SL254]
          Length = 229

 Score =  156 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNKL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|134298575|ref|YP_001112071.1| two component transcriptional regulator [Desulfotomaculum reducens
           MI-1]
 gi|134051275|gb|ABO49246.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum reducens MI-1]
          Length = 232

 Score =  156 bits (397), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 27/133 (20%), Positives = 59/133 (44%), Gaps = 5/133 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+    +R++ ++     GF V +A +   A +  + E +P+ +++D  + G  
Sbjct: 1   MPKILVVEDEQPIRELIKYNLEREGFQVIQAANGDIALDMAKSE-VPDIILLDIMLPGQD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                 ++ Q      + +  L    +    + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLSVCRYLHQDAATRSIPIIMLSARGEELDKVLGLEMGADDYITKPFSPRELIARIKARL 119

Query: 119 QMQKSKDENQFLD 131
           + Q    ENQ L+
Sbjct: 120 RRQTV--ENQVLE 130


>gi|330447454|ref|ZP_08311103.1| HAMP domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328491645|dbj|GAA05600.1| HAMP domain protein [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 1114

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 31/132 (23%), Positives = 59/132 (44%), Gaps = 3/132 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   +  ++  +     G+ V  A +  +A    E E  P+ +++D  M  +   E
Sbjct: 707 ILVVDDEPVNLQILNNFLRLAGYRVKTAENGPQALAMVE-EQRPDLILLDIMMPEMSGYE 765

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+     ++ +  L      +  I G   GAN +L KPFN+E L   ++   Q  
Sbjct: 766 VCTILRKQYSIFELPIMMLSALGQIQDRIKGFECGANDYLTKPFNKEELIARIQAYLQAS 825

Query: 122 KSKDENQFLDAI 133
           K++ E Q   ++
Sbjct: 826 KTEHEKQKNQSL 837


>gi|295838770|ref|ZP_06825703.1| DNA-binding response regulator ResD [Streptomyces sp. SPB74]
 gi|295827181|gb|EFG65293.1| DNA-binding response regulator ResD [Streptomyces sp. SPB74]
          Length = 345

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 46/119 (38%), Gaps = 6/119 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+VD    V +V     +  G+ V  A     A         P+ +V+D  + G+    
Sbjct: 16  VLVVDDDPTVAEVVAGYLDRAGYTVDLAGDGPSALARAHAH-RPDLVVLDLMLPGMDGLE 74

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               +R+      V V  L    D E  + G   GA+ ++ KPF+   L   +  + + 
Sbjct: 75  VCRRLRERAA---VPVVMLTARGDEEDRVLGLEQGADDYVTKPFSPRELVLRVASVLRR 130


>gi|332760677|gb|EGJ90965.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri 4343-70]
          Length = 229

 Score =  156 bits (396), Expect = 8e-37,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|288554581|ref|YP_003426516.1| two-component response regulator yycF [Bacillus pseudofirmus OF4]
 gi|288545741|gb|ADC49624.1| two-component response regulator yycF [Bacillus pseudofirmus OF4]
          Length = 236

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      GF VF A    EA E  +KE  P+ +++D  +     
Sbjct: 3   KRILVVDDEKPIADILKFNLEKEGFEVFCAYDGNEAVEQVKKEE-PDLILLDIMLPHKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  MEVCREVRKS---YDIPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKSKDEN 127
            +KS  E 
Sbjct: 119 RRKSGAEE 126


>gi|218782319|ref|YP_002433637.1| response regulator receiver modulated diguanylate cyclase
           [Desulfatibacillum alkenivorans AK-01]
 gi|218763703|gb|ACL06169.1| response regulator receiver modulated diguanylate cyclase
           [Desulfatibacillum alkenivorans AK-01]
          Length = 301

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 29/139 (20%), Positives = 63/139 (45%), Gaps = 7/139 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L++D S ++  V +++    G  V  AT+  E  E     + P+ +++D  M G+ 
Sbjct: 1   MANILVIDDSRLIAHVAKNMLTARGHEVTVATNGEEGLEAVAT-IKPDLILLDLIMPGMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  ++  P   D+ V  L  + +    + G  AGA+ ++ KPF    L   +    
Sbjct: 60  GYAVCEKIKGSPATADIPVIMLTSKAETADKVRGLEAGASDYVTKPFEEGELVARVNTHL 119

Query: 119 QMQK----SKDENQFLDAI 133
           ++++     ++ N+ L  +
Sbjct: 120 RIKELYESLQETNRQLQEL 138


>gi|297616303|ref|YP_003701462.1| two component transcriptional regulator, winged helix family
           [Syntrophothermus lipocalidus DSM 12680]
 gi|297144140|gb|ADI00897.1| two component transcriptional regulator, winged helix family
           [Syntrophothermus lipocalidus DSM 12680]
          Length = 228

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 53/127 (41%), Gaps = 6/127 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+V+   +V+++ R      G+ V  A    EA         P+ +++D  +      
Sbjct: 4   TILVVEDEELVQELLRLYLEKEGYAVEAAWDGEEALSKFRSNN-PDLVILDIMLPKKDGW 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R M   ++  +  L  + +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  TVCREIRAM---SNAPIIMLTAKGEESDRVLGLDLGADDYVCKPFSPIELVARVKAVLRR 119

Query: 121 QKSKDEN 127
               +++
Sbjct: 120 TSLANQD 126


>gi|261340989|ref|ZP_05968847.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacter cancerogenus ATCC 35316]
 gi|288316853|gb|EFC55791.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacter cancerogenus ATCC 35316]
          Length = 229

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPIEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHIKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|531494|emb|CAA56927.1| phoB [Shigella flexneri]
          Length = 229

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|288956869|ref|YP_003447210.1| two-component response regulator [Azospirillum sp. B510]
 gi|288909177|dbj|BAI70666.1| two-component response regulator [Azospirillum sp. B510]
          Length = 248

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 52/119 (43%), Gaps = 3/119 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+V+    +  + ++     GF V  A+   EA      E  P+ +++D  +  +  LE
Sbjct: 23  VLIVEDEADILTLLKYNLEKEGFRVATASDGEEAL-LAAGEQTPHIVLLDWMLPLMSGLE 81

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               +R+     D+ +  L    +    + G  +GA+ ++ KPF+   L   MR + + 
Sbjct: 82  VCRQLRRNAKTRDIPIIMLTARGEEGDRVRGLNSGADDYITKPFSPTELVARMRAVLRR 140


>gi|163814591|ref|ZP_02205980.1| hypothetical protein COPEUT_00742 [Coprococcus eutactus ATCC 27759]
 gi|158450226|gb|EDP27221.1| hypothetical protein COPEUT_00742 [Coprococcus eutactus ATCC 27759]
          Length = 245

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 56/129 (43%), Gaps = 6/129 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           +++L+VD    + ++     N   +    A S  EA +  E E  P+ +++D  + G+  
Sbjct: 4   NNILIVDDDENIAELISLYLNKECYETEIAASGTEALQLFE-EYSPDLVLLDVMLPGMDG 62

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+    ++  +  L  + +    + G + GA+ +++KPF+   L   +  L +
Sbjct: 63  YQVCTEIRK---TSNTPIIMLSAKGEVFDKVLGLKIGADDYIVKPFDSNELVARVGALLR 119

Query: 120 MQKSKDENQ 128
                +  Q
Sbjct: 120 RSAMTESTQ 128


>gi|90580619|ref|ZP_01236424.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Vibrio angustum S14]
 gi|90438277|gb|EAS63463.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium angustum S14]
          Length = 1114

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 30/132 (22%), Positives = 61/132 (46%), Gaps = 3/132 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   +  ++  +     G+ V  A S  +A +  +++  P+ +++D  M  +   E
Sbjct: 707 ILVVDDEPVNLQILNNFLRLAGYRVKTAESGHQALDIVQQQ-RPDLILLDIMMPEMSGYE 765

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+     ++ +  L      +  I G   GAN +L KPFN+E L   ++   Q  
Sbjct: 766 VCTLLRKQYSIFELPIMMLSALGQIQDRIKGFECGANDYLTKPFNKEELIARIQAYLQAS 825

Query: 122 KSKDENQFLDAI 133
           K++ E Q   ++
Sbjct: 826 KTEHEKQKNQSL 837


>gi|59712595|ref|YP_205371.1| DNA-binding response regulator in two-component regulatory system
           with PhoR [Vibrio fischeri ES114]
 gi|59480696|gb|AAW86483.1| DNA-binding response regulator in two-component regulatory system
           with PhoR [Vibrio fischeri ES114]
          Length = 230

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 54/132 (40%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYEPIEAEDYDSALSLLC-EPYPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++      + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDEFTKKIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVIR 121

Query: 120 MQKSKDENQFLD 131
                   + +D
Sbjct: 122 RVSPTSIEELID 133


>gi|113476924|ref|YP_722985.1| adenylate/guanylate cyclase [Trichodesmium erythraeum IMS101]
 gi|110167972|gb|ABG52512.1| adenylate/guanylate cyclase [Trichodesmium erythraeum IMS101]
          Length = 1207

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 60/125 (48%), Gaps = 2/125 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   +   +  +  +   + V +A +  +A +   ++ LP+ +++D  M G+   E
Sbjct: 741 ILIVDDEPVNLTLLSNQLSLHNYQVIQANNGQKALDILAQDFLPDLILLDVMMPGMTGYE 800

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               VR+  L   + +  L  +     ++ G   GAN +L KPF+++ L   ++    ++
Sbjct: 801 VTQKVRETWLLHQLPIIMLTAKNRVSDLVMGLEVGANDYLSKPFHKKELLARIKTHINIK 860

Query: 122 KSKDE 126
           K + E
Sbjct: 861 KLRTE 865


>gi|197335063|ref|YP_002156819.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           fischeri MJ11]
 gi|197316553|gb|ACH66000.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           fischeri MJ11]
          Length = 230

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 54/132 (40%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYEPIEAEDYDSALSLLC-EPYPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++      + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDEFTKKIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVIR 121

Query: 120 MQKSKDENQFLD 131
                   + +D
Sbjct: 122 RVSPTSIEELID 133


>gi|300818279|ref|ZP_07098490.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 107-1]
 gi|300529170|gb|EFK50232.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 107-1]
          Length = 229

 Score =  156 bits (396), Expect = 9e-37,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|254508241|ref|ZP_05120365.1| response regulator receiver domain protein [Vibrio parahaemolyticus
           16]
 gi|219548858|gb|EED25859.1| response regulator receiver domain protein [Vibrio parahaemolyticus
           16]
          Length = 1111

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 38/133 (28%), Positives = 56/133 (42%), Gaps = 6/133 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
           LL+VD   +  +V        G+ V  A    EA E  E E  P  +++D  M G+    
Sbjct: 707 LLVVDDEPVNLRVLDSFLRLEGYRVQTAKDGLEAFEKLEAEK-PELVLLDIMMPGMSGYQ 765

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +RQ      + V  L      +  + G  AGAN +L KPFN++ L   +R      
Sbjct: 766 VCEKLRQDYDHAQLPVIMLTALNQADDRLRGFEAGANDYLSKPFNKQELAARIRAHLTAS 825

Query: 122 KSKD---ENQFLD 131
           K++    ENQ L 
Sbjct: 826 KAEQRRIENQQLQ 838


>gi|296101518|ref|YP_003611664.1| transcriptional regulator PhoB [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
 gi|295055977|gb|ADF60715.1| transcriptional regulator PhoB [Enterobacter cloacae subsp. cloacae
           ATCC 13047]
          Length = 229

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|332881804|ref|ZP_08449452.1| response regulator receiver domain protein [Capnocytophaga sp. oral
            taxon 329 str. F0087]
 gi|332680443|gb|EGJ53392.1| response regulator receiver domain protein [Capnocytophaga sp. oral
            taxon 329 str. F0087]
          Length = 1341

 Score =  156 bits (396), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 57/131 (43%), Gaps = 4/131 (3%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+LLVD +  + ++   +     + V  A +  EA +  +   + + +V D  M G+  F
Sbjct: 1093 SILLVDDNMQLLEMMEKILATK-YRVLTAENGLEALKQLKAHAV-DLIVSDVMMPGMDGF 1150

Query: 63   --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 ++     + + V  L  +   +  +    AGA+ +L KPF  + L   +  L + 
Sbjct: 1151 ALCRKLKSQLETSHIPVIMLTAKQSADDRVDCYEAGADGYLAKPFELKVLAARIDNLLRT 1210

Query: 121  QKSKDENQFLD 131
             +++ +   ++
Sbjct: 1211 YRNRQQAFRME 1221


>gi|294139921|ref|YP_003555899.1| phosphate regulon response regulator PhoB [Shewanella violacea
           DSS12]
 gi|293326390|dbj|BAJ01121.1| phosphate regulon response regulator PhoB [Shewanella violacea
           DSS12]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   + +  GF    A     A      E  P+ +++D    G    
Sbjct: 4   KILIVEDESAIREMLAFVLDQHGFNTTSAEDFDSAINMI-SEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLRQDEFTRQIPIIMLTARGEEEDKVRGLEVGADDYMTKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SSPTSLEEPID 133


>gi|157146995|ref|YP_001454314.1| transcriptional regulator PhoB [Citrobacter koseri ATCC BAA-895]
 gi|157084200|gb|ABV13878.1| hypothetical protein CKO_02772 [Citrobacter koseri ATCC BAA-895]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYVTKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|332707455|ref|ZP_08427504.1| two-component response regulator, CheY subfamily [Lyngbya majuscula
           3L]
 gi|332353806|gb|EGJ33297.1| two-component response regulator, CheY subfamily [Lyngbya majuscula
           3L]
          Length = 236

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 54/133 (40%), Gaps = 4/133 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V +  S  EA E C K   P+ +V D  M  + 
Sbjct: 1   MKKILVVDDDKTLLTLLKRYLEHRGYQVEQVCSGTEALEACVKNP-PDLVVSDVLMPEMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
              F   +R +P G  +   +L  + + E  I G   GA+ +L KP     L   +  L 
Sbjct: 60  GLEFCRRLRNIPNGRLMPFIFLSSKAELEDRINGHSMGADDYLTKPVAPRELEAKIEALL 119

Query: 119 QM-QKSKDENQFL 130
           +   +   E   L
Sbjct: 120 ERSHRIHAEIVRL 132


>gi|313112755|ref|ZP_07798403.1| response regulator receiver domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624954|gb|EFQ08261.1| response regulator receiver domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 331

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 46/120 (38%), Gaps = 1/120 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++ R      G++  EA     A          + +++D  M  + 
Sbjct: 104 MAKILIVDDEPRIRELIREHLQYSGYICEEAADGTAALTQL-SGGAFDLVILDLMMPFMD 162

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                        +  V  L    +    +AG  +GA+ +++KPF+   L   ++ +   
Sbjct: 163 GMTCLREMRARHINTPVIILTARGEEYDKLAGLESGADDYVVKPFSPRELVARVKAVLNR 222


>gi|237730369|ref|ZP_04560850.1| transcriptional regulator PhoB [Citrobacter sp. 30_2]
 gi|226905908|gb|EEH91826.1| transcriptional regulator PhoB [Citrobacter sp. 30_2]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVLR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|290474714|ref|YP_003467594.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulation of Pi uptake (OmpR family)
           [Xenorhabdus bovienii SS-2004]
 gi|289174027|emb|CBJ80814.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulation of Pi uptake (OmpR family)
           [Xenorhabdus bovienii SS-2004]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 51/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEVQIREMVCLVLEQNGYQTVEAEDYDVAVWRL-SEPYPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I  +++     D+ V  +    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQLIKQMKRDSSTRDIPVMMVTARGEEEDRVRGLDVGADDYITKPFSPKELVARIKAVLR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|154250855|ref|YP_001411679.1| two component transcriptional regulator [Parvibaculum
           lavamentivorans DS-1]
 gi|154154805|gb|ABS62022.1| two component transcriptional regulator, winged helix family
           [Parvibaculum lavamentivorans DS-1]
          Length = 272

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 56/125 (44%), Gaps = 4/125 (3%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG- 58
           M  S+++V+    +  + ++  +  G+ V  A    EA +   +E  P+ +++D  + G 
Sbjct: 42  MKPSVMIVEDEEALLTLLQYNLDKEGYKVITAADGEEA-DLLIRETTPDLILLDWMLPGL 100

Query: 59  -VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             +E    +R  P   +V +  +    +    I G   GA+ ++ KPF+   L   +R +
Sbjct: 101 SGIELCRRLRGRPETRNVPIIMITARGEETDRIRGLDIGADDYVTKPFSMTELLARIRAV 160

Query: 118 PQMQK 122
            +  +
Sbjct: 161 MRRIR 165


>gi|148980999|ref|ZP_01816248.1| DNA-binding response regulator PhoB [Vibrionales bacterium SWAT-3]
 gi|145961039|gb|EDK26361.1| DNA-binding response regulator PhoB [Vibrionales bacterium SWAT-3]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLC-EPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  VNFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|311280718|ref|YP_003942949.1| two component transcriptional regulator PhoB, winged helix family
           [Enterobacter cloacae SCF1]
 gi|308749913|gb|ADO49665.1| two component transcriptional regulator PhoB, winged helix family
           [Enterobacter cloacae SCF1]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVTQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|206967625|ref|ZP_03228581.1| DNA-binding response regulator [Bacillus cereus AH1134]
 gi|206736545|gb|EDZ53692.1| DNA-binding response regulator [Bacillus cereus AH1134]
          Length = 223

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 62/131 (47%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E     +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEIQ 131


>gi|29830590|ref|NP_825224.1| two-component system response regulator [Streptomyces avermitilis
           MA-4680]
 gi|29607702|dbj|BAC71759.1| putative two-component system response regulator [Streptomyces
           avermitilis MA-4680]
          Length = 243

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A E       P+ +V+D  M  +  
Sbjct: 11  QRILIVDDEPAVREALQRSLAFEGYDTEVAVDGADALEKATA-YQPDLVVLDIQMPRMDG 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    GT   +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 70  LTAARRIRGAGTTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 128


>gi|283834288|ref|ZP_06354029.1| phosphate regulon transcriptional regulatory protein PhoB
           [Citrobacter youngae ATCC 29220]
 gi|291069814|gb|EFE07923.1| phosphate regulon transcriptional regulatory protein PhoB
           [Citrobacter youngae ATCC 29220]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ +  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREAMTRDIPIMMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVLR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|114327579|ref|YP_744736.1| phosphate regulon transcriptional regulatory protein phoB
           [Granulibacter bethesdensis CGDNIH1]
 gi|114315753|gb|ABI61813.1| phosphate regulon transcriptional regulatory protein phoB
           [Granulibacter bethesdensis CGDNIH1]
          Length = 249

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 58/120 (48%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++L+V+    +  + R+     GF V EA+   EA      E+ P+ +++D  + G   +
Sbjct: 23  TVLIVEDEAALATMLRYNLEKQGFRVEEASDGQEALHRL-SEVQPDLVLLDWMLPGLSGI 81

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+ P   D+ +  +   V+ +  +     GA+ ++ KPFN + L+  +R L + 
Sbjct: 82  EVCRQIRRKPGTRDLPIIMVTARVEDQDAVRALNTGADDYITKPFNMQALQARIRALLRR 141


>gi|26246403|ref|NP_752442.1| transcriptional regulator PhoB [Escherichia coli CFT073]
 gi|26106801|gb|AAN78986.1|AE016756_169 Phosphate regulon transcriptional Regulatory protein phoB
           [Escherichia coli CFT073]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEVPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|229012417|ref|ZP_04169592.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides DSM 2048]
 gi|229170815|ref|ZP_04298429.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus AH621]
 gi|228612653|gb|EEK69862.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus AH621]
 gi|228748776|gb|EEL98626.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides DSM 2048]
          Length = 237

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 26/137 (18%), Positives = 57/137 (41%), Gaps = 9/137 (6%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+V+    +R+V +       + V+ A +  E  +       P+ +++D  M     
Sbjct: 3   KRILIVEDEENIREVCKRYLEREEYEVYTAVNGKEGWDLFLTH-QPDLIILDLMMPKKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +RQ    ++V +  L  + +    I G   GA+ +L KPF+   L   ++ + +
Sbjct: 62  WELCEEIRQQ---SNVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIILR 118

Query: 120 M---QKSKDENQFLDAI 133
                + + +   L+ I
Sbjct: 119 RGSHVQIQAKESLLEVI 135


>gi|146292399|ref|YP_001182823.1| two component transcriptional regulator [Shewanella putrefaciens
           CN-32]
 gi|145564089|gb|ABP75024.1| two component transcriptional regulator, winged helix family
           [Shewanella putrefaciens CN-32]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A     KE  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVMEQHGFTTSAAEDFDSAIALL-KEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SAPTRLEETID 133


>gi|163943242|ref|YP_001642472.1| two component transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|163865439|gb|ABY46497.1| two component transcriptional regulator, winged helix family
           [Bacillus weihenstephanensis KBAB4]
          Length = 236

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 6/122 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+V+    +R+V +       + V+ A +  E  +       P+ +++D  M    
Sbjct: 1   MKKILIVEDEENIREVCKRYLEREEYEVYTAVNGTEGWDVFLTH-QPDLIILDLMMPKKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +RQ    ++V +  L  + +    I G   GA+ +L KPF+   L   ++ + 
Sbjct: 60  GWELCGEIRQQ---SNVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIIL 116

Query: 119 QM 120
           + 
Sbjct: 117 RR 118


>gi|11467431|ref|NP_043139.1| hypothetical protein CypaCp002 [Cyanophora paradoxa]
 gi|1351749|sp|P48259|YCF27_CYAPA RecName: Full=Probable transcriptional regulator ycf27; AltName:
           Full=OmpR-like protein
 gi|1016232|gb|AAA81319.1| ycf27 [Cyanophora paradoxa]
          Length = 239

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 54/124 (43%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +R++     +  G+ V  A    EA    + E  PN +V+D  M     
Sbjct: 6   KKILVVDDEISIRRILETRLSMIGYEVVTAADGEEALTIFQLEH-PNLVVLDVMMPKLDG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R L +
Sbjct: 65  YGVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSLLR 121

Query: 120 MQKS 123
             ++
Sbjct: 122 RTEN 125


>gi|113971044|ref|YP_734837.1| two component transcriptional regulator [Shewanella sp. MR-4]
 gi|114048269|ref|YP_738819.1| two component transcriptional regulator [Shewanella sp. MR-7]
 gi|117921320|ref|YP_870512.1| two component transcriptional regulator [Shewanella sp. ANA-3]
 gi|120599604|ref|YP_964178.1| two component transcriptional regulator [Shewanella sp. W3-18-1]
 gi|113885728|gb|ABI39780.1| two component transcriptional regulator, winged helix family
           [Shewanella sp. MR-4]
 gi|113889711|gb|ABI43762.1| two component transcriptional regulator, winged helix family
           [Shewanella sp. MR-7]
 gi|117613652|gb|ABK49106.1| two component transcriptional regulator, winged helix family
           [Shewanella sp. ANA-3]
 gi|120559697|gb|ABM25624.1| two component transcriptional regulator, winged helix family
           [Shewanella sp. W3-18-1]
 gi|319425699|gb|ADV53773.1| two component transcriptional regulator, winged helix family
           [Shewanella putrefaciens 200]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A     KE  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVMEQHGFTTSAAEDFDSAIALL-KEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SAPTRLEETID 133


>gi|84393908|ref|ZP_00992650.1| Response regulator [Vibrio splendidus 12B01]
 gi|86145558|ref|ZP_01063888.1| Response regulator [Vibrio sp. MED222]
 gi|218708602|ref|YP_002416223.1| DNA-binding response regulator PhoB [Vibrio splendidus LGP32]
 gi|84375458|gb|EAP92363.1| Response regulator [Vibrio splendidus 12B01]
 gi|85836529|gb|EAQ54655.1| Response regulator [Vibrio sp. MED222]
 gi|218321621|emb|CAV17573.1| DNA-binding response regulator PhoB [Vibrio splendidus LGP32]
          Length = 229

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKLC-EPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|298492569|ref|YP_003722746.1| response regulator receiver sensor signal transduction histidine
           kinase ['Nostoc azollae' 0708]
 gi|298234487|gb|ADI65623.1| response regulator receiver sensor signal transduction histidine
           kinase ['Nostoc azollae' 0708]
          Length = 383

 Score =  156 bits (395), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 54/129 (41%), Gaps = 3/129 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD +     +   +  + G+ V  A S   A    E E  P+ +++D +M  +   
Sbjct: 12  NILIVDDTPNNLHLLSSMLEEQGYEVRCANSGAIALRAVEMEH-PDIILLDINMPNMNGY 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++  P   D+ V +L    +    +   R G   ++ KPF  E +   +     +
Sbjct: 71  EVCERLKLDPRTRDIPVIFLSALSETIDKVKAFRIGGIDYITKPFQLEEVLARLENHISL 130

Query: 121 QKSKDENQF 129
           ++ + E Q 
Sbjct: 131 RRMQIELQQ 139


>gi|126173616|ref|YP_001049765.1| two component transcriptional regulator [Shewanella baltica OS155]
 gi|152999896|ref|YP_001365577.1| two component transcriptional regulator [Shewanella baltica OS185]
 gi|160874521|ref|YP_001553837.1| two component transcriptional regulator [Shewanella baltica OS195]
 gi|217974139|ref|YP_002358890.1| two component transcriptional regulator PhoB, winged helix family
           [Shewanella baltica OS223]
 gi|304409488|ref|ZP_07391108.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS183]
 gi|307303846|ref|ZP_07583599.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica BA175]
 gi|125996821|gb|ABN60896.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS155]
 gi|151364514|gb|ABS07514.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS185]
 gi|160860043|gb|ABX48577.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS195]
 gi|217499274|gb|ACK47467.1| two component transcriptional regulator PhoB, winged helix family
           [Shewanella baltica OS223]
 gi|304352006|gb|EFM16404.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica OS183]
 gi|306912744|gb|EFN43167.1| two component transcriptional regulator, winged helix family
           [Shewanella baltica BA175]
 gi|315266760|gb|ADT93613.1| two component transcriptional regulator PhoB, winged helix family
           [Shewanella baltica OS678]
          Length = 229

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A     KE  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVMEQHGFTTSAAEDFDSAIALL-KEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SAPTRLEETID 133


>gi|84514488|ref|ZP_01001852.1| phosphate regulon transcriptional regulatory protein PhoB
           [Loktanella vestfoldensis SKA53]
 gi|84511539|gb|EAQ07992.1| phosphate regulon transcriptional regulatory protein PhoB
           [Loktanella vestfoldensis SKA53]
          Length = 229

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 53/130 (40%), Gaps = 3/130 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           S+L+V+     R+V  +     GF V +A    EA     +E  P+ +++D  + G   +
Sbjct: 7   SVLVVEDEPAQREVLAYNLESEGFRVIKAADGNEAL-LLIEEEQPDLILLDWMLPGTSGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++  P      V  L    +    + G   GA+ ++ KP++   L   ++   + 
Sbjct: 66  EICRQIKSRPAFRMTPVIMLSARSEEVDKVRGLETGADDYISKPYSIIELLARVKAHLRR 125

Query: 121 QKSKDENQFL 130
            +     + L
Sbjct: 126 SRPATMGERL 135


>gi|322372853|ref|ZP_08047389.1| DNA-binding response regulator VicR [Streptococcus sp. C150]
 gi|321277895|gb|EFX54964.1| DNA-binding response regulator VicR [Streptococcus sp. C150]
          Length = 236

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAEN-PDLVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   +   +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|297203135|ref|ZP_06920532.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sviceus ATCC 29083]
 gi|297148314|gb|EFH28936.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sviceus ATCC 29083]
          Length = 240

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 53/130 (40%), Gaps = 2/130 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V +V     +  G++V  A    EA         P+ +V+D  + G+   
Sbjct: 12  RVLVVDDDPTVAEVVSGYLDRAGYLVDRAADGPEALARAAAH-RPDLVVLDLMLPGMDGL 70

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V  L    D +  I G   GA+ ++ KPF+   L   +  + +  +
Sbjct: 71  EVCRRMRGRGP-VPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRSR 129

Query: 123 SKDENQFLDA 132
             +++  L A
Sbjct: 130 PAEQSGALRA 139


>gi|225181123|ref|ZP_03734569.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
 gi|225168092|gb|EEG76897.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
          Length = 229

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 53/127 (41%), Gaps = 6/127 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    + K  +      G+ V  A    EA     +E  P+ +V+D  +    
Sbjct: 1   MPRVLVVDDEKTIVKGLKFNLEKEGYEVLVAFDGEEALRVFNEES-PDLIVLDLMLPKLD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E   ++R+    +DV +  L    +    I G   GA+ ++ KPFN   L   ++ + 
Sbjct: 60  GFEVCRNIRK---TSDVPIVMLTARGEDIDKILGLELGADDYVTKPFNPRELAARVKAIM 116

Query: 119 QMQKSKD 125
           +  +S  
Sbjct: 117 RRSQSSS 123


>gi|78044728|ref|YP_360866.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77996843|gb|ABB15742.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 231

 Score =  155 bits (394), Expect = 1e-36,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 59/127 (46%), Gaps = 4/127 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD    + ++ +      G+ V EA     A E  +KE LP+ +++D  + G+ 
Sbjct: 1   MK-ILVVDDEAPIVELIKFNLEREGYKVLEAYDGIRALEIVKKE-LPDLVILDIMLPGMS 58

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE   ++R      ++ +  L    +    I G   GA+ +++KPF+   L   ++   
Sbjct: 59  GLEVCKNIRNNEKTAEIPIIMLSARGEEVDKILGLELGADDYMVKPFSPRELVARVKARL 118

Query: 119 QMQKSKD 125
           +  + ++
Sbjct: 119 RRLEGRE 125


>gi|332160707|ref|YP_004297284.1| phosphate regulon transcriptional regulatory protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|325664937|gb|ADZ41581.1| phosphate regulon transcriptional regulatory protein [Yersinia
           enterocolitica subsp. palearctica 105.5R(r)]
 gi|330862470|emb|CBX72627.1| phosphate regulon transcriptional regulatory protein phoB [Yersinia
           enterocolitica W22703]
          Length = 279

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 53  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPYPDLVLLDWMLPGGSG 111

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 112 IQFIKHMKREVLTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 171

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 172 RISPMAVEEVIE 183


>gi|312862953|ref|ZP_07723193.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus vestibularis F0396]
 gi|322516692|ref|ZP_08069601.1| response regulator [Streptococcus vestibularis ATCC 49124]
 gi|311101813|gb|EFQ60016.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus vestibularis F0396]
 gi|322124725|gb|EFX96163.1| response regulator [Streptococcus vestibularis ATCC 49124]
          Length = 235

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAEK-PDLVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   +   +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|153871532|ref|ZP_02000680.1| adenylate/guanylate cyclase [Beggiatoa sp. PS]
 gi|152071998|gb|EDN69316.1| adenylate/guanylate cyclase [Beggiatoa sp. PS]
          Length = 594

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 53/132 (40%), Gaps = 5/132 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD + +  K+         F V  A +   A     K L P+ +++D  M G+  
Sbjct: 6   NKVLIVDDNSVNLKILSRFLKKAHFEVIMAKNGESAITQV-KNLKPDIILLDIMMPGMDG 64

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     ++      D+ V ++         + G + GA  ++ KP   E +   +     
Sbjct: 65  FETCRCLKANEESKDIPVIFMTALESTPDKVKGFKIGAIDYITKPVQMEEVLARVNTHLT 124

Query: 120 MQKSKDENQFLD 131
           ++    +N+ L+
Sbjct: 125 IRHL--QNRLLE 134


>gi|237808813|ref|YP_002893253.1| two component transcriptional regulator PhoB, winged helix family
           [Tolumonas auensis DSM 9187]
 gi|237501074|gb|ACQ93667.1| two component transcriptional regulator PhoB, winged helix family
           [Tolumonas auensis DSM 9187]
          Length = 229

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 57/131 (43%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    G+   EA    EA     KE  P  +++D  + G    
Sbjct: 4   RVLVVEDEAPIREMLCFMLEQKGYEPVEAADFTEAVALV-KEPYPELILLDWMIPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            FI  ++Q  L  ++ +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QFIKLMKQEELTRNIPIVMLTARGEEEDKVRGLEVGADDYITKPFSPKELTARIKAVMRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SAPTATEEVID 133


>gi|228477430|ref|ZP_04062066.1| transcriptional regulatory protein [Streptococcus salivarius SK126]
 gi|228250865|gb|EEK10053.1| transcriptional regulatory protein [Streptococcus salivarius SK126]
          Length = 235

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAEK-PDLVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   +   +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|307149957|ref|YP_003885341.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 7822]
 gi|306980185|gb|ADN12066.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7822]
          Length = 242

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   ++  P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETF-RQTNPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|239995182|ref|ZP_04715706.1| putative DNA-binding response regulator PhoB [Alteromonas macleodii
           ATCC 27126]
          Length = 229

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+V+    +R++ + +    GF + EA     A+E    E  P+ +++D  + G   
Sbjct: 3   RTVLVVEDEAPIREMLKFVLEQSGFNIIEAEDFDIAQEKIC-EPYPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++Q     D+ V  L    + E  I G  AGA+ ++ KPF+ + L   ++ + +
Sbjct: 62  VQLAKSLKQHEFTRDIPVIMLTARGEEEDKIRGLDAGADDYVTKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|167630147|ref|YP_001680646.1| transcriptional regulatory protein [Heliobacterium modesticaldum
           Ice1]
 gi|167592887|gb|ABZ84635.1| transcriptional regulatory protein [Heliobacterium modesticaldum
           Ice1]
          Length = 232

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 50/122 (40%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+V+    + ++ R      G  V  A     A   C +E LP+ +++D  +    
Sbjct: 1   MAKILVVEDDQHILELVRFNLEKEGHTVQVAVDGEAAL-ACLQEELPDLIILDLMLPRLD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    VR       + +  L  + +    + G   GA+ ++ KPF+   L   ++ L 
Sbjct: 60  GLELCRRVRSRNHSAHLPILMLTAKGEEVDKVIGLEMGADDYMTKPFSPRELVARIKALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|170727789|ref|YP_001761815.1| two component transcriptional regulator [Shewanella woodyi ATCC
           51908]
 gi|169813136|gb|ACA87720.1| two component transcriptional regulator, winged helix family
           [Shewanella woodyi ATCC 51908]
          Length = 229

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 52/131 (39%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF+   A     A +    E  P+ +++D    G    
Sbjct: 4   RILIVEDELAIREMLTFVLEQHGFVTSAAEDFDSALDLL-TEPYPDLVLLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRMRQDEFTRQIPIIMLTARGEEEDKVRGLEVGADDYMTKPFSPKELVARIKAVIRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SSPTSLEEPID 133


>gi|27363935|ref|NP_759463.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           vulnificus CMCP6]
 gi|37678907|ref|NP_933516.1| DNA-binding response regulator PhoB [Vibrio vulnificus YJ016]
 gi|320157317|ref|YP_004189696.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Vibrio vulnificus MO6-24/O]
 gi|27360052|gb|AAO08990.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           vulnificus CMCP6]
 gi|37197648|dbj|BAC93487.1| DNA-binding response regulator PhoB [Vibrio vulnificus YJ016]
 gi|319932629|gb|ADV87493.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Vibrio vulnificus MO6-24/O]
          Length = 229

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|310766801|gb|ADP11751.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia sp. Ejp617]
          Length = 229

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQNDYQPIEAADYDRAVNLLI-EPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPLAVEEVIE 133


>gi|172056682|ref|YP_001813142.1| two component transcriptional regulator [Exiguobacterium sibiricum
           255-15]
 gi|171989203|gb|ACB60125.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sibiricum 255-15]
          Length = 228

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 49/120 (40%), Gaps = 2/120 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R +         +    A++  EA +  +++   + +++D  M  +   
Sbjct: 7   KILVVDDEAQMRDLLVSNLQKENYQTTTASNGQEALDLMQRD-AFHLVLLDVMMPEMDGL 65

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
            A +R     ++V +  L    D    I G + GA+ ++ KPF+   L   +    +   
Sbjct: 66  TACMRIRE-FSNVPIIMLTARSDELDRIHGLKIGADDYITKPFSPRELLARIEATLRRSH 124


>gi|260771433|ref|ZP_05880358.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           furnissii CIP 102972]
 gi|260613559|gb|EEX38753.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           furnissii CIP 102972]
          Length = 229

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVNKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|50120049|ref|YP_049216.1| phosphate regulon response regulator [Pectobacterium atrosepticum
           SCRI1043]
 gi|227113361|ref|ZP_03827017.1| phosphate regulon response regulator [Pectobacterium carotovorum
           subsp. brasiliensis PBR1692]
 gi|227327489|ref|ZP_03831513.1| phosphate regulon response regulator [Pectobacterium carotovorum
           subsp. carotovorum WPP14]
 gi|253687403|ref|YP_003016593.1| two component transcriptional regulator PhoB, winged helix family
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|261822544|ref|YP_003260650.1| two component transcriptional regulator PhoB, winged helix family
           [Pectobacterium wasabiae WPP163]
 gi|49610575|emb|CAG74020.1| phosphate regulon response regulator [Pectobacterium atrosepticum
           SCRI1043]
 gi|251753981|gb|ACT12057.1| two component transcriptional regulator PhoB, winged helix family
           [Pectobacterium carotovorum subsp. carotovorum PC1]
 gi|261606557|gb|ACX89043.1| two component transcriptional regulator PhoB, winged helix family
           [Pectobacterium wasabiae WPP163]
          Length = 229

 Score =  155 bits (394), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P  +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMVCFVLEQNGYQPVEAEDYDSAVTQL-SEPFPELVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|205351709|ref|YP_002225510.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 287/91]
 gi|205271490|emb|CAR36308.1| phosphate regulon transcriptional regulatory protein PhoB
           [Salmonella enterica subsp. enterica serovar Gallinarum
           str. 287/91]
 gi|326626742|gb|EGE33085.1| transcriptional regulator PhoB [Salmonella enterica subsp. enterica
           serovar Gallinarum str. 9]
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDCAVNKL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|47566185|ref|ZP_00237213.1| two-component response regulator [Bacillus cereus G9241]
 gi|47556738|gb|EAL15069.1| two-component response regulator [Bacillus cereus G9241]
          Length = 223

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 62/131 (47%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E     +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEIQ 131


>gi|218779275|ref|YP_002430593.1| two component transcriptional regulator, winged helix family
           [Desulfatibacillum alkenivorans AK-01]
 gi|218760659|gb|ACL03125.1| two component transcriptional regulator, winged helix family
           [Desulfatibacillum alkenivorans AK-01]
          Length = 228

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 57/125 (45%), Gaps = 3/125 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            S+L+VD    + ++ +      GF +F A S  +A E   K   P+ +++D  + G+  
Sbjct: 4   TSILIVDDEEDILELLKFNLEREGFKIFCADSGEKALEAV-KNFSPDLVLLDLMLPGIDG 62

Query: 62  FI--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++  P  + + +  L  + D   ++ G   GA+ ++ KPF+   +   +R + +
Sbjct: 63  LEVARVLKSKPNTSTIPIIMLTAKGDESDVVRGLELGADDYVTKPFSPRVIIARVRAVMR 122

Query: 120 MQKSK 124
              ++
Sbjct: 123 RNAAE 127


>gi|299821888|ref|ZP_07053776.1| DNA-binding response regulator [Listeria grayi DSM 20601]
 gi|299817553|gb|EFI84789.1| DNA-binding response regulator [Listeria grayi DSM 20601]
          Length = 235

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 1/126 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      GF V  A+   E  E    E  P+ +V+D  + G+ 
Sbjct: 1   MTKILVVDDELSIVTLLQFNIEKAGFEVITASDGQEGYELAIAEK-PDLIVLDLMLPGMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +      DV +  L  + +    I G   GA+ +L KPF+   +   ++ + + 
Sbjct: 60  GIEVTKKLRSEKIDVPILMLTAKDEELDKIIGLELGADDYLTKPFSPREVVARIKAIMRR 119

Query: 121 QKSKDE 126
            +S+ E
Sbjct: 120 TESRKE 125


>gi|91794040|ref|YP_563691.1| phosphate regulon transcriptional regulatory protein phoB
           [Shewanella denitrificans OS217]
 gi|91716042|gb|ABE55968.1| two component transcriptional regulator, winged helix family
           [Shewanella denitrificans OS217]
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 51/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   +    GF    A     A     +E  P+ +++D    G    
Sbjct: 4   RILIVEDESAIREMLIFVMEQHGFTTVAAEDFDSAIGLL-QEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLKQDKFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SAPTRLEETID 133


>gi|74310968|ref|YP_309387.1| transcriptional regulator PhoB [Shigella sonnei Ss046]
 gi|73854445|gb|AAZ87152.1| positive response regulator for pho regulon [Shigella sonnei Ss046]
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDCAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|259047884|ref|ZP_05738285.1| DNA-binding response regulator [Granulicatella adiacens ATCC 49175]
 gi|259035561|gb|EEW36816.1| DNA-binding response regulator [Granulicatella adiacens ATCC 49175]
          Length = 238

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 50/125 (40%), Gaps = 6/125 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  + +   +  GF V  A    E       E  P+ +++D  +    
Sbjct: 1   MKKILVVDDEKPISDIVKFSLSKEGFEVITAFDGEEGLAAF-HEKNPDLVILDLMLPKID 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    +R+    + V +  +  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCREIRK---TSHVPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELIARVKANL 116

Query: 119 QMQKS 123
           + Q+ 
Sbjct: 117 RRQQL 121


>gi|332140178|ref|YP_004425916.1| putative DNA-binding response regulator PhoB [Alteromonas macleodii
           str. 'Deep ecotype']
 gi|327550200|gb|AEA96918.1| putative DNA-binding response regulator PhoB [Alteromonas macleodii
           str. 'Deep ecotype']
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+V+    +R++ + +    GF + EA     A+E    E  P+ +++D  + G   
Sbjct: 3   RTVLVVEDEAPIREMLKFVLEQSGFNIIEAEDYDIAQEKIC-EPYPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++Q     D+ V  L    + E  I G  AGA+ ++ KPF+ + L   ++ + +
Sbjct: 62  VQLAKSLKQHEFTRDIPVIMLTARGEEEDKIRGLDAGADDYVTKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|323491596|ref|ZP_08096775.1| DNA-binding response regulator PhoB [Vibrio brasiliensis LMG 20546]
 gi|323314172|gb|EGA67257.1| DNA-binding response regulator PhoB [Vibrio brasiliensis LMG 20546]
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQTVEAEDYDTAVTKL-SEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|260776661|ref|ZP_05885556.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260607884|gb|EEX34149.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|83591942|ref|YP_425694.1| two component transcriptional regulator [Rhodospirillum rubrum ATCC
           11170]
 gi|83574856|gb|ABC21407.1| two component transcriptional regulator, winged helix family
           [Rhodospirillum rubrum ATCC 11170]
          Length = 233

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 54/125 (43%), Gaps = 4/125 (3%)

Query: 1   MDS-LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG- 58
           M S +L+V+    +  + R+     G+ V EA    EA      E  P+ +++D  +   
Sbjct: 1   MKSHVLIVEDEVSLVTLLRYNLEKEGYRVSEAMDGEEAMTLV-AEDQPDVVILDWMLPSL 59

Query: 59  -VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             +E    +R+ P   D+ +  L    +    I G   GA+ ++ KPF+   L   ++ L
Sbjct: 60  SGIEVCRQLRRKPRTRDLPILMLTARGEESDRIRGLNTGADDYMSKPFSMPELLARVKAL 119

Query: 118 PQMQK 122
            +  +
Sbjct: 120 LRRAQ 124


>gi|292487424|ref|YP_003530296.1| phosphate regulon transcriptional regulatory protein phoB [Erwinia
           amylovora CFBP1430]
 gi|292898668|ref|YP_003538037.1| phosphate regulon two-component response regulator [Erwinia
           amylovora ATCC 49946]
 gi|291198516|emb|CBJ45624.1| phosphate regulon two-component response regulator [Erwinia
           amylovora ATCC 49946]
 gi|291552843|emb|CBA19888.1| Phosphate regulon transcriptional regulatory protein phoB [Erwinia
           amylovora CFBP1430]
 gi|312171528|emb|CBX79786.1| Phosphate regulon transcriptional regulatory protein phoB [Erwinia
           amylovora ATCC BAA-2158]
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQNDYQPIEAADYDSALSLLI-EPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RIAPMAVEEVIE 133


>gi|152968913|ref|YP_001334022.1| transcriptional regulator PhoB [Klebsiella pneumoniae subsp.
           pneumoniae MGH 78578]
 gi|206576178|ref|YP_002240146.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella pneumoniae 342]
 gi|238893323|ref|YP_002918057.1| transcriptional regulator PhoB [Klebsiella pneumoniae NTUH-K2044]
 gi|262042405|ref|ZP_06015566.1| phosphate regulon response regulator [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288936893|ref|YP_003440952.1| two component transcriptional regulator, winged helix family
           [Klebsiella variicola At-22]
 gi|290510051|ref|ZP_06549421.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella sp. 1_1_55]
 gi|330006877|ref|ZP_08305751.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella sp. MS 92-3]
 gi|1172481|sp|P45605|PHOB_KLEPN RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|149295|gb|AAA25122.1| phosphate regulatory protein phoB [Klebsiella pneumoniae]
 gi|150953762|gb|ABR75792.1| positive response regulator for pho regulon, sensor is PhoR (or
           CreC) [Klebsiella pneumoniae subsp. pneumoniae MGH
           78578]
 gi|206565236|gb|ACI07012.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella pneumoniae 342]
 gi|238545639|dbj|BAH61990.1| positive response regulator for pho regulon [Klebsiella pneumoniae
           subsp. pneumoniae NTUH-K2044]
 gi|259040237|gb|EEW41347.1| phosphate regulon response regulator [Klebsiella pneumoniae subsp.
           rhinoscleromatis ATCC 13884]
 gi|288891602|gb|ADC59920.1| two component transcriptional regulator, winged helix family
           [Klebsiella variicola At-22]
 gi|289776767|gb|EFD84765.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella sp. 1_1_55]
 gi|328535683|gb|EGF62130.1| phosphate regulon transcriptional regulatory protein PhoB
           [Klebsiella sp. MS 92-3]
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI  +++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKLLKREAMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|324325416|gb|ADY20676.1| response regulator [Bacillus thuringiensis serovar finitimus
           YBT-020]
          Length = 223

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 61/131 (46%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E     +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ +   
Sbjct: 121 YTKQEQQEEFQ 131


>gi|42780487|ref|NP_977734.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
 gi|206977570|ref|ZP_03238464.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217958874|ref|YP_002337422.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|222095033|ref|YP_002529093.1| response regulator [Bacillus cereus Q1]
 gi|42736406|gb|AAS40342.1| DNA-binding response regulator [Bacillus cereus ATCC 10987]
 gi|206744288|gb|EDZ55701.1| DNA-binding response regulator [Bacillus cereus H3081.97]
 gi|217068126|gb|ACJ82376.1| DNA-binding response regulator [Bacillus cereus AH187]
 gi|221239091|gb|ACM11801.1| response regulator [Bacillus cereus Q1]
          Length = 223

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 61/131 (46%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E     +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ +   
Sbjct: 121 YTKQEQQEEFQ 131


>gi|238760009|ref|ZP_04621161.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           aldovae ATCC 35236]
 gi|238701762|gb|EEP94327.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           aldovae ATCC 35236]
          Length = 260

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 34  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVMRL-SEPFPDLVLLDWMLPGGSG 92

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 93  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 152

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 153 RISPMAVEEVIE 164


>gi|218441116|ref|YP_002379445.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
 gi|218173844|gb|ACK72577.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7424]
          Length = 247

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   ++  P+ +V+D  M      
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETF-RQTSPDLVVLDVMMPKLDGY 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 70  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126

Query: 121 QK 122
            +
Sbjct: 127 VE 128


>gi|114563933|ref|YP_751447.1| two component transcriptional regulator, winged helix family
           protein [Shewanella frigidimarina NCIMB 400]
 gi|114335226|gb|ABI72608.1| two component transcriptional regulator, winged helix family
           [Shewanella frigidimarina NCIMB 400]
          Length = 229

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 53/131 (40%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++   + +  GF    A     A E   KE  P+ +++D    G    
Sbjct: 4   RILIVEDESAIREMLTFVMDQHGFTTAAAEDFDSAIELL-KEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLAKRLKQDEFTRQIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELVARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
                  + +D
Sbjct: 123 SAPTRLEETID 133


>gi|295094559|emb|CBK83650.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Coprococcus sp.
           ART55/1]
          Length = 244

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 56/129 (43%), Gaps = 6/129 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           +++L+VD    + ++     N   +    A S  EA +  E E  P+ +++D  + G+  
Sbjct: 4   NNILIVDDDENIAELISLYLNKECYETEIAASGTEALQLFE-EYSPDLVLLDVMLPGMDG 62

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+    ++  +  L  + +    + G + GA+ +++KPF+   L   +  L +
Sbjct: 63  YQVCTEIRK---TSNTPIIMLSAKGEVFDKVLGLKIGADDYIVKPFDSNELVARVGALLR 119

Query: 120 MQKSKDENQ 128
                +  Q
Sbjct: 120 RSAMTESAQ 128


>gi|312127494|ref|YP_003992368.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311777513|gb|ADQ06999.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 223

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 57/126 (45%), Gaps = 7/126 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D    + +V +      GF V  A +  +      K  +P+ +++D  +    
Sbjct: 1   MK-ILVIDDDVKICEVIKLYLEKEGFEVVVAHNGIDGIAMF-KNEMPDLVILDIMLPKKD 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R++   +++ +  L  + +    + G   GA+ +++KPF+ + L   ++ + 
Sbjct: 59  GYEVCRELRKI---SNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVL 115

Query: 119 QMQKSK 124
           +  + +
Sbjct: 116 RRTQGE 121


>gi|320160793|ref|YP_004174017.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
 gi|319994646|dbj|BAJ63417.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
          Length = 239

 Score =  155 bits (393), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 57/126 (45%), Gaps = 6/126 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD     + + R      G++V  A++  EA E       P+ +++D  M  +  
Sbjct: 4   THILVVDDEPRYQHLLRVNLEAAGYLVSTASNGEEALELI-SSRQPDLVILDVMMPHLDG 62

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +RQ    + V +  L  + + +  + G   GA+ +++KPF+   L   +R + +
Sbjct: 63  FSTCERIRQ---FSSVPIIMLTAKGEEQDRVKGLNVGADDYVVKPFSATELIARVRAVLR 119

Query: 120 MQKSKD 125
             ++ +
Sbjct: 120 RAQTAE 125


>gi|296501980|ref|YP_003663680.1| two-component response regulator [Bacillus thuringiensis BMB171]
 gi|296323032|gb|ADH05960.1| two-component response regulator [Bacillus thuringiensis BMB171]
          Length = 223

 Score =  154 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEIQ 131


>gi|312884258|ref|ZP_07743967.1| response regulator [Vibrio caribbenthicus ATCC BAA-2122]
 gi|309368031|gb|EFP95574.1| response regulator [Vibrio caribbenthicus ATCC BAA-2122]
          Length = 229

 Score =  154 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|261252149|ref|ZP_05944722.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           orientalis CIP 102891]
 gi|260935540|gb|EEX91529.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           orientalis CIP 102891]
          Length = 229

 Score =  154 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|222529445|ref|YP_002573327.1| winged helix family two component transcriptional regulator
           [Caldicellulosiruptor bescii DSM 6725]
 gi|222456292|gb|ACM60554.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor bescii DSM 6725]
          Length = 223

 Score =  154 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 57/126 (45%), Gaps = 7/126 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D    + +V +      GF V  A +  +      K  +P+ +++D  +    
Sbjct: 1   MK-ILIIDDDVKICEVIKLYLEKEGFEVVVAHNGMDGIAMF-KNEMPDLVILDIMLPKKD 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R++   +++ +  L  + +    + G   GA+ +++KPF+ + L   ++ + 
Sbjct: 59  GYEVCRELRKI---SNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVL 115

Query: 119 QMQKSK 124
           +  + +
Sbjct: 116 RRTQGE 121


>gi|91225176|ref|ZP_01260398.1| DNA-binding response regulator PhoB [Vibrio alginolyticus 12G01]
 gi|254228694|ref|ZP_04922118.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. Ex25]
 gi|262395154|ref|YP_003287008.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. Ex25]
 gi|269965135|ref|ZP_06179269.1| DNA-binding response regulator PhoB [Vibrio alginolyticus 40B]
 gi|91190119|gb|EAS76390.1| DNA-binding response regulator PhoB [Vibrio alginolyticus 12G01]
 gi|151938873|gb|EDN57707.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. Ex25]
 gi|262338748|gb|ACY52543.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. Ex25]
 gi|269830121|gb|EEZ84348.1| DNA-binding response regulator PhoB [Vibrio alginolyticus 40B]
          Length = 229

 Score =  154 bits (392), Expect = 2e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVTKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|89092214|ref|ZP_01165168.1| phosphate regulon transcriptional regulatory protein PhoB
           [Oceanospirillum sp. MED92]
 gi|89083302|gb|EAR62520.1| phosphate regulon transcriptional regulatory protein PhoB
           [Oceanospirillum sp. MED92]
          Length = 231

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  M G   
Sbjct: 5   KSVLIVDDEAPIREMIAVALEMAGYQCLEAENANQAHGLIV-DDKPDMVLLDWMMPGASG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +EF   +R+     D+ +  L  + D +  I G  AG + ++ KPF+   L   ++ + +
Sbjct: 64  IEFARRLRKDETTADIPIIMLTAKGDEDNKIKGLEAGVDDYITKPFSPRELVARLKAVLR 123

Query: 120 M 120
            
Sbjct: 124 R 124


>gi|116627886|ref|YP_820505.1| DNA-binding response regulator [Streptococcus thermophilus LMD-9]
 gi|116101163|gb|ABJ66309.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Streptococcus thermophilus LMD-9]
 gi|312278467|gb|ADQ63124.1| Alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus thermophilus ND03]
          Length = 235

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E +  P+ +++D  +  + 
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKK-PDLVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   +   +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|332994441|gb|AEF04496.1| putative DNA-binding response regulator PhoB [Alteromonas sp. SN2]
          Length = 229

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+V+    +R++ + +    GF + EA     A+E    E  P+ +++D  + G   
Sbjct: 3   RTVLVVEDEAPIREMLKFVLEQSGFNIIEAEDYDIAQEKIC-EPYPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++Q     D+ V  L    + E  I G  AGA+ ++ KPF+ + L   ++ + +
Sbjct: 62  VQLAKSLKQHEFTRDIPVIMLTARGEEEDKIRGLDAGADDYVTKPFSPKELIARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|331656451|ref|ZP_08357413.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA206]
 gi|315299630|gb|EFU58878.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli MS 16-3]
 gi|331054699|gb|EGI26708.1| phosphate regulon transcriptional regulatory protein PhoB
           [Escherichia coli TA206]
          Length = 229

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 58/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYIIKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|168180586|ref|ZP_02615250.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum NCTC 2916]
 gi|226949883|ref|YP_002804974.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A2 str. Kyoto]
 gi|182668498|gb|EDT80477.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum NCTC 2916]
 gi|226840760|gb|ACO83426.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A2 str. Kyoto]
          Length = 232

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+ +L+VD    + ++ +    + G+    A +  EA     KE  P+ +++D  + G+ 
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYNCICALNGIEALNIA-KEEKPDLILLDLMLPGMD 61

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+        +  +  + +    + G   GA+ ++ KPF+   +   ++ + 
Sbjct: 62  GYEVCKEIRKDNNIATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVL 121

Query: 119 QMQ 121
           + +
Sbjct: 122 RRR 124


>gi|153940311|ref|YP_001391825.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum F str. Langeland]
 gi|152936207|gb|ABS41705.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum F str. Langeland]
 gi|295319851|gb|ADG00229.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum F str. 230613]
          Length = 232

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+ +L+VD    + ++ +    + G+    A +  EA     KE  P+ +++D  + G+ 
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYNCICALNGIEALNIA-KEEKPDLILLDLMLPGMD 61

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+        +  +  + +    + G   GA+ ++ KPF+   +   ++ + 
Sbjct: 62  GYEVCKEIRKDNNIATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVL 121

Query: 119 QMQ 121
           + +
Sbjct: 122 RRR 124


>gi|317481983|ref|ZP_07941008.1| response regulator receiver domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
 gi|316916550|gb|EFV37947.1| response regulator receiver domain-containing protein
           [Bifidobacterium sp. 12_1_47BFAA]
          Length = 296

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 63  MTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGID 121

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 122 GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVM 178

Query: 119 QMQKSKDE 126
           +  ++  +
Sbjct: 179 RRNQATAQ 186


>gi|37522238|ref|NP_925615.1| two-component response regulator [Gloeobacter violaceus PCC 7421]
 gi|35213238|dbj|BAC90610.1| two-component response regulator [Gloeobacter violaceus PCC 7421]
          Length = 245

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 53/120 (44%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   +E  P+ +V+D  M      
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEVFSREH-PDLVVLDVMMPKLDGY 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 70  GVCQELRKD---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126


>gi|254788364|ref|YP_003075793.1| phosphate regulon transcriptional regulator PhoB [Teredinibacter
           turnerae T7901]
 gi|237687065|gb|ACR14329.1| phosphate regulon transcriptional regulatory protein PhoB
           [Teredinibacter turnerae T7901]
          Length = 235

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 55/126 (43%), Gaps = 3/126 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R + R       + V EA    EA +    +  P+ +++D  M G   
Sbjct: 4   KKILVVDDERAIRDMLRVALEMADYAVLEAADAQEAHQIVV-DTRPDLILLDWMMPGVSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +EF   ++   +  ++ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IEFARRLKSQEVTREIPIIMLTAKGEEDNKIQGLEIGADDYITKPFSPRELVARLKAVLR 122

Query: 120 MQKSKD 125
              S  
Sbjct: 123 RSDSLS 128


>gi|206968679|ref|ZP_03229634.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Bacillus cereus AH1134]
 gi|229096888|ref|ZP_04227857.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock3-29]
 gi|229115876|ref|ZP_04245274.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock1-3]
 gi|229173099|ref|ZP_04300650.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus MM3]
 gi|229182148|ref|ZP_04309435.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus 172560W]
 gi|206735720|gb|EDZ52878.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Bacillus cereus AH1134]
 gi|228601322|gb|EEK58856.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus 172560W]
 gi|228610432|gb|EEK67703.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus MM3]
 gi|228667619|gb|EEL23063.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock1-3]
 gi|228686498|gb|EEL40407.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock3-29]
          Length = 237

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 51/121 (42%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+V+    +R+V +       + V+ A +  E  +       P+ +++D  M     
Sbjct: 3   KRILIVEDEENIREVCKRYLEREEYEVYTAVNGKEGWDLFLTH-QPDLIILDLMMPKKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +RQ    ++V +  L  + +    I G   GA+ +L KPF+   L   ++ + +
Sbjct: 62  WELCEEIRQQ---SNVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIILR 118

Query: 120 M 120
            
Sbjct: 119 R 119


>gi|239930403|ref|ZP_04687356.1| two-component systen response regulator [Streptomyces ghanaensis
           ATCC 14672]
 gi|291438761|ref|ZP_06578151.1| two-component system response regulator [Streptomyces ghanaensis
           ATCC 14672]
 gi|291341656|gb|EFE68612.1| two-component system response regulator [Streptomyces ghanaensis
           ATCC 14672]
          Length = 246

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A E       P+ LV+D  M  +  
Sbjct: 13  QRILIVDDEPAVREALQRSLAFEGYDTEVAVDGADALEKA-ASYRPDLLVLDIQMPRMDG 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 72  LTAARRIRSAGDTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 130


>gi|13324642|gb|AAK18824.1|AF327739_1 response regulator Rr1 [Streptococcus thermophilus]
          Length = 235

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E +  P+ +++D  +  + 
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKK-PDLVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                V+++   +   +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GL-EIVKEIRKTSHTPIIMLSAKDSEFDKVVGLEIGADDYVTKPFSNRELLARIKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|315641357|ref|ZP_07896433.1| DNA-binding response regulator [Enterococcus italicus DSM 15952]
 gi|315482930|gb|EFU73450.1| DNA-binding response regulator [Enterococcus italicus DSM 15952]
          Length = 234

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 52/120 (43%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +   +  G+ VF A    EA E   +E+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIVKFNLSKEGYEVFTAYDGEEALEKV-REVEPDLILLDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKTFDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118


>gi|261856844|ref|YP_003264127.1| PhoB family transcriptional regulator [Halothiobacillus
           neapolitanus c2]
 gi|261837313|gb|ACX97080.1| two component transcriptional regulator PhoB, winged helix family
           [Halothiobacillus neapolitanus c2]
          Length = 230

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 61/127 (48%), Gaps = 3/127 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+V+    +R++        G+ + EA+ V EA E      LP+ +++D  + G   
Sbjct: 4   KTILIVEDEKPIREMVTFALGRAGYDLIEASDVSEAFEQL-SHKLPDLVLLDWMLPGASG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +EF   +++  +  DV +  L    + E  ++G  AGA+ ++ KPF+   L   ++ + +
Sbjct: 63  IEFARRMKRDEITRDVPIVMLTARGEEEDKVSGLEAGADDYITKPFSPRELMARIKAVLR 122

Query: 120 MQKSKDE 126
                 E
Sbjct: 123 RASPDSE 129


>gi|118443576|ref|YP_877112.1| transcriptional regulator [Clostridium novyi NT]
 gi|118134032|gb|ABK61076.1| transcriptional regulatory protein [Clostridium novyi NT]
          Length = 228

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 52/128 (40%), Gaps = 6/128 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + ++ +      G+          A +    E  P+ +++D  +  +   
Sbjct: 7   KILIVDDDENICEIIKMYLESSGYSTECCYDGKSA-QTAFYEYKPDLVLLDVMLPHMDGI 65

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+     +  V  L  + +    +     GA+ +++KPF  + L   ++ + + 
Sbjct: 66  DVLKWIRKE---CETPVIMLTAKGETFDKVLALELGADDYIVKPFEPKELIARIKAVLRR 122

Query: 121 QKSKDENQ 128
              ++E++
Sbjct: 123 YNVENEDK 130


>gi|262276591|ref|ZP_06054400.1| phosphate regulon transcriptional regulatory protein PhoB
           [Grimontia hollisae CIP 101886]
 gi|262220399|gb|EEY71715.1| phosphate regulon transcriptional regulatory protein PhoB
           [Grimontia hollisae CIP 101886]
          Length = 229

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A E    E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSALEKIC-EPYPELILMDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  L   + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDELTRQIPIVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|312793633|ref|YP_004026556.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor kristjanssonii 177R1B]
 gi|312875870|ref|ZP_07735860.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|311797351|gb|EFR13690.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor lactoaceticus 6A]
 gi|312180773|gb|ADQ40943.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor kristjanssonii 177R1B]
          Length = 223

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 57/126 (45%), Gaps = 7/126 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D    + +V +      GF V  A +  +      K  +P+ +++D  +    
Sbjct: 1   MK-ILVIDDDVKICEVIKLYLEKEGFEVVVAHNGMDGIAMF-KNEMPDLVILDIMLPKKD 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R++   +++ +  L  + +    + G   GA+ +++KPF+ + L   ++ + 
Sbjct: 59  GYEVCRELRKI---SNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVL 115

Query: 119 QMQKSK 124
           +  + +
Sbjct: 116 RRTQGE 121


>gi|223938177|ref|ZP_03630074.1| multi-sensor signal transduction histidine kinase [bacterium
           Ellin514]
 gi|223893221|gb|EEF59685.1| multi-sensor signal transduction histidine kinase [bacterium
           Ellin514]
          Length = 1139

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 46/126 (36%), Gaps = 4/126 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LL D +  +R     L     + V        A +   K   P+ ++ D  M      
Sbjct: 645 RILLADDNADMRDYVMRLLKGS-YRVEAVADGEAALKAALKHP-PDLILSDIMMPRLDGF 702

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  VR  P    + V  L      E  + G   GA+ +L KPF+   L   +R   +M
Sbjct: 703 GLLREVRNNPSTRLIPVILLSARAGEESRVEGLGHGADDYLTKPFSAHELLARVRSHLRM 762

Query: 121 QKSKDE 126
            + + E
Sbjct: 763 ARLRQE 768


>gi|315158433|gb|EFU02450.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0312]
          Length = 234

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    + ++ ++     G+ VF A    EA E  E E+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPILEIVKYNLVKEGYEVFTAYDGEEALEKVE-EVEPDLIILDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKTHDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118


>gi|166032814|ref|ZP_02235643.1| hypothetical protein DORFOR_02529 [Dorea formicigenerans ATCC
           27755]
 gi|166027171|gb|EDR45928.1| hypothetical protein DORFOR_02529 [Dorea formicigenerans ATCC
           27755]
          Length = 235

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 53/132 (40%), Gaps = 5/132 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    +RK+ +      G+ V EA    EA E    E     +++D  M  +   
Sbjct: 15  KILVVDDESRMRKLVKDFLEREGYQVLEAGDGLEAMEAFYAEKDIALIILDVMMPKMDGW 74

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ      V +  L    D    + G   G + ++ KPF+ + L   +  L + 
Sbjct: 75  QTCREIRQSSK---VPIIMLTARGDERDELQGFDLGVDEYISKPFSPKILVARVNALLRR 131

Query: 121 QKSKDENQFLDA 132
               D ++ ++A
Sbjct: 132 SNVLDADEHVEA 143


>gi|88858377|ref|ZP_01133019.1| phosphate regulon transcriptional regulatory protein phoB
           [Pseudoalteromonas tunicata D2]
 gi|88819994|gb|EAR29807.1| phosphate regulon transcriptional regulatory protein phoB
           [Pseudoalteromonas tunicata D2]
          Length = 229

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 52/132 (39%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVDDEAPIREMLVFVLEQNGFQAIEAEDYDSAIASLM-EPYPDMILLDWMLPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQIAKKIKQSEYTRHIPIIMLTARGEEEDKVKGLEVGADDYVTKPFSPKELMARIKAVIR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RVSPTSLEEAIE 133


>gi|89897369|ref|YP_520856.1| hypothetical protein DSY4623 [Desulfitobacterium hafniense Y51]
 gi|89336817|dbj|BAE86412.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 227

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 58/132 (43%), Gaps = 7/132 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++ R      G+ + EA +   A E   K+   + +++D  M G+ 
Sbjct: 1   MK-ILVVDDDERIREIVRLYLEAEGYDIEEADNGNSALEKVRKDS-FDLVILDLMMPGLD 58

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      + +  L  + +    + G   GA+ +++KPF+   L   ++ + 
Sbjct: 59  GWTVCKVLRKETK---IPIIMLTAKGEENDRVLGFDLGADDYVVKPFSPRELSARVKAVL 115

Query: 119 QMQKSKDENQFL 130
           +  + +   + L
Sbjct: 116 RRLEGEPTKEHL 127


>gi|15616589|ref|NP_244895.1| two-component response regulator [Bacillus halodurans C-125]
 gi|10176652|dbj|BAB07746.1| two-component response regulator [Bacillus halodurans C-125]
          Length = 236

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/130 (19%), Positives = 53/130 (40%), Gaps = 6/130 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      GF V  A    EA E   +E  P+ +++D  +     
Sbjct: 4   KKILVVDDEKPIADILKFNLEKEGFTVICAYDGAEAVEQVNQEK-PDLILLDIMLPNKDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 63  MEVCREVRKQFE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 119

Query: 120 MQKSKDENQF 129
             ++  ++Q 
Sbjct: 120 RHQTSGDDQL 129


>gi|225174148|ref|ZP_03728147.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
 gi|225169933|gb|EEG78728.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
          Length = 231

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 54/125 (43%), Gaps = 6/125 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
           +L+VD    +R++ R      GF V  A    EA +   K   P  +++D  +  +    
Sbjct: 6   ILIVDDEEHIRELVRLYLEKEGFTVALAADGEEAVQKA-KSTTPQLIILDLMLPKLDGWD 64

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               VR+    ++V +  L  + +    + G   GA+ +L KPF+   L   ++ + +  
Sbjct: 65  VCREVRK---FSEVPIIMLTAKGEEFDKVLGLELGADDYLTKPFSPRELVARVKAILRRA 121

Query: 122 KSKDE 126
             +++
Sbjct: 122 TPEEQ 126


>gi|71282474|ref|YP_267951.1| phosphate regulon response regulator PhoB [Colwellia
           psychrerythraea 34H]
 gi|71148214|gb|AAZ28687.1| phosphate regulon response regulator PhoB [Colwellia
           psychrerythraea 34H]
          Length = 233

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   + +  GF   EA  + +A      E  P+ +++D  + G   
Sbjct: 3   RKILVVEDETPIREMISFVLDQNGFNAIEACDIEQALAKI-HEPYPDLILLDWMLPGGTG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++Q     ++ +  L    D +  + G  AG + F+ KPF+ + L   ++ + +
Sbjct: 62  VSLAKKLKQNEYTRNIPIIMLTARSDEDDKVKGFEAGVDDFVTKPFSPKELIARIKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|54307916|ref|YP_128936.1| putative DNA-binding response regulator PhoB [Photobacterium
           profundum SS9]
 gi|46912342|emb|CAG19134.1| putative DNA-binding response regulator PhoB [Photobacterium
           profundum SS9]
          Length = 229

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA    +A E    E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQPIEAEDYDDALEKIC-EPYPELILMDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  L   + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|89072663|ref|ZP_01159228.1| putative DNA-binding response regulator PhoB [Photobacterium sp.
           SKA34]
 gi|89051483|gb|EAR56937.1| putative DNA-binding response regulator PhoB [Photobacterium sp.
           SKA34]
          Length = 229

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A E    E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAIEAEDYDTALEKMC-EPYPELILMDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  L   + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|269103311|ref|ZP_06156008.1| phosphate regulon transcriptional regulatory protein PhoB
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163209|gb|EEZ41705.1| phosphate regulon transcriptional regulatory protein PhoB
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 229

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A E    E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQPIEAEDYDSALEKIC-EPYPELILMDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  L   + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|229133940|ref|ZP_04262762.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus BDRD-ST196]
 gi|228649500|gb|EEL05513.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus BDRD-ST196]
          Length = 237

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 51/121 (42%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+V+    +R+V +       + V+ A +  E  +       P+ +++D  M     
Sbjct: 3   KRILIVEDEENIREVCKRYLEREEYEVYTAVNGKEGWDLFLTH-QPDLIILDLMMPKKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +RQ    ++V +  L  + +    I G   GA+ +L KPF+   L   ++ + +
Sbjct: 62  WELCEEIRQQ---SNVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIILR 118

Query: 120 M 120
            
Sbjct: 119 R 119


>gi|55823082|ref|YP_141523.1| response regulator [Streptococcus thermophilus CNRZ1066]
 gi|55739067|gb|AAV62708.1| response regulator (homolog to RR02/MicA Spn & RR02 Sth &VicR Spy)
           [Streptococcus thermophilus CNRZ1066]
          Length = 235

 Score =  154 bits (392), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E +  P+ +++D  +  + 
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKK-PDLVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                V+++   +   +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GL-EIVKEIRKTSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|318081143|ref|ZP_07988475.1| two-component system response regulator [Streptomyces sp. SA3_actF]
          Length = 327

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 43/119 (36%), Gaps = 2/119 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    V +V        G  V  A     A         P+ +V+D  + G+    
Sbjct: 19  VLVVDDDPTVAEVVAGYLLRAGCTVDRAGDGPSALARAHTH-RPDLVVLDLMLPGMDGLE 77

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              R       V V  L    D +  I G   GA+ ++ KPF+   L   +  + +  +
Sbjct: 78  VCRRMRERHP-VPVIMLTARGDEDDRILGLERGADDYVTKPFSPRELVLRVESVLRRTR 135


>gi|309789878|ref|ZP_07684456.1| two component transcriptional regulator, winged helix family
           [Oscillochloris trichoides DG6]
 gi|308228085|gb|EFO81735.1| two component transcriptional regulator, winged helix family
           [Oscillochloris trichoides DG6]
          Length = 231

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 31/137 (22%), Positives = 61/137 (44%), Gaps = 9/137 (6%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+V+    + +  R+     G+ V  A+   +  E   +E  P+ +V+D  +  + 
Sbjct: 1   MPTILIVEDERTLAETLRYNLEREGYTVVVASDGVQGLEQARREP-PDLIVLDIMLPRLD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +RQ    +DV +  L    D    IAG   GA+ ++ KPF+       +R + 
Sbjct: 60  GFSVCRILRQE---SDVPIIMLTARQDEVDRIAGLELGADDYISKPFSLGEFLARIRAIM 116

Query: 119 QMQKSK---DENQFLDA 132
           +  + +    E + L+A
Sbjct: 117 RRSERQPRTSEREVLNA 133


>gi|300715551|ref|YP_003740354.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia billingiae Eb661]
 gi|299061387|emb|CAX58497.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia billingiae Eb661]
          Length = 229

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAVNLLI-EPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|298246544|ref|ZP_06970350.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
 gi|297554025|gb|EFH87890.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
          Length = 244

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 47/121 (38%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD   ++ +   +     G+ V  A     A +    E  P+ +V+D  + G+  
Sbjct: 3   RKILVVDDEAVLAETIAYNLEQAGYHVITAADGNSALDAARSE-RPDLIVLDIMLPGMDG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+        +  L    D    + G   GA+ ++ KPF R  L   +R L +
Sbjct: 62  LEVCRQLRRENKTATTPILMLTARGDEIDKVVGLEVGADDYVTKPFGRRELLARVRALIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|170756077|ref|YP_001782072.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum B1 str. Okra]
 gi|169121289|gb|ACA45125.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum B1 str. Okra]
          Length = 232

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+ +L+VD    + ++ +    + G+    A +  EA     KE  P+ +++D  + G+ 
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYNCICALNGIEALNIA-KEEKPDLILLDLMLPGMD 61

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+        +  +  + +    + G   GA+ ++ KPF+   +   ++ + 
Sbjct: 62  GYEVCKEIRKDNNIATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMIARVKAVL 121

Query: 119 QMQ 121
           + +
Sbjct: 122 RRR 124


>gi|284929471|ref|YP_003421993.1| winged helix family two component transcriptional regulator
           [cyanobacterium UCYN-A]
 gi|284809915|gb|ADB95612.1| two component transcriptional regulator, winged helix family
           [cyanobacterium UCYN-A]
          Length = 243

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E    + +P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEIFY-DSVPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|153834652|ref|ZP_01987319.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           harveyi HY01]
 gi|156973339|ref|YP_001444246.1| response regulator [Vibrio harveyi ATCC BAA-1116]
 gi|269962450|ref|ZP_06176800.1| DNA-binding response regulator PhoB [Vibrio harveyi 1DA3]
 gi|148868964|gb|EDL68018.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           harveyi HY01]
 gi|156524933|gb|ABU70019.1| hypothetical protein VIBHAR_01026 [Vibrio harveyi ATCC BAA-1116]
 gi|269832946|gb|EEZ87055.1| DNA-binding response regulator PhoB [Vibrio harveyi 1DA3]
          Length = 229

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|257440003|ref|ZP_05615758.1| two-component response regulator [Faecalibacterium prausnitzii
           A2-165]
 gi|257197551|gb|EEU95835.1| two-component response regulator [Faecalibacterium prausnitzii
           A2-165]
          Length = 299

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 47/126 (37%), Gaps = 1/126 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++ R      G++  EA     A          + +++D  M  + 
Sbjct: 72  MAKILIVDDEPRIRELIREHLQYAGYVCEEAGDGSAALSLL-SGGGFDLVILDVMMPFMD 130

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                        +  V  L    +    +AG   GA+ +++KPF+   L   ++ +   
Sbjct: 131 GMTCLREMRARHINTPVIILTARGEEYDKLAGLEGGADDYVVKPFSPRELVARVKAVLNR 190

Query: 121 QKSKDE 126
              + E
Sbjct: 191 TMPRSE 196


>gi|291619427|ref|YP_003522169.1| CpxR [Pantoea ananatis LMG 20103]
 gi|291154457|gb|ADD79041.1| CpxR [Pantoea ananatis LMG 20103]
          Length = 267

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 52/131 (39%), Gaps = 7/131 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M+ +LLVD    +  + + L    GF V  A+   +A      +   + L++D  M    
Sbjct: 36  MNKILLVDDDRELTSLLKELLEMEGFEVVVASDGEQALNLL--DNSIDLLLLDVMMPKKN 93

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++ +  +RQ        V  L         + G   GA+ +L KPFN   L   +R + 
Sbjct: 94  GIDTLKELRQQ---YQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAIL 150

Query: 119 QMQKSKDENQF 129
           +     ++ Q 
Sbjct: 151 RRSNWSEQQQQ 161


>gi|229000526|ref|ZP_04160071.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock3-17]
 gi|229007908|ref|ZP_04165478.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock1-4]
 gi|228753336|gb|EEM02804.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock1-4]
 gi|228759238|gb|EEM08239.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock3-17]
          Length = 248

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 58/138 (42%), Gaps = 9/138 (6%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME-- 57
           M   +L+++    +R+V +      G+ V+ A +  E  +       P+ +++D  M   
Sbjct: 9   MKQRILIIEDEENIREVCKRYLEREGYEVYTAMNGMEGWDLFLTH-QPDLILLDLMMPKK 67

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              E    +RQ    ++V +  L  + +    I G   GA+ ++ KPF+   L   ++ +
Sbjct: 68  DGWELCEEIRQQ---SNVPIIMLTAKGEERDRILGLTIGADDYVTKPFSPRELVLRVQII 124

Query: 118 PQMQKS--KDENQFLDAI 133
            +        E +FL  +
Sbjct: 125 LKRGNQIPIQEEEFLSEV 142


>gi|55821169|ref|YP_139611.1| response regulator [Streptococcus thermophilus LMG 18311]
 gi|55737154|gb|AAV60796.1| response regulator (homolog to RR02/MicA Spn & RR02 Sth &VicR Spy)
           [Streptococcus thermophilus LMG 18311]
          Length = 235

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E +  P+ +++D  +  + 
Sbjct: 1   MKKILVVDDERPISDIIKFNLTKEGYEVVTAFDGREALEQFEAKK-PDLVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   +   +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHTPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARIKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|255326659|ref|ZP_05367735.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Rothia mucilaginosa ATCC 25296]
 gi|283457339|ref|YP_003361914.1| response regulator [Rothia mucilaginosa DY-18]
 gi|255295876|gb|EET75217.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Rothia mucilaginosa ATCC 25296]
 gi|283133329|dbj|BAI64094.1| response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Rothia mucilaginosa
           DY-18]
          Length = 234

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 55/125 (44%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    + ++        GF V  A +  EA E    E  P+ +V+D  M G+  F
Sbjct: 6   KLLVVDDEFNILELLATSLRFAGFEVVTAGNGREALEKAHAEN-PDLIVLDVMMPGMDGF 64

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    GT   V +L  +   E  + G  AG + ++ KPF+ + +   +R + +  +
Sbjct: 65  EVTRRLRENGTTTPVLFLTAKDATEDKVTGLGAGGDDYVTKPFSLDEVIARIRAILRRSR 124

Query: 123 SKDEN 127
           S  E 
Sbjct: 125 SVQEE 129


>gi|74316234|ref|YP_313974.1| two component transcriptional regulator [Thiobacillus denitrificans
           ATCC 25259]
 gi|74055729|gb|AAZ96169.1| Two component Transcriptional regulator, Winged helix family
           [Thiobacillus denitrificans ATCC 25259]
          Length = 230

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 22/131 (16%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++LLV+    ++++ +      G  V  A     A     K  LP+ +++D  + G+  +
Sbjct: 4   NILLVEDEPGIQELLKFNLTQAGHQVTAAGDAEHAL-KFLKTTLPDVILLDWMLPGMSGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           +    +R       V +  L    +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DLCRRLRGDARYQPVPIIMLTARGEERDKVLGLDTGADDYITKPFSPRELVSRIKAVLRR 122

Query: 121 QKSKDENQFLD 131
           +  +   + ++
Sbjct: 123 RAPQMTEEAVE 133


>gi|320332849|ref|YP_004169560.1| winged helix family two component transcriptional regulator
           [Deinococcus maricopensis DSM 21211]
 gi|319754138|gb|ADV65895.1| two component transcriptional regulator, winged helix family
           [Deinococcus maricopensis DSM 21211]
          Length = 227

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+V+ +  +R++ R    + G+ V  A++  E      +   P+ +++D  M G+ 
Sbjct: 1   MKTILVVEDNAGIREMVREYLAEHGYRVRVASNGVEGL-LETRHHPPDLILLDVMMPGMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+        V +L         + G   GA+ +L KPF+   L   +R L + 
Sbjct: 60  GL-EFLRKYRADAGTPVMFLTARDAELDKVLGLELGADDYLTKPFSMAELLARIRALLRR 118


>gi|28897343|ref|NP_796948.1| DNA-binding response regulator PhoB [Vibrio parahaemolyticus RIMD
           2210633]
 gi|153838075|ref|ZP_01990742.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AQ3810]
 gi|260364511|ref|ZP_05777132.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus K5030]
 gi|260876305|ref|ZP_05888660.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AN-5034]
 gi|260898576|ref|ZP_05907072.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus Peru-466]
 gi|260903268|ref|ZP_05911663.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AQ4037]
 gi|28805552|dbj|BAC58832.1| DNA-binding response regulator PhoB [Vibrio parahaemolyticus RIMD
           2210633]
 gi|149748542|gb|EDM59401.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AQ3810]
 gi|308086888|gb|EFO36583.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus Peru-466]
 gi|308092989|gb|EFO42684.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AN-5034]
 gi|308107972|gb|EFO45512.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus AQ4037]
 gi|308114699|gb|EFO52239.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus K5030]
 gi|328472632|gb|EGF43495.1| DNA-binding response regulator PhoB [Vibrio parahaemolyticus 10329]
          Length = 229

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDTAVTKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|212640658|ref|YP_002317178.1| OmpR family DNA-binding response regulator [Anoxybacillus
           flavithermus WK1]
 gi|212562138|gb|ACJ35193.1| DNA-binding response regulator, OmpR family (REC-wHTH domains)
           [Anoxybacillus flavithermus WK1]
          Length = 236

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 53/128 (41%), Gaps = 6/128 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V  A    EA +  E ++ P+ +++D  +     
Sbjct: 5   KKILVVDDEKPIADILQFNLRKEGYDVHCAYDGVEALQKVE-DIQPDLILLDIMLPQKDG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +R+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 64  MEVCREIRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 120

Query: 120 MQKSKDEN 127
             + + E 
Sbjct: 121 RHQQRQEQ 128


>gi|229102995|ref|ZP_04233684.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock3-28]
 gi|228680410|gb|EEL34598.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock3-28]
          Length = 237

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 27/137 (19%), Positives = 56/137 (40%), Gaps = 9/137 (6%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+V+    +R+V +       + V+ A +  E  +       P+ +++D  M     
Sbjct: 3   KRILIVEDEENIREVCKRYLEREEYEVYTAVNGREGWDLFLTH-RPDLIILDLMMPKKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +RQ    ++V +  L  + +    I G   GA+ +L KPF+   L   ++ + +
Sbjct: 62  WELCEEIRQQ---SNVPIIMLTAKGEERDRILGLTMGADDYLTKPFSPRELVLRVQIILR 118

Query: 120 MQK---SKDENQFLDAI 133
                  + E   L+ I
Sbjct: 119 RGSHVPIQAEESLLEVI 135


>gi|220906550|ref|YP_002481861.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 7425]
 gi|219863161|gb|ACL43500.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7425]
          Length = 243

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 55/122 (45%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   +E +P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYNVVTAADGEEALETF-REEVPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|90414588|ref|ZP_01222561.1| putative DNA-binding response regulator PhoB [Photobacterium
           profundum 3TCK]
 gi|90324304|gb|EAS40873.1| putative DNA-binding response regulator PhoB [Photobacterium
           profundum 3TCK]
          Length = 229

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA    +A E    E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQPIEAEDYDDALEKIC-EPYPELILMDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  L   + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|270263528|ref|ZP_06191797.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
 gi|270042412|gb|EFA15507.1| transcriptional regulatory protein [Serratia odorifera 4Rx13]
          Length = 229

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|52144036|ref|YP_082792.1| response regulator [Bacillus cereus E33L]
 gi|118476873|ref|YP_894024.1| response regulator [Bacillus thuringiensis str. Al Hakam]
 gi|196035354|ref|ZP_03102759.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196040638|ref|ZP_03107937.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|196046479|ref|ZP_03113704.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|218902506|ref|YP_002450340.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|225863261|ref|YP_002748639.1| DNA-binding response regulator [Bacillus cereus 03BB102]
 gi|254726203|ref|ZP_05187985.1| DNA-binding response regulator [Bacillus anthracis str. A1055]
 gi|51977505|gb|AAU19055.1| response regulator [Bacillus cereus E33L]
 gi|118416098|gb|ABK84517.1| response regulator [Bacillus thuringiensis str. Al Hakam]
 gi|195992031|gb|EDX55994.1| DNA-binding response regulator [Bacillus cereus W]
 gi|196022663|gb|EDX61345.1| DNA-binding response regulator [Bacillus cereus 03BB108]
 gi|196028428|gb|EDX67036.1| DNA-binding response regulator [Bacillus cereus NVH0597-99]
 gi|218538516|gb|ACK90914.1| DNA-binding response regulator [Bacillus cereus AH820]
 gi|225785753|gb|ACO25970.1| DNA-binding response regulator [Bacillus cereus 03BB102]
          Length = 223

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEIQ 131


>gi|30261401|ref|NP_843778.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|47526577|ref|YP_017926.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49184231|ref|YP_027483.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|65318666|ref|ZP_00391625.1| COG0745: Response regulators consisting of a CheY-like receiver
           domain and a winged-helix DNA-binding domain [Bacillus
           anthracis str. A2012]
 gi|167634425|ref|ZP_02392746.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|167639277|ref|ZP_02397549.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|170686885|ref|ZP_02878105.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|170706300|ref|ZP_02896761.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|177651390|ref|ZP_02934179.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|227815860|ref|YP_002815869.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|229604024|ref|YP_002865817.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
 gi|254682541|ref|ZP_05146402.1| DNA-binding response regulator [Bacillus anthracis str. CNEVA-9066]
 gi|254733959|ref|ZP_05191673.1| DNA-binding response regulator [Bacillus anthracis str. Western
           North America USA6153]
 gi|254740353|ref|ZP_05198044.1| DNA-binding response regulator [Bacillus anthracis str. Kruger B]
 gi|254753741|ref|ZP_05205776.1| DNA-binding response regulator [Bacillus anthracis str. Vollum]
 gi|254758837|ref|ZP_05210864.1| DNA-binding response regulator [Bacillus anthracis str. Australia
           94]
 gi|30255255|gb|AAP25264.1| DNA-binding response regulator [Bacillus anthracis str. Ames]
 gi|47501725|gb|AAT30401.1| DNA-binding response regulator [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|49178158|gb|AAT53534.1| DNA-binding response regulator [Bacillus anthracis str. Sterne]
 gi|167512716|gb|EDR88090.1| DNA-binding response regulator [Bacillus anthracis str. A0193]
 gi|167530313|gb|EDR93039.1| DNA-binding response regulator [Bacillus anthracis str. A0442]
 gi|170128834|gb|EDS97700.1| DNA-binding response regulator [Bacillus anthracis str. A0389]
 gi|170669408|gb|EDT20151.1| DNA-binding response regulator [Bacillus anthracis str. A0465]
 gi|172082668|gb|EDT67731.1| DNA-binding response regulator [Bacillus anthracis str. A0174]
 gi|227002678|gb|ACP12421.1| DNA-binding response regulator [Bacillus anthracis str. CDC 684]
 gi|229268432|gb|ACQ50069.1| DNA-binding response regulator [Bacillus anthracis str. A0248]
          Length = 223

 Score =  154 bits (391), Expect = 3e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEIQ 131


>gi|226357509|ref|YP_002787249.1| response regulator, CheY [Deinococcus deserti VCD115]
 gi|226319500|gb|ACO47495.1| putative response regulator, CheY [Deinococcus deserti VCD115]
          Length = 227

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 51/120 (42%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+V+ +  VR + R    + G+ V  A++  E      +   P+ +++D  M G+ 
Sbjct: 1   MKTILIVEDNPGVRDMVREYLQEHGYRVRVASNGHEGL-LEVRHHRPDLVLLDMMMPGMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+        V +L         + G   GA+ ++ KPF+   L   +R   + 
Sbjct: 60  GL-EFLRRFRAAEHAPVVFLTARDAELDKVLGLELGADDYVTKPFSMAELLARVRAHLRR 118


>gi|186683435|ref|YP_001866631.1| two component transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186465887|gb|ACC81688.1| two component transcriptional regulator, winged helix family
           [Nostoc punctiforme PCC 73102]
          Length = 247

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 54/121 (44%), Gaps = 6/121 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++ +      G+ V  A+   EA     +E  P+ +V+D  M      
Sbjct: 10  TILVVDDEASIRRILQTRLEMIGYHVVTASDGEEALSAWSRET-PDLIVLDVMMPKLDGY 68

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +  L + 
Sbjct: 69  GVCLELRKQ---SDVPIIMLTALADVADRITGLELGADDYMIKPFSPKELEARIASLLRR 125

Query: 121 Q 121
           +
Sbjct: 126 R 126


>gi|224367365|ref|YP_002601528.1| two-component DNA-binding response regulator [Desulfobacterium
           autotrophicum HRM2]
 gi|223690081|gb|ACN13364.1| two-component DNA-binding response regulator [Desulfobacterium
           autotrophicum HRM2]
          Length = 233

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++ R      G+    A S  EA    ++E +P+ +V+D  + G+  F
Sbjct: 5   KILIVDDERDIVELVRFNLKREGYHTLVAFSGEEALSMAKRE-MPDLVVLDLMLPGIDGF 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R   +  ++ +  L  + +   ++ G   GAN ++ KPF+   L   +R + + 
Sbjct: 64  EVTRRIRGNAVTVEIPIVMLTAKGEESDIVTGLEIGANDYISKPFSPRELVARIRGILRR 123

Query: 121 Q 121
           +
Sbjct: 124 R 124


>gi|254506701|ref|ZP_05118841.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus 16]
 gi|323499854|ref|ZP_08104813.1| response regulator [Vibrio sinaloensis DSM 21326]
 gi|219550282|gb|EED27267.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           parahaemolyticus 16]
 gi|323315095|gb|EGA68147.1| response regulator [Vibrio sinaloensis DSM 21326]
          Length = 229

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|163802439|ref|ZP_02196332.1| recombination associated protein [Vibrio sp. AND4]
 gi|159173740|gb|EDP58555.1| recombination associated protein [Vibrio sp. AND4]
          Length = 229

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAVTKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INFIKHMKREELTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|146297008|ref|YP_001180779.1| two component transcriptional regulator [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410584|gb|ABP67588.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 223

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 57/126 (45%), Gaps = 7/126 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D    + +V +      GF V  A +  +      K  +P+ +++D  +    
Sbjct: 1   MK-ILVIDDDVKICEVIKLYLEKEGFEVIIAHNGSDGITMF-KHEMPDLVILDIMLPKKD 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R++   +++ +  L  + +    + G   GA+ +++KPF+ + L   ++ + 
Sbjct: 59  GYEVCREIRKI---SNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVL 115

Query: 119 QMQKSK 124
           +  + +
Sbjct: 116 RRTQGE 121


>gi|226310588|ref|YP_002770482.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226093536|dbj|BAH41978.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 239

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 57/129 (44%), Gaps = 6/129 (4%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M   +L+VD +  + ++   +  + GF V  A S  +A     +   PN +++D  M  +
Sbjct: 1   MKDHILIVDDNLEIIELLEDILENEGFSVSSAESGEDALSLLSQGERPNLILLDIMMPNM 60

Query: 60  --LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              E  + +R+     D+ + +L  +      + G   GA+ ++ KPF+ E L   +R  
Sbjct: 61  SGYELCSQIRRE---WDLPILFLSAKGKAVDKVVGFEIGADDYITKPFDTEELLARIRAH 117

Query: 118 PQMQKSKDE 126
            +  +   +
Sbjct: 118 LRRYERIRK 126


>gi|239916919|ref|YP_002956477.1| PhoP-like protein [Micrococcus luteus NCTC 2665]
 gi|281414626|ref|ZP_06246368.1| PhoP-like protein [Micrococcus luteus NCTC 2665]
 gi|289706878|ref|ZP_06503219.1| response regulator receiver domain protein [Micrococcus luteus
           SK58]
 gi|239838126|gb|ACS29923.1| PhoP-like protein [Micrococcus luteus NCTC 2665]
 gi|289556428|gb|EFD49778.1| response regulator receiver domain protein [Micrococcus luteus
           SK58]
          Length = 226

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+          +L    GF V  A    EA    E++   + +++D  + G+ 
Sbjct: 1   MSRILIVEDEESFSDPLSYLLEKEGFEVTVAADGNEALSVFERDSA-DLILLDLMLPGMS 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  VRQ    ++V V  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTEVCRQVRQR---SNVPVIMLTAKDSEIDKVVGLELGADDYVTKPYSSRELVARVRAVL 116

Query: 119 QMQKSKDE 126
           + Q  ++E
Sbjct: 117 RRQGEQEE 124


>gi|37527767|ref|NP_931112.1| phosphate regulon transcriptional regulatory protein [Photorhabdus
           luminescens subsp. laumondii TTO1]
 gi|36787203|emb|CAE16283.1| phosphate regulon transcriptional regulatory protein [Photorhabdus
           luminescens subsp. laumondii TTO1]
          Length = 229

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A   C  E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEKNGYQPVEAEDYDSAL-ACLSEPYPDLVLLDWMLPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I  +++     D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQIIKQMKRNNNIRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARVKAVLR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|323699409|ref|ZP_08111321.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio sp. ND132]
 gi|323459341|gb|EGB15206.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio desulfuricans ND132]
          Length = 228

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 52/128 (40%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+V+     R++ ++     GF V  A               P+ +++D  M G   
Sbjct: 4   QKILVVEDHRDTRELLKYNLTAAGFDVAAAEDGQLGLNLAHA-FKPDIILLDLMMPGTDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    ++  P    + V  L  + +    I G   GA+ +++KPF+   L   ++ + +
Sbjct: 63  LEVCRQLKGDPATARIPVIMLTAKGEEVDKIVGLELGADDYVVKPFSPRELVLRIKAILR 122

Query: 120 MQKSKDEN 127
              + + N
Sbjct: 123 RYGAPEPN 130


>gi|254555220|ref|YP_003061637.1| response regulator [Lactobacillus plantarum JDM1]
 gi|300769135|ref|ZP_07079024.1| response regulator [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308179221|ref|YP_003923349.1| response regulator [Lactobacillus plantarum subsp. plantarum
           ST-III]
 gi|254044147|gb|ACT60940.1| response regulator [Lactobacillus plantarum JDM1]
 gi|300493375|gb|EFK28554.1| response regulator [Lactobacillus plantarum subsp. plantarum ATCC
           14917]
 gi|308044712|gb|ADN97255.1| response regulator [Lactobacillus plantarum subsp. plantarum
           ST-III]
          Length = 235

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 52/123 (42%), Gaps = 2/123 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA +  + E+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIMKFNLTKEGYEVHVAADGEEALQKVD-EVHPDLILLDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 RQ+    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-RQVRKNYDMPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118

Query: 121 QKS 123
           Q +
Sbjct: 119 QGA 121


>gi|271499555|ref|YP_003332580.1| winged helix family two component transcriptional regulator
           [Dickeya dadantii Ech586]
 gi|270343110|gb|ACZ75875.1| two component transcriptional regulator, winged helix family
           [Dickeya dadantii Ech586]
          Length = 229

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPVEAEDYDSAVNRL-AEPYPELVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|222099706|ref|YP_002534274.1| Response regulator DrrA [Thermotoga neapolitana DSM 4359]
 gi|221572096|gb|ACM22908.1| Response regulator DrrA [Thermotoga neapolitana DSM 4359]
          Length = 251

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + ++  +     G+ V +A    EA +   +E + +  ++D  + G+  
Sbjct: 16  KKILVVDDDPAILELVGYNLAKEGYDVLKAYDGEEALKLANEEDV-DMFIVDIMLPGMDG 74

Query: 62  FI--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R M    +  V +L  + +    + G   GA+ ++ KPF+   L   ++ + +
Sbjct: 75  FELVRKIRSMEKYRNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFR 134

Query: 120 M 120
            
Sbjct: 135 R 135


>gi|218896331|ref|YP_002444742.1| DNA-binding response regulator [Bacillus cereus G9842]
 gi|218540658|gb|ACK93052.1| DNA-binding response regulator [Bacillus cereus G9842]
          Length = 223

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEIQ 131


>gi|213498008|emb|CAR92187.1| PhoB protein [Serratia sp. ATCC 39006]
          Length = 229

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPVEAEDYDSAINQL-TEPYPELVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHMKRETLTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                  ++ ++
Sbjct: 122 RISPMAVDEVIE 133


>gi|330998526|ref|ZP_08322347.1| response regulator receiver domain protein [Paraprevotella
            xylaniphila YIT 11841]
 gi|329568257|gb|EGG50073.1| response regulator receiver domain protein [Paraprevotella
            xylaniphila YIT 11841]
          Length = 1341

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 56/131 (42%), Gaps = 4/131 (3%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+LLVD +  + ++   +     + V  A +  EA E  +   + + +V D  M G+  F
Sbjct: 1093 SILLVDDNTQLLEMMEKILATK-YRVLTAENGLEALEQLKASAV-DLIVSDVMMPGMDGF 1150

Query: 63   --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 ++     + + V  L  +   +  +    AGA+ +L KPF  + L   +  L   
Sbjct: 1151 ALCRKLKSQLETSHIPVIMLTAKQSADDRVDCYEAGADGYLAKPFELKVLAARIDNLLHT 1210

Query: 121  QKSKDENQFLD 131
             +++ +   ++
Sbjct: 1211 YRNRQQAFRME 1221


>gi|188534673|ref|YP_001908470.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia tasmaniensis Et1/99]
 gi|188029715|emb|CAO97594.1| Response regulator in two-component regulatory system with PhoR
           [Erwinia tasmaniensis Et1/99]
          Length = 229

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQNDYHPIEAADYDSAVSLLI-EPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|30019451|ref|NP_831082.1| two-component response regulator [Bacillus cereus ATCC 14579]
 gi|218236073|ref|YP_002366082.1| DNA-binding response regulator [Bacillus cereus B4264]
 gi|29894995|gb|AAP08283.1| Two-component response regulator [Bacillus cereus ATCC 14579]
 gi|218164030|gb|ACK64022.1| DNA-binding response regulator [Bacillus cereus B4264]
 gi|326939022|gb|AEA14918.1| two-component response regulator [Bacillus thuringiensis serovar
           chinensis CT-43]
          Length = 223

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEIQ 131


>gi|282601102|ref|ZP_05980740.2| DNA-binding response regulator ResD [Subdoligranulum variabile DSM
           15176]
 gi|282570663|gb|EFB76198.1| DNA-binding response regulator ResD [Subdoligranulum variabile DSM
           15176]
          Length = 271

 Score =  154 bits (391), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 46/127 (36%), Gaps = 1/127 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R + R      GF   EA     A     +    + +++D  M  + 
Sbjct: 45  MAKILVVDDEPRIRDLIREHLQYAGFTCEEAGDGAAALSILTQGG-IDLVILDIMMPFMD 103

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                           V  L    +    +AG   GA+ +++KPF+   L   ++ +   
Sbjct: 104 GMTCLREMRTRKIMTPVIMLTARSEEYDKLAGLEGGADDYVVKPFSPRELVARVKAVLAR 163

Query: 121 QKSKDEN 127
              + E+
Sbjct: 164 TMPRTED 170


>gi|3282774|gb|AAC25063.1| response regulator homolog PhoB [Vibrio cholerae]
          Length = 229

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAMSKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  +  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHMKREEMTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|209527854|ref|ZP_03276344.1| two component transcriptional regulator, winged helix family
           [Arthrospira maxima CS-328]
 gi|209491711|gb|EDZ92076.1| two component transcriptional regulator, winged helix family
           [Arthrospira maxima CS-328]
          Length = 243

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 53/120 (44%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   ++  P+ +V+D  M      
Sbjct: 7   RILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEIF-RQTEPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|157369284|ref|YP_001477273.1| two component transcriptional regulator [Serratia proteamaculans
           568]
 gi|157321048|gb|ABV40145.1| two component transcriptional regulator, winged helix family
           [Serratia proteamaculans 568]
          Length = 229

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHMKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|29830959|ref|NP_825593.1| two-component system response regulator [Streptomyces avermitilis
           MA-4680]
 gi|29608073|dbj|BAC72128.1| putative two-component system response regulator [Streptomyces
           avermitilis MA-4680]
          Length = 249

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 47/120 (39%), Gaps = 2/120 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V +V     +  G++V  A     A         P+ +V+D  + G+   
Sbjct: 22  RVLVVDDDPTVAEVVSGYLDRAGYVVDRAEDGPTALARAAAHW-PDLVVLDLMLPGMDGL 80

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V  L    D +  I G   GA+ ++ KPF+   L   +  + +  +
Sbjct: 81  EVCRRMRGRGP-VPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRTR 139


>gi|29375768|ref|NP_814922.1| DNA-binding response regulator VicR [Enterococcus faecalis V583]
 gi|227518447|ref|ZP_03948496.1| DNA-binding response regulator [Enterococcus faecalis TX0104]
 gi|227552977|ref|ZP_03983026.1| DNA-binding response regulator [Enterococcus faecalis HH22]
 gi|229546129|ref|ZP_04434854.1| DNA-binding response regulator protein [Enterococcus faecalis
           TX1322]
 gi|229550318|ref|ZP_04439043.1| DNA-binding response regulator [Enterococcus faecalis ATCC 29200]
 gi|255973090|ref|ZP_05423676.1| DNA-binding response regulator [Enterococcus faecalis T1]
 gi|255976129|ref|ZP_05426715.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis T2]
 gi|256618776|ref|ZP_05475622.1| transcriptional regulatory protein [Enterococcus faecalis ATCC
           4200]
 gi|256762196|ref|ZP_05502776.1| DNA-binding response regulator [Enterococcus faecalis T3]
 gi|256852841|ref|ZP_05558211.1| VicR protein [Enterococcus faecalis T8]
 gi|256958685|ref|ZP_05562856.1| transcriptional regulatory protein [Enterococcus faecalis DS5]
 gi|256962217|ref|ZP_05566388.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis Merz96]
 gi|256965407|ref|ZP_05569578.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis HIP11704]
 gi|257077961|ref|ZP_05572322.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis JH1]
 gi|257082850|ref|ZP_05577211.1| DNA-binding response regulator VicR [Enterococcus faecalis E1Sol]
 gi|257085548|ref|ZP_05579909.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis Fly1]
 gi|257086546|ref|ZP_05580907.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis D6]
 gi|257089603|ref|ZP_05583964.1| two component system response regulator vicR [Enterococcus faecalis
           CH188]
 gi|257415810|ref|ZP_05592804.1| transcriptional regulatory protein [Enterococcus faecalis AR01/DG]
 gi|257419019|ref|ZP_05596013.1| DNA-binding response regulator [Enterococcus faecalis T11]
 gi|257422896|ref|ZP_05599886.1| two component system response regulator vicR [Enterococcus faecalis
           X98]
 gi|293383244|ref|ZP_06629160.1| DNA-binding response regulator VicR [Enterococcus faecalis R712]
 gi|293387601|ref|ZP_06632147.1| DNA-binding response regulator VicR [Enterococcus faecalis S613]
 gi|294781108|ref|ZP_06746458.1| response regulator receiver domain protein [Enterococcus faecalis
           PC1.1]
 gi|300860056|ref|ZP_07106144.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecalis TUSoD Ef11]
 gi|307268695|ref|ZP_07550064.1| response regulator receiver domain protein [Enterococcus faecalis
           TX4248]
 gi|307273520|ref|ZP_07554763.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0855]
 gi|307274483|ref|ZP_07555666.1| response regulator receiver domain protein [Enterococcus faecalis
           TX2134]
 gi|307279011|ref|ZP_07560069.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0860]
 gi|307288506|ref|ZP_07568492.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0109]
 gi|307291176|ref|ZP_07571061.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0411]
 gi|312899664|ref|ZP_07758988.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0470]
 gi|312903943|ref|ZP_07763112.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0635]
 gi|312907168|ref|ZP_07766159.1| response regulator receiver domain protein [Enterococcus faecalis
           DAPTO 512]
 gi|312909787|ref|ZP_07768635.1| response regulator receiver domain protein [Enterococcus faecalis
           DAPTO 516]
 gi|312951046|ref|ZP_07769954.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0102]
 gi|29343229|gb|AAO80992.1| DNA-binding response regulator VicR [Enterococcus faecalis V583]
 gi|227074125|gb|EEI12088.1| DNA-binding response regulator [Enterococcus faecalis TX0104]
 gi|227177886|gb|EEI58858.1| DNA-binding response regulator [Enterococcus faecalis HH22]
 gi|229304581|gb|EEN70577.1| DNA-binding response regulator [Enterococcus faecalis ATCC 29200]
 gi|229308653|gb|EEN74640.1| DNA-binding response regulator protein [Enterococcus faecalis
           TX1322]
 gi|255964108|gb|EET96584.1| DNA-binding response regulator [Enterococcus faecalis T1]
 gi|255969001|gb|EET99623.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis T2]
 gi|256598303|gb|EEU17479.1| transcriptional regulatory protein [Enterococcus faecalis ATCC
           4200]
 gi|256683447|gb|EEU23142.1| DNA-binding response regulator [Enterococcus faecalis T3]
 gi|256711300|gb|EEU26338.1| VicR protein [Enterococcus faecalis T8]
 gi|256949181|gb|EEU65813.1| transcriptional regulatory protein [Enterococcus faecalis DS5]
 gi|256952713|gb|EEU69345.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis Merz96]
 gi|256955903|gb|EEU72535.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis HIP11704]
 gi|256985991|gb|EEU73293.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis JH1]
 gi|256990880|gb|EEU78182.1| DNA-binding response regulator VicR [Enterococcus faecalis E1Sol]
 gi|256993578|gb|EEU80880.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis Fly1]
 gi|256994576|gb|EEU81878.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecalis D6]
 gi|256998415|gb|EEU84935.1| two component system response regulator vicR [Enterococcus faecalis
           CH188]
 gi|257157638|gb|EEU87598.1| transcriptional regulatory protein [Enterococcus faecalis ARO1/DG]
 gi|257160847|gb|EEU90807.1| DNA-binding response regulator [Enterococcus faecalis T11]
 gi|257164720|gb|EEU94680.1| two component system response regulator vicR [Enterococcus faecalis
           X98]
 gi|291079422|gb|EFE16786.1| DNA-binding response regulator VicR [Enterococcus faecalis R712]
 gi|291082933|gb|EFE19896.1| DNA-binding response regulator VicR [Enterococcus faecalis S613]
 gi|294451786|gb|EFG20238.1| response regulator receiver domain protein [Enterococcus faecalis
           PC1.1]
 gi|300850874|gb|EFK78623.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecalis TUSoD Ef11]
 gi|306497830|gb|EFM67362.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0411]
 gi|306500581|gb|EFM69912.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0109]
 gi|306504136|gb|EFM73348.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0860]
 gi|306508877|gb|EFM77964.1| response regulator receiver domain protein [Enterococcus faecalis
           TX2134]
 gi|306509797|gb|EFM78824.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0855]
 gi|306515007|gb|EFM83553.1| response regulator receiver domain protein [Enterococcus faecalis
           TX4248]
 gi|310626196|gb|EFQ09479.1| response regulator receiver domain protein [Enterococcus faecalis
           DAPTO 512]
 gi|310631001|gb|EFQ14284.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0102]
 gi|310632663|gb|EFQ15946.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0635]
 gi|311289745|gb|EFQ68301.1| response regulator receiver domain protein [Enterococcus faecalis
           DAPTO 516]
 gi|311293170|gb|EFQ71726.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0470]
 gi|315027746|gb|EFT39678.1| response regulator receiver domain protein [Enterococcus faecalis
           TX2137]
 gi|315029162|gb|EFT41094.1| response regulator receiver domain protein [Enterococcus faecalis
           TX4000]
 gi|315031521|gb|EFT43453.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0017]
 gi|315035063|gb|EFT46995.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0027]
 gi|315145504|gb|EFT89520.1| response regulator receiver domain protein [Enterococcus faecalis
           TX2141]
 gi|315147675|gb|EFT91691.1| response regulator receiver domain protein [Enterococcus faecalis
           TX4244]
 gi|315151377|gb|EFT95393.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0012]
 gi|315154083|gb|EFT98099.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0031]
 gi|315157370|gb|EFU01387.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0043]
 gi|315162567|gb|EFU06584.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0645]
 gi|315165410|gb|EFU09427.1| response regulator receiver domain protein [Enterococcus faecalis
           TX1302]
 gi|315166596|gb|EFU10613.1| response regulator receiver domain protein [Enterococcus faecalis
           TX1341]
 gi|315169875|gb|EFU13892.1| response regulator receiver domain protein [Enterococcus faecalis
           TX1342]
 gi|315172774|gb|EFU16791.1| response regulator receiver domain protein [Enterococcus faecalis
           TX1346]
 gi|315575748|gb|EFU87939.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0309B]
 gi|315578292|gb|EFU90483.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0630]
 gi|315579808|gb|EFU91999.1| response regulator receiver domain protein [Enterococcus faecalis
           TX0309A]
 gi|323480426|gb|ADX79865.1| response regulator [Enterococcus faecalis 62]
 gi|327534818|gb|AEA93652.1| response regulator [Enterococcus faecalis OG1RF]
          Length = 234

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    + ++ ++     G+ VF A    EA E  E E+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISEIVKYNLVKEGYEVFTAYDGEEALEKVE-EVEPDLIILDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKTHDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118


>gi|293392590|ref|ZP_06636910.1| phosphate regulon response regulator [Serratia odorifera DSM 4582]
 gi|291424992|gb|EFE98201.1| phosphate regulon response regulator [Serratia odorifera DSM 4582]
          Length = 229

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|320547235|ref|ZP_08041528.1| DNA-binding response regulator [Streptococcus equinus ATCC 9812]
 gi|320448123|gb|EFW88873.1| DNA-binding response regulator [Streptococcus equinus ATCC 9812]
          Length = 236

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 53/125 (42%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+    A    EA E  E+E  P+ +++D  + G+ 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYETVTAFDGREAIEKFEEEN-PDLIILDLMLPGLD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEVRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TENIE 123


>gi|218885985|ref|YP_002435306.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
 gi|218756939|gb|ACL07838.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio vulgaris str. 'Miyazaki F']
          Length = 230

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 30/127 (23%), Positives = 57/127 (44%), Gaps = 3/127 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+    + ++    F   GF V  AT+  E  E   ++  P  +++D  + G+   
Sbjct: 5   RILVVEDDEDILQLLTFTFESAGFEVRTATTGREGLEIALRQK-PALVLLDLMLPGMSGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++MP   DV V  L    +    I G   GA+ +++KPF+   L   +R + + 
Sbjct: 64  DVCRELKRMPETEDVPVIMLTARGEEVDRIVGLELGADDYVVKPFSPRELVLRIRAVLKR 123

Query: 121 QKSKDEN 127
            +   EN
Sbjct: 124 AQGVAEN 130


>gi|315644507|ref|ZP_07897639.1| signal transduction histidine kinase, LytS [Paenibacillus vortex
           V453]
 gi|315280014|gb|EFU43311.1| signal transduction histidine kinase, LytS [Paenibacillus vortex
           V453]
          Length = 1031

 Score =  154 bits (390), Expect = 4e-36,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 2/126 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++LLVD   +  +V R L     + +  A++  +A E        + ++ D  M G+   
Sbjct: 698 TVLLVDDDPVNLQVLRSLLFAENYNLLTASNGVQALEHIRSGQGIDLVITDWMMPGMSGL 757

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                VR+     ++ +  L      E +  G +AGAN FL KP + + LR  +R L ++
Sbjct: 758 QLCRTVREQHTLFELPILMLTARSLPEDVRTGLQAGANDFLRKPVDADELRARVRNLLEL 817

Query: 121 QKSKDE 126
           ++S  +
Sbjct: 818 RRSVRQ 823


>gi|288941366|ref|YP_003443606.1| two component transcriptional regulator PhoB, winged helix family
           [Allochromatium vinosum DSM 180]
 gi|288896738|gb|ADC62574.1| two component transcriptional regulator PhoB, winged helix family
           [Allochromatium vinosum DSM 180]
          Length = 228

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 54/124 (43%), Gaps = 3/124 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M ++L++D    +R+V R       F V EA    EA         P+ +++D  + G  
Sbjct: 1   MTTILVIDDEPDIREVMRFALESSDFRVMEAGHADEA-RKLLSNETPDLILLDWMLPGRS 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    ++Q P    + +  +    + E  + G   GA+ ++ KPF+   +   ++ + 
Sbjct: 60  GLELAQQLKQNPKTKSIPIIMISARGEEEDRVKGLDTGADDYIAKPFSPREMVARVKAVL 119

Query: 119 QMQK 122
           +  K
Sbjct: 120 RRAK 123


>gi|209966526|ref|YP_002299441.1| phosphate regulon transcriptional regulatory protein PhoB
           [Rhodospirillum centenum SW]
 gi|209959992|gb|ACJ00629.1| phosphate regulon transcriptional regulatory protein PhoB
           [Rhodospirillum centenum SW]
          Length = 234

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 52/119 (43%), Gaps = 3/119 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+V+    +  + ++     GF V  A+   EA      E  P+ +++D  +  +  LE
Sbjct: 9   ILIVEDEADLVTLLKYNLEKEGFRVISASDGEEAL-LLANEQAPHLVLLDWMLPLMSGLE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               +R+ P   D  V  L    +    + G  +GA+ ++ KPF+   L   MR + + 
Sbjct: 68  VCRQLRRNPKTRDTPVIMLTARGEEADKVRGLNSGADDYIAKPFSPTELVARMRAVLRR 126


>gi|28377004|ref|NP_783896.1| response regulator [Lactobacillus plantarum WCFS1]
 gi|28269835|emb|CAD62732.1| response regulator [Lactobacillus plantarum WCFS1]
          Length = 235

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 51/121 (42%), Gaps = 2/121 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA +  + E+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIMKFNLTKEGYEVHVAADGEEALQKVD-EVHPDLILLDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 RQ+    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-RQVRKNYDMPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118

Query: 121 Q 121
           Q
Sbjct: 119 Q 119


>gi|317056207|ref|YP_004104674.1| winged helix family two component transcriptional regulator
           [Ruminococcus albus 7]
 gi|315448476|gb|ADU22040.1| two component transcriptional regulator, winged helix family
           [Ruminococcus albus 7]
          Length = 224

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 48/122 (39%), Gaps = 2/122 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  +        G+ V  A    +A + C KE   + +V+D  M    
Sbjct: 1   MSRILIVDDEPDIITLISRYAEREGYEVVTAEDGSQAIDICRKED-FDLIVMDIMMPDTD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F A  +++    D+ V  L         + G   G + ++ KPF+   L   ++ +   
Sbjct: 60  GFTAC-KKIKEFKDIPVIMLSARGTEFDKLFGFEVGVDDYVTKPFSPRELMARIKAVINR 118

Query: 121 QK 122
            K
Sbjct: 119 SK 120


>gi|300869112|ref|ZP_07113711.1| two component transcriptional regulator [Oscillatoria sp. PCC 6506]
 gi|300332881|emb|CBN58907.1| two component transcriptional regulator [Oscillatoria sp. PCC 6506]
          Length = 247

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA +   +   P+ +V+D  M      
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDTF-RNTDPDLVVLDVMMPKLDGY 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 70  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126


>gi|294630116|ref|ZP_06708676.1| DNA-binding response regulator [Streptomyces sp. e14]
 gi|292833449|gb|EFF91798.1| DNA-binding response regulator [Streptomyces sp. e14]
          Length = 246

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A E       P+ +V+D  M  +  
Sbjct: 13  QRILIVDDEPAVREALQRSLAFEGYDTEVAVDGADALEKAAA-YRPDLVVLDIQMPRMDG 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 72  LTAARRIRGTGDTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 130


>gi|51595267|ref|YP_069458.1| two-component regulatory system response regulator [Yersinia
           pseudotuberculosis IP 32953]
 gi|108808689|ref|YP_652605.1| phosphate regulon transcriptional regulator [Yersinia pestis
           Antiqua]
 gi|108811049|ref|YP_646816.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Nepal516]
 gi|149364950|ref|ZP_01886985.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis CA88-4125]
 gi|153946834|ref|YP_001402096.1| PhoB family transcriptional regulator [Yersinia pseudotuberculosis
           IP 31758]
 gi|165935944|ref|ZP_02224514.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|167468099|ref|ZP_02332803.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis FV-1]
 gi|170025493|ref|YP_001721998.1| two component transcriptional regulator [Yersinia
           pseudotuberculosis YPIII]
 gi|186894284|ref|YP_001871396.1| two component transcriptional regulator [Yersinia
           pseudotuberculosis PB1/+]
 gi|218930234|ref|YP_002348109.1| phosphate regulon transcriptional regulator [Yersinia pestis CO92]
 gi|229838810|ref|ZP_04458969.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229896037|ref|ZP_04511207.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis Pestoides A]
 gi|229899378|ref|ZP_04514521.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229901275|ref|ZP_04516397.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis Nepal516]
 gi|51588549|emb|CAH20157.1| response regulator in two-component regulatory system with PhoR (or
           CreC), regulates Pi uptake (OmpR family) [Yersinia
           pseudotuberculosis IP 32953]
 gi|108774697|gb|ABG17216.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Nepal516]
 gi|108780602|gb|ABG14660.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Antiqua]
 gi|115348845|emb|CAL21800.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis CO92]
 gi|149291363|gb|EDM41437.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis CA88-4125]
 gi|152958329|gb|ABS45790.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pseudotuberculosis IP 31758]
 gi|165916089|gb|EDR34696.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Orientalis str. IP275]
 gi|169752027|gb|ACA69545.1| two component transcriptional regulator, winged helix family
           [Yersinia pseudotuberculosis YPIII]
 gi|186697310|gb|ACC87939.1| two component transcriptional regulator, winged helix family
           [Yersinia pseudotuberculosis PB1/+]
 gi|229681204|gb|EEO77298.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis Nepal516]
 gi|229687780|gb|EEO79853.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis biovar Orientalis
           str. India 195]
 gi|229695176|gb|EEO85223.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis biovar Orientalis
           str. PEXU2]
 gi|229700960|gb|EEO88989.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Yersinia pestis Pestoides A]
 gi|320016389|gb|ADV99960.1| osmolarity response regulator [Yersinia pestis biovar Medievalis
           str. Harbin 35]
          Length = 229

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVARL-SEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|113478264|ref|YP_724325.1| two component transcriptional regulator [Trichodesmium erythraeum
           IMS101]
 gi|110169312|gb|ABG53852.1| two component transcriptional regulator, winged helix family
           [Trichodesmium erythraeum IMS101]
          Length = 257

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V +A    +  +    +LLP+ +V+D  +  V 
Sbjct: 1   MPRILVIDDDPAIAELVAVNLEMAGYEVSQAEDGIKG-QALALQLLPDLIVLDLMLPKVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+     D+ V  L      +  + G  AGA+ +L KPF  E +   +R L 
Sbjct: 60  GFTVCQRLRRDERTADIPVLMLTALGQTQDKVEGFNAGADDYLTKPFEIEEMLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|317492787|ref|ZP_07951211.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacteriaceae bacterium 9_2_54FAA]
 gi|316918909|gb|EFV40244.1| phosphate regulon transcriptional regulatory protein PhoB
           [Enterobacteriaceae bacterium 9_2_54FAA]
          Length = 229

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPVEAEDYDSAVNSL-SEPYPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHMKREALTREIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|261419126|ref|YP_003252808.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC61]
 gi|319765943|ref|YP_004131444.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC52]
 gi|261375583|gb|ACX78326.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC61]
 gi|317110809|gb|ADU93301.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC52]
          Length = 224

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 58/124 (46%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++  H  +  GF + EA +  EA +  E  +  + +++D  M  + 
Sbjct: 1   MARILVVDDDAHIRELVSHFLSLEGFTIHEAANGKEALDVLET-VKVDLVIMDIMMPEMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R      DV +  L  + + ++ + G   GA+ +L+KPF+   L   ++ L 
Sbjct: 60  GWELCRELR---DYDDVPILMLTAKGETKQKVKGFELGADDYLVKPFDPLELVARVKALL 116

Query: 119 QMQK 122
           +  +
Sbjct: 117 KRYR 120


>gi|333008591|gb|EGK28059.1| phosphate regulon transcriptional regulatory protein PhoB [Shigella
           flexneri VA-6]
          Length = 229

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLLGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|94499897|ref|ZP_01306433.1| two-component response regulator PhoB [Oceanobacter sp. RED65]
 gi|94428098|gb|EAT13072.1| two-component response regulator PhoB [Oceanobacter sp. RED65]
          Length = 232

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R++        G+   EA++  +A      E  P  +++D  + G   
Sbjct: 6   KKILIVDDEASIREMIAVALEMAGYECIEASNTQDAYSLIIDEH-PEMILLDWMLPGTSG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LEF   +++     +V +  L  + + +  + G  AGA+ ++ KPF+   L   ++ + +
Sbjct: 65  LEFARRLKRDDRTNEVPIIMLTAKGEEDNKVLGLEAGADDYITKPFSPRELVARLKAVLR 124

Query: 120 M 120
            
Sbjct: 125 R 125


>gi|145600097|ref|YP_001164173.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Pestoides F]
 gi|145211793|gb|ABP41200.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Pestoides F]
          Length = 229

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVARL-SEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|254385529|ref|ZP_05000855.1| two-component system response regulator [Streptomyces sp. Mg1]
 gi|194344400|gb|EDX25366.1| two-component system response regulator [Streptomyces sp. Mg1]
          Length = 243

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  R      G+    A    +A +       P+ +V+D  M  +  
Sbjct: 8   QRILVVDDEPAVREALRRSLAFEGYGAQTAVDGLDALDKA-ASYAPDLIVLDIQMPRMDG 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+   +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 67  LTAARRLRSAGSTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARVRALLRR 125


>gi|90579403|ref|ZP_01235213.1| putative DNA-binding response regulator PhoB [Vibrio angustum S14]
 gi|90440236|gb|EAS65417.1| putative DNA-binding response regulator PhoB [Vibrio angustum S14]
          Length = 229

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A E    E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAIEAEDYDTALEKMC-EPYPELILMDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  L   + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|75907309|ref|YP_321605.1| multi-sensor hybrid histidine kinase [Anabaena variabilis ATCC
           29413]
 gi|75701034|gb|ABA20710.1| multi-sensor hybrid histidine kinase [Anabaena variabilis ATCC
           29413]
          Length = 1431

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 29/134 (21%), Positives = 58/134 (43%), Gaps = 8/134 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LLVD +  +R+  + L +   ++V  AT    A E    + LP+ ++ D  M      
Sbjct: 608 RILLVDDNADMREYVKRLLSRH-YVVETATDGLAALEAL-ADHLPDLVLTDVMMPRLDGF 665

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ- 119
             ++ +R      ++ +  L      E  + G  AGA+ +L+KPF+   L   +    + 
Sbjct: 666 GLLSALRSNNRTREIPIILLSARAGEEAKVEGLEAGADDYLIKPFSARELLARVEATLKL 725

Query: 120 ---MQKSKDENQFL 130
               + + ++ Q L
Sbjct: 726 AQLRRDAMEQQQTL 739



 Score =  115 bits (290), Expect = 2e-24,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 43/122 (35%), Gaps = 5/122 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
            +L+VD     R+    L    G  V  A S  EA +   +   P+ L+ D  M  +    
Sbjct: 1310 VLVVDDDTDTREFVAFLLEQAGARVITAVSALEALQVFTQSP-PDILLSDIGMPDMDGYM 1368

Query: 62   FIAHVRQMPLGT--DVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             +  +R +P      +    L             + G    + KP + + L  A+  L  
Sbjct: 1369 LMRQIRALPPDQGGKIPAIALTAYAGEIDEKRALKVGFQRHISKPVDPDNLIRAIVNLID 1428

Query: 120  MQ 121
            ++
Sbjct: 1429 IK 1430


>gi|284048184|ref|YP_003398523.1| two component transcriptional regulator, winged helix family
           [Acidaminococcus fermentans DSM 20731]
 gi|283952405|gb|ADB47208.1| two component transcriptional regulator, winged helix family
           [Acidaminococcus fermentans DSM 20731]
          Length = 232

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
            ++L+ D    +R++    F   GF V EA    EA    +    P+ +++D  M     
Sbjct: 5   QTVLIADDEPQIREILSIYFKKEGFKVIEAADGAEALVQVQAGK-PDIILLDIMMPVLDG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    VR++   +D+ +  L  +   +  I G   GA+ ++ KPFN   +   ++ + +
Sbjct: 64  LEVCKQVRKI---SDIPIIMLTAKDSDDDRILGLEIGADDYISKPFNTREVVARVKAVLR 120

Query: 120 MQKS 123
              +
Sbjct: 121 RTNA 124


>gi|257870078|ref|ZP_05649731.1| transcriptional regulator [Enterococcus gallinarum EG2]
 gi|257804242|gb|EEV33064.1| transcriptional regulator [Enterococcus gallinarum EG2]
          Length = 234

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V+ A    EA E    E+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGYEVYTAYDGEEALEKV-AEIEPDLILLDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKNHDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118


>gi|11467627|ref|NP_050679.1| Ycf27 [Guillardia theta]
 gi|6136611|sp|O78428|YCF27_GUITH RecName: Full=Probable transcriptional regulator ycf27; AltName:
           Full=OmpR-like protein
 gi|3602952|gb|AAC35613.1| ompR homolog [Guillardia theta]
          Length = 254

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 54/125 (43%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +RK+     +  G+ V  A+   EA     +E +P+ +++D  M      
Sbjct: 16  KVLIVDDEASIRKILETRLSMIGYFVVTASDGEEALNLFHQE-MPDVVILDIMMPKLDGY 74

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 75  GVCQEIRKD---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRAVLRR 131

Query: 121 QKSKD 125
                
Sbjct: 132 TNKAA 136


>gi|90413136|ref|ZP_01221132.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium profundum 3TCK]
 gi|90325827|gb|EAS42279.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium profundum 3TCK]
          Length = 1117

 Score =  154 bits (390), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 3/132 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD   +  +V  +     G+ V  A S  +A +  E++  P  +++D  M  +   E
Sbjct: 711 LLVVDDEPVNLQVLNNFLRLEGYRVLTADSGPQALKIIEQQ-QPALILLDIMMPEMSGYE 769

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+     ++ +  L      +  I G  +GAN +L KPFN+E L   +    Q  
Sbjct: 770 VCHILREEHSLIELPIIMLSALGQVQDRIKGFESGANDYLTKPFNKEELIARISAHLQAG 829

Query: 122 KSKDENQFLDAI 133
           K++ + Q   A+
Sbjct: 830 KTEVQRQKNAAL 841


>gi|172038915|ref|YP_001805416.1| two-component response regulator [Cyanothece sp. ATCC 51142]
 gi|171700369|gb|ACB53350.1| two-component response regulator [Cyanothece sp. ATCC 51142]
          Length = 243

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA +    E +P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDIF-HEAVPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|238755122|ref|ZP_04616469.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           ruckeri ATCC 29473]
 gi|238706682|gb|EEP99052.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           ruckeri ATCC 29473]
          Length = 234

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 8   RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVARL-SEPFPDLVLLDWMLPGGSG 66

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 67  IQFIKHMKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 126

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 127 RISPMAVEEVIE 138


>gi|147679020|ref|YP_001213235.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146275117|dbj|BAF60866.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 228

 Score =  153 bits (389), Expect = 5e-36,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 50/123 (40%), Gaps = 6/123 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           +++L+VD   +V+ + R      GF V  A    EA         P+ +++D  +  +  
Sbjct: 4   NTILVVDDEELVQDLIRLYLEKEGFRVEVARDGEEALAKLGFAN-PDLVILDIMLPKMDG 62

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+        +  L  + +    + G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  WAVCREIRK---TMATPIIMLTAKGEEFDRVLGLELGADDYVCKPFSPIELVARIKAVLR 119

Query: 120 MQK 122
             +
Sbjct: 120 RAR 122


>gi|295101234|emb|CBK98779.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Faecalibacterium
           prausnitzii L2-6]
          Length = 232

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++ R      G+ V  A    E  E    +L P+ +++D  M  +   
Sbjct: 5   KILVVDDDTNICELLRLYLTKEGYQVTTANDGEEGLEKF-NQLKPDMVLLDVMMPRMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R++    +  V  L  + +    + G   GA+ +++KPF+ + +   ++ + + 
Sbjct: 64  EVCRRIRKLG---NTPVMMLTAKGETFDKVLGLELGADDYMVKPFDTKEVVARIKAVLRR 120


>gi|251790686|ref|YP_003005407.1| two component transcriptional regulator PhoB, winged helix family
           [Dickeya zeae Ech1591]
 gi|307129884|ref|YP_003881900.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Dickeya dadantii 3937]
 gi|247539307|gb|ACT07928.1| two component transcriptional regulator PhoB, winged helix family
           [Dickeya zeae Ech1591]
 gi|306527413|gb|ADM97343.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Dickeya dadantii 3937]
          Length = 229

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPVEAEDYDSAVTRL-AEPYPELVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|148273519|ref|YP_001223080.1| putative two-component system response regulator [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
 gi|147831449|emb|CAN02409.1| putative two-component system response regulator [Clavibacter
           michiganensis subsp. michiganensis NCPPB 382]
          Length = 283

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 48/121 (39%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    V +V        GF V       EA      E +P+ +V+D  + G+  
Sbjct: 31  RRILVVEDDPTVNEVVCRYLKASGFQVETVADGLEAV-RVATERMPDLVVLDRMLPGLDG 89

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R     + V V  L      E  + G  AGA+ +L KPF+   L   +R + +
Sbjct: 90  LEVCRRIRAHHPESPVPVVMLTALGQGEDRVNGLDAGADDYLAKPFSPRELVLRVRAVLR 149

Query: 120 M 120
            
Sbjct: 150 R 150


>gi|163939206|ref|YP_001644090.1| two component transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|163861403|gb|ABY42462.1| two component transcriptional regulator, winged helix family
           [Bacillus weihenstephanensis KBAB4]
          Length = 223

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD    +R++     ++FG+   EA +  EA    E +   +++V+D  M  +   
Sbjct: 5   NVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALRKLETDHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEIQ 131


>gi|163790938|ref|ZP_02185361.1| DNA-binding response regulator [Carnobacterium sp. AT7]
 gi|159873780|gb|EDP67861.1| DNA-binding response regulator [Carnobacterium sp. AT7]
          Length = 235

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 54/129 (41%), Gaps = 6/129 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  + +      G+ VF A    EA E  E E+LP+ +++D  +    
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGYEVFTAYDGEEALEKVE-EVLPDLIILDLMLPKKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    VR+     D+ +  +  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCREVRKN---HDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELAARVKANL 116

Query: 119 QMQKSKDEN 127
           +   +    
Sbjct: 117 RRHDNAKTQ 125


>gi|49477181|ref|YP_035526.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
 gi|49328737|gb|AAT59383.1| response regulator [Bacillus thuringiensis serovar konkukian str.
           97-27]
          Length = 223

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 63/131 (48%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              +++ + + 
Sbjct: 121 YTKQEQQEEVQ 131


>gi|297200653|ref|ZP_06918050.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sviceus ATCC 29083]
 gi|197709788|gb|EDY53822.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sviceus ATCC 29083]
          Length = 245

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A +       P+ +V+D  M  +  
Sbjct: 11  QRILIVDDEPAVREALQRSLAFEGYDTEVAVDGADALDKATA-YRPDLVVLDIQMPRMDG 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 70  LTAARRIRGAGDTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARVRALLRR 128


>gi|113474756|ref|YP_720817.1| two component transcriptional regulator [Trichodesmium erythraeum
           IMS101]
 gi|110165804|gb|ABG50344.1| two component transcriptional regulator, winged helix family
           [Trichodesmium erythraeum IMS101]
          Length = 243

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E       P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETF-HNTTPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|254421179|ref|ZP_05034897.1| response regulator receiver domain protein [Synechococcus sp. PCC
           7335]
 gi|196188668|gb|EDX83632.1| response regulator receiver domain protein [Synechococcus sp. PCC
           7335]
          Length = 242

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA +   +  +P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDTF-RNTIPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|168187034|ref|ZP_02621669.1| transcriptional regulatory protein ResD [Clostridium botulinum C
           str. Eklund]
 gi|169295053|gb|EDS77186.1| transcriptional regulatory protein ResD [Clostridium botulinum C
           str. Eklund]
          Length = 228

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + ++ +      G+          A+     E  P+ +++D  +  +   
Sbjct: 7   KILIVDDDENICEIIKMYLESSGYSTECCYDGKSAQGAFF-EYKPDLVLLDVMLPHMDGI 65

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+        V  L  + +    +     GA+ +++KPF  + L   ++ + + 
Sbjct: 66  DVLKWIRKESE---TPVIMLTAKGETFDKVLALELGADDYIVKPFEPKELIARIKAVLRR 122

Query: 121 QKSKDENQ 128
              ++E++
Sbjct: 123 YNVENEDK 130


>gi|281355429|ref|ZP_06241923.1| two component transcriptional regulator, winged helix family
           [Victivallis vadensis ATCC BAA-548]
 gi|281318309|gb|EFB02329.1| two component transcriptional regulator, winged helix family
           [Victivallis vadensis ATCC BAA-548]
          Length = 231

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 56/126 (44%), Gaps = 4/126 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGF-MVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            +L+V+    ++++ R+  N  G+  V    S  EA      E  P+ +++D  + G+  
Sbjct: 5   KILVVEDEEAIQELIRYNLNKDGYDRVRCCESGEEALAAA-TEFAPDLILLDLMLPGMDG 63

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++     + + +  L  + +   ++ G   GA+ +L KPF+ + L   ++ + +
Sbjct: 64  LAVCRRLKSDTRTSAIPIIMLTAKSEESDIVIGLEMGADDYLPKPFSPKVLIARIKSVLR 123

Query: 120 MQKSKD 125
             K  D
Sbjct: 124 RVKPSD 129


>gi|126658619|ref|ZP_01729765.1| two-component response regulator [Cyanothece sp. CCY0110]
 gi|126620056|gb|EAZ90779.1| two-component response regulator [Cyanothece sp. CCY0110]
          Length = 243

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA +    E +P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDIF-HEAIPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|221134917|ref|ZP_03561220.1| putative DNA-binding response regulator PhoB [Glaciecola sp.
           HTCC2999]
          Length = 228

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 54/123 (43%), Gaps = 4/123 (3%)

Query: 1   MDS-LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M   +LLV+    +R++ + +    GF V EA     A +    E  P+ +++D  + G 
Sbjct: 1   MSRSILLVEDEAPIREMIKIILEQAGFTVNEAEDFDIALDKMV-EPYPDLVLLDWMLPGG 59

Query: 60  LE--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                    ++     ++ V  L    + +  I G  AGA+ ++ KPF+ + L   ++ +
Sbjct: 60  SGVQLARKFKEHEFTREIPVILLTARGEEDDKIRGLDAGADDYITKPFSPKELVARIKAV 119

Query: 118 PQM 120
            + 
Sbjct: 120 MRR 122


>gi|282898472|ref|ZP_06306462.1| Two component Transcriptional regulator, Winged helix family
           [Raphidiopsis brookii D9]
 gi|281196638|gb|EFA71544.1| Two component Transcriptional regulator, Winged helix family
           [Raphidiopsis brookii D9]
          Length = 242

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKAN-PDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|332981325|ref|YP_004462766.1| winged helix family two component transcriptional regulator
           [Mahella australiensis 50-1 BON]
 gi|332699003|gb|AEE95944.1| two component transcriptional regulator, winged helix family
           [Mahella australiensis 50-1 BON]
          Length = 235

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 25/125 (20%), Positives = 56/125 (44%), Gaps = 3/125 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD    + ++ R    + G+ V  A     A +FC ++ +P+ +++D  + G+   
Sbjct: 5   TILVVDDEAHILELIRFNLENAGYKVEVAEDGETALKFCRQQ-VPDLIILDIMLPGIDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R       V +  L  + +    + G   GA+ ++ KPF    L   ++ L + 
Sbjct: 64  EVCKTLRASVATAKVPIIMLTAKGEEIDKVVGLEIGADDYIAKPFGIRELIARVKALLRR 123

Query: 121 QKSKD 125
            ++ D
Sbjct: 124 TENND 128


>gi|119485204|ref|ZP_01619589.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
 gi|119457432|gb|EAW38557.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
          Length = 237

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 56/122 (45%), Gaps = 4/122 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+    + ++ +    + GF    A     A E+ + +  P+ +V+D  + G+ 
Sbjct: 1   MK-ILIVEDDGEIAQLIQQTLENEGFSCETARDGWGALEWFQTQ-QPDLIVLDLMLPGLD 58

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                A +RQ P   D ++  L  + +    + G   GA+ +L+KPF+   L   +R L 
Sbjct: 59  GLEVCARIRQQPGVKDPYILMLTAKGEEIDRVIGLSTGADDYLVKPFSPRELVARIRALL 118

Query: 119 QM 120
           + 
Sbjct: 119 RR 120


>gi|199597241|ref|ZP_03210672.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus rhamnosus HN001]
 gi|199591757|gb|EDY99832.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus rhamnosus HN001]
          Length = 234

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 51/126 (40%), Gaps = 1/126 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + ++      + V  AT   EA +    E   +++++D  +  + 
Sbjct: 1   MKKILIVDDEPAILTLLQYNLEAEHYQVETATDGQEALDKVRSEP-FDFIILDLMLPSLS 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +         +  L  + +    I G   GA+ ++ KPF+   +   ++ + + 
Sbjct: 60  GLDVTCKIREEKIQTPIMILTAKDNETDKIVGLELGADDYVTKPFSPREIIARIKAIERR 119

Query: 121 QKSKDE 126
            +S+ +
Sbjct: 120 SQSQPQ 125


>gi|170077600|ref|YP_001734238.1| two-component DNA binding response regulator [Synechococcus sp. PCC
           7002]
 gi|169885269|gb|ACA98982.1| Two-component DNA binding response regulator [Synechococcus sp. PCC
           7002]
          Length = 242

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA    + E  P+ +V+D  M      
Sbjct: 7   RILVVDDEASIRRILETRLSMIGYEVVTAADGEEALATFD-EADPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|158338202|ref|YP_001519379.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
 gi|158308443|gb|ABW30060.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
          Length = 249

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     +  G+ +  A    EA E  E E  P+ +V+D  M  +   
Sbjct: 6   KILIVDDEATIRRILATRLSMVGYEIVVAADGVEALEQFEAEK-PDLIVLDVMMPRMNGL 64

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+      V +  L    +    I G   GA+ +L KPF+ + L   ++ + + 
Sbjct: 65  QVCQTLRESTG---VPIIMLTALGEVSDRIKGLELGADDYLPKPFSPKELESRIQAILRR 121


>gi|332286633|ref|YP_004418544.1| phosphate regulon two-component response regulator [Pusillimonas
           sp. T7-7]
 gi|330430586|gb|AEC21920.1| phosphate regulon two-component response regulator [Pusillimonas
           sp. T7-7]
          Length = 233

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 54/125 (43%), Gaps = 3/125 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+V+    ++++     +  G  V  A    +A+     E LP+ +++D  + G   
Sbjct: 3   TTILVVEDEPAIQELISVNLSFAGHKVLRAFDAEQAQTLIRAE-LPDLILLDWMLPGASG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +     +R       V V  L  +      + G  AGA+ ++ KPF+ + L   ++ + +
Sbjct: 62  ITLARTLRSDERTRHVPVIMLTAKGAEHDKVEGLEAGADDYITKPFSPKELIARIKAVLR 121

Query: 120 MQKSK 124
            +  +
Sbjct: 122 RRAPQ 126


>gi|162419398|ref|YP_001607632.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis Angola]
 gi|162352213|gb|ABX86161.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis Angola]
          Length = 230

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 4   RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVARL-SEPFPDLVLLDWMLPGGSG 62

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 63  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 122

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 123 RISPMAVEEVIE 134


>gi|296133811|ref|YP_003641058.1| two component transcriptional regulator, winged helix family
           [Thermincola sp. JR]
 gi|296032389|gb|ADG83157.1| two component transcriptional regulator, winged helix family
           [Thermincola potens JR]
          Length = 235

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 27/123 (21%), Positives = 54/123 (43%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD  H + ++ R +    GF V  A     A +   +   P+ +++D  + G+ 
Sbjct: 1   MAKILIVDDEHHIIELVRFVLQKEGFDVKVAQDGLTAIKE-TENYRPDLILLDLMLPGID 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+ P   D+ V  +  + D    I G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCRTLRKKPETADIPVIMVTAKSDEMDKIIGLELGADDYVTKPFSPRELVARVKARL 119

Query: 119 QMQ 121
           + +
Sbjct: 120 RRR 122


>gi|261212177|ref|ZP_05926463.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. RC341]
 gi|262402893|ref|ZP_06079454.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. RC586]
 gi|260838785|gb|EEX65436.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. RC341]
 gi|262351675|gb|EEZ00808.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           sp. RC586]
          Length = 229

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAMSKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  +  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHMKREEVTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|119896456|ref|YP_931669.1| phosphate regulon transcriptional regulatory protein [Azoarcus sp.
           BH72]
 gi|119668869|emb|CAL92782.1| phosphate regulon transcriptional regulatory protein [Azoarcus sp.
           BH72]
          Length = 236

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 58/125 (46%), Gaps = 3/125 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++LLV+    ++++     +  G  V  A     A +   ++ LP+ +++D  + G+  +
Sbjct: 4   NILLVEDEPAIQELIAANLSRAGHHVVRAADAEAA-QRLVRDALPDLVLLDWMLPGMSGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           +F   +R      ++ +  L    + +  +AG   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DFARRLRAEERTREIPIIMLTARGEEQDKVAGLETGADDYITKPFSPRELVARIKAVLRR 122

Query: 121 QKSKD 125
           +  + 
Sbjct: 123 RAPQA 127


>gi|119486641|ref|ZP_01620691.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
 gi|119456258|gb|EAW37390.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
          Length = 243

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRK-TEPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|56477139|ref|YP_158728.1| phosphate regulon transcriptional regulatory protein phoB
           [Aromatoleum aromaticum EbN1]
 gi|56313182|emb|CAI07827.1| Phosphate regulon transcriptional regulatory protein phoB
           [Aromatoleum aromaticum EbN1]
          Length = 235

 Score =  153 bits (389), Expect = 6e-36,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 63/132 (47%), Gaps = 3/132 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++LLV+    ++++     +  G  V  A+   EA +   ++ LP+ +++D  + G+  +
Sbjct: 4   NILLVEDELAIQELIAASLSRAGHRVVRASDAEEAAQRL-RDALPDLVLLDWMLPGMTGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           EF   +R      ++ +  L    + +  +AG  +GA+ ++ KPF+   L   +  + + 
Sbjct: 63  EFARRLRGDERTREIPIIMLTARGEEQDKVAGLESGADDYITKPFSPRELAARITAVLRR 122

Query: 121 QKSKDENQFLDA 132
           +  +     ++A
Sbjct: 123 RAPQTTEDAVEA 134


>gi|294084770|ref|YP_003551528.1| winged helix family two component transcriptional regulator
           [Candidatus Puniceispirillum marinum IMCC1322]
 gi|292664343|gb|ADE39444.1| two component transcriptional regulator, winged helix family
           [Candidatus Puniceispirillum marinum IMCC1322]
          Length = 235

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 49/122 (40%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+ D      ++        GF VFEA    +A    E +L P+ +++D  M  +  +
Sbjct: 5   KILIADDEPNQLELLSFNLRQAGFTVFEAADGRQAVNMVE-DLQPDLIILDWMMPHMSGI 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E     R      D+ V  L    +      G   GA+ ++ KPF+   L   ++ L + 
Sbjct: 64  EVCRLFRSRTETKDLPVIILSARGEEGDRTLGLDTGADDYITKPFSPRELVSRVKALLRR 123

Query: 121 QK 122
            +
Sbjct: 124 AR 125


>gi|303232491|ref|ZP_07319179.1| putative Sensory transduction protein regX3 [Atopobium vaginae
           PB189-T1-4]
 gi|302481415|gb|EFL44487.1| putative Sensory transduction protein regX3 [Atopobium vaginae
           PB189-T1-4]
          Length = 240

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +LLV+    +R+         G+ V        A E  EK    + +++D  +  +  
Sbjct: 6   KRILLVEDEKTIREAVSAYLEREGYFVRGVGDGQNALEEFEKHS-FDLIILDLMLPKLSG 64

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R +   ++V +  L  + + E  I G   GA+ +L+KPF+   L   +R L +  
Sbjct: 65  -ERVCRAVRETSNVPIIMLTAKGEVEDRIIGLELGADDYLIKPFSPRELVARVRALLRRA 123

Query: 122 KSKDE 126
            S+ E
Sbjct: 124 HSEAE 128


>gi|75908099|ref|YP_322395.1| two component transcriptional regulator [Anabaena variabilis ATCC
           29413]
 gi|75701824|gb|ABA21500.1| two component transcriptional regulator, winged helix family
           [Anabaena variabilis ATCC 29413]
          Length = 242

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKSD-PDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|187777475|ref|ZP_02993948.1| hypothetical protein CLOSPO_01043 [Clostridium sporogenes ATCC
           15579]
 gi|187774403|gb|EDU38205.1| hypothetical protein CLOSPO_01043 [Clostridium sporogenes ATCC
           15579]
          Length = 228

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 58/133 (43%), Gaps = 8/133 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + +V +    + G+         EA+E    E  P+ +++D  +  +   
Sbjct: 7   KVLVVDDDENIAEVIKMYLENSGYDTRVCYDGKEAQEGFL-EYKPDLVLLDIMLPHIDGV 65

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+    + + +  L  + D    +     GA+ +++KPF  + L   ++ + + 
Sbjct: 66  DVLKWIRKD---STIPIIMLTAKGDTFDKVLALELGADDYIVKPFEPKELLARVKAVLRR 122

Query: 121 QKSKDENQFLDAI 133
               +EN+  +A+
Sbjct: 123 YNVDNENK--EAL 133


>gi|218438945|ref|YP_002377274.1| multi-sensor signal transduction histidine kinase [Cyanothece sp.
           PCC 7424]
 gi|218171673|gb|ACK70406.1| multi-sensor signal transduction histidine kinase [Cyanothece sp.
           PCC 7424]
          Length = 1383

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 29/136 (21%), Positives = 60/136 (44%), Gaps = 8/136 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LL D +  +R+  + L + + + V        A E   +   P+ ++ D  M      
Sbjct: 631 RILLADDNGDMREYVKRLLSQY-YEVETVADGIAALEAIRRHP-PDLVLSDVMMPRLNGF 688

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ- 119
           E +  +R+ PL  ++ +  L      E ++ G ++GA+ +L+KPF+   L   +    + 
Sbjct: 689 ELLQELRRNPLTEELPIILLSARAGEESLVEGLKSGADDYLVKPFSARELLARIEATLKM 748

Query: 120 ---MQKSKDENQFLDA 132
               Q++  + Q L A
Sbjct: 749 AQLRQQAAQKEQKLRA 764


>gi|255658266|ref|ZP_05403675.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Mitsuokella multacida DSM 20544]
 gi|260849578|gb|EEX69585.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Mitsuokella multacida DSM 20544]
          Length = 235

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 55/135 (40%), Gaps = 9/135 (6%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLE 61
           +L+VD    +R++        G+ V  A     A +        + +++D  +     LE
Sbjct: 3   ILVVDDEAPIRELLSFNLKKSGYEVEMAADGRTALQRA---PEADLVLLDIMLPEVDGLE 59

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM- 120
               ++  P  + + +  L  + +    + G   GA+ +++KPF+   L   ++ + +  
Sbjct: 60  VCRQLKADPQTSGIPIIMLTAKAEEIDRVLGLELGADDYVVKPFSMRELLARVKAVLRRS 119

Query: 121 ---QKSKDENQFLDA 132
              QK   EN+  + 
Sbjct: 120 ASVQKGSRENKEREE 134


>gi|229818366|ref|ZP_04448647.1| hypothetical protein BIFANG_03668 [Bifidobacterium angulatum DSM
           20098]
 gi|229784236|gb|EEP20350.1| hypothetical protein BIFANG_03668 [Bifidobacterium angulatum DSM
           20098]
          Length = 233

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 50/129 (38%), Gaps = 6/129 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E        + +++D  + G+ 
Sbjct: 1   MTRILIVEDEESYREPLVYQLTREGYEVSAAATGEEGLELF-THGGIDLVLLDLMLPGID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTTLCRRIREQSR---VPIIMLTAKSTEIDKVVGLEIGADDYVTKPYSFRELLARIRAVL 116

Query: 119 QMQKSKDEN 127
           +  +S  + 
Sbjct: 117 RRNQSAQQQ 125


>gi|254490292|ref|ZP_05103481.1| phosphate regulon transcriptional regulatory protein PhoB
           [Methylophaga thiooxidans DMS010]
 gi|224464425|gb|EEF80685.1| phosphate regulon transcriptional regulatory protein PhoB
           [Methylophaga thiooxydans DMS010]
          Length = 230

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 61/135 (45%), Gaps = 5/135 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+V+    +R +        GF            +F +K+  P+ +++D  + G   
Sbjct: 3   TSVLVVEDDVAIRDMLSFTLKQAGFGCDSVGDGEAGLDFLKKQ-QPDMILLDWMLPGIDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +EFI  +R      ++ V  L  + + E M+ G   GA+ ++ KPF+   L   +R + +
Sbjct: 62  IEFIRRLRANEFLANIPVIMLTAKGESEDMVKGLAVGADDYVNKPFSPPELMARIRAVLR 121

Query: 120 MQK--SKDENQFLDA 132
             +  S DE Q L +
Sbjct: 122 RCQPDSSDEGQQLQS 136


>gi|308185867|ref|YP_003929998.1| phosphate regulon transcriptional regulatory protein phoB [Pantoea
           vagans C9-1]
 gi|317047132|ref|YP_004114780.1| winged helix family two component transcriptional regulator
           [Pantoea sp. At-9b]
 gi|308056377|gb|ADO08549.1| Phosphate regulon transcriptional regulatory protein phoB [Pantoea
           vagans C9-1]
 gi|316948749|gb|ADU68224.1| two component transcriptional regulator, winged helix family
           [Pantoea sp. At-9b]
          Length = 229

 Score =  153 bits (389), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAVGKLI-EPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELMARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|295394513|ref|ZP_06804736.1| response regulator [Brevibacterium mcbrellneri ATCC 49030]
 gi|294972692|gb|EFG48544.1| response regulator [Brevibacterium mcbrellneri ATCC 49030]
          Length = 252

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 54/125 (43%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           +LL+VD    +R++        GF V  A +  +A    E+   P+ LV+D  +  +  F
Sbjct: 13  TLLVVDDEPNIRELLSTSLRFAGFDVVSAANGADALRLAEQND-PDLLVLDVMLPDMDGF 71

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  + V +L    D    I G   G + ++ KPF+ E +   +R + +   
Sbjct: 72  TVTRRLRQAGKHMPVVFLTARDDTSDKITGLTVGGDDYVTKPFSLEEVVARIRAVLRRTH 131

Query: 123 SKDEN 127
           + DE 
Sbjct: 132 ALDEE 136


>gi|56422009|ref|YP_149327.1| two-component response regulator [Geobacillus kaustophilus HTA426]
 gi|297531668|ref|YP_003672943.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. C56-T3]
 gi|56381851|dbj|BAD77759.1| two-component response regulator [Geobacillus kaustophilus HTA426]
 gi|297254920|gb|ADI28366.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. C56-T3]
          Length = 237

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 51/129 (39%), Gaps = 6/129 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V  A    EA +  E E +P+ +++D  +     
Sbjct: 3   KRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVE-ETMPDLILLDIMLPLKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  MEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKSKDENQ 128
                   +
Sbjct: 119 RHAQTANQE 127


>gi|3236110|emb|CAA04532.1| arcA [Lactococcus lactis]
          Length = 233

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 51/120 (42%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      GF VF A    EA E   KE+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGFEVFTAFDGEEALEAF-KEVQPDLILLDLMLPKLD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++   +D  +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLDVA-REIRKTSDTPIIMVSAKDSEFDKVIGLELGADDYVTKPFSNRELLARIKANLRR 118


>gi|54307731|ref|YP_128751.1| sensory box sensor histidine kinase/response regulator
           [Photobacterium profundum SS9]
 gi|46912154|emb|CAG18949.1| hypothetical sensory box sensor histidine kinase/response regulator
           [Photobacterium profundum SS9]
          Length = 1131

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 33/132 (25%), Positives = 60/132 (45%), Gaps = 3/132 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD   +  +V  +     G+ V  A S  +A +  E++  P  +++D  M  +   E
Sbjct: 725 LLVVDDEPVNLQVLNNFLRLEGYRVLTADSGPQALKIIEQQ-QPALILLDIMMPEMSGYE 783

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+     ++ +  L      +  I G  +GAN +L KPFN+E L   +    Q  
Sbjct: 784 VCHILREEYSLIELPIIMLSALGQVQDRIKGFESGANDYLTKPFNKEELIARISAHLQAG 843

Query: 122 KSKDENQFLDAI 133
           K++ + Q   A+
Sbjct: 844 KTEVQRQKNAAL 855


>gi|206891156|ref|YP_002249147.1| two-component hybrid sensor and regulator [Thermodesulfovibrio
           yellowstonii DSM 11347]
 gi|206743094|gb|ACI22151.1| two-component hybrid sensor and regulator [Thermodesulfovibrio
           yellowstonii DSM 11347]
          Length = 356

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 26/137 (18%), Positives = 59/137 (43%), Gaps = 6/137 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+VD +    ++ R      G+   EA    EA +    E+ P+ +++D  M  +  
Sbjct: 6   QTILIVDDNIDTVELLRKRLKAEGYNTEEAYDGEEALKKVY-EVYPDLIILDVMMPKMDG 64

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++       + +  L  + D E  + G   GA+ ++ KPF+   L   +R L  
Sbjct: 65  YEVCQRLKTDDRTKFIPIIMLTAKSDVESKVKGFDIGADDYVPKPFDYRELSARVRSLIT 124

Query: 120 MQKSKD---ENQFLDAI 133
            +++ +   E +  +++
Sbjct: 125 RKETAEKVIEEEKTESV 141


>gi|169831576|ref|YP_001717558.1| two component transcriptional regulator [Candidatus Desulforudis
           audaxviator MP104C]
 gi|169638420|gb|ACA59926.1| two component transcriptional regulator, winged helix family
           [Candidatus Desulforudis audaxviator MP104C]
          Length = 231

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 50/130 (38%), Gaps = 3/130 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+    + ++ R+     GF V EA     A E        + +V+D  + G+ 
Sbjct: 1   MARILVVEDEKHIVELMRYGLEKEGFQVVEANDGDRALEMVHTG-RIDLVVLDIMLPGLD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +RQ     D+ V  L         + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLTVCRLLRQNERTRDIPVIILSARGQELDRVLGLELGADDYITKPFSVRELVARVKARL 119

Query: 119 QMQKSKDENQ 128
           +      E +
Sbjct: 120 RRHVPVQEAR 129


>gi|238919113|ref|YP_002932627.1| phosphate regulon transcriptional regulatory protein PhoB,
           [Edwardsiella ictaluri 93-146]
 gi|238868681|gb|ACR68392.1| phosphate regulon transcriptional regulatory protein PhoB, putative
           [Edwardsiella ictaluri 93-146]
          Length = 229

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 52/120 (43%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R +   +    G+   EA S   A      E  P+ +++D  + G    
Sbjct: 4   RILVVEDETPIRDMVSFVLEQNGYQPLEAESYDGALSQLC-EPYPDLILLDWMLPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             I  +++ P   D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLIKQLKREPATRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMRR 122


>gi|148381483|ref|YP_001256024.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC
           3502]
 gi|153931315|ref|YP_001385858.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC
           19397]
 gi|153937839|ref|YP_001389265.1| DNA-binding response regulator [Clostridium botulinum A str. Hall]
 gi|153940381|ref|YP_001392897.1| DNA-binding response regulator [Clostridium botulinum F str.
           Langeland]
 gi|168181012|ref|ZP_02615676.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916]
 gi|168183623|ref|ZP_02618287.1| DNA-binding response regulator [Clostridium botulinum Bf]
 gi|170755568|ref|YP_001783183.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra]
 gi|226950999|ref|YP_002806090.1| DNA-binding response regulator [Clostridium botulinum A2 str.
           Kyoto]
 gi|237797004|ref|YP_002864556.1| DNA-binding response regulator [Clostridium botulinum Ba4 str. 657]
 gi|148290967|emb|CAL85103.1| two-component response regulator [Clostridium botulinum A str. ATCC
           3502]
 gi|152927359|gb|ABS32859.1| DNA-binding response regulator [Clostridium botulinum A str. ATCC
           19397]
 gi|152933753|gb|ABS39252.1| DNA-binding response regulator [Clostridium botulinum A str. Hall]
 gi|152936277|gb|ABS41775.1| DNA-binding response regulator [Clostridium botulinum F str.
           Langeland]
 gi|169120780|gb|ACA44616.1| DNA-binding response regulator [Clostridium botulinum B1 str. Okra]
 gi|182668045|gb|EDT80024.1| DNA-binding response regulator [Clostridium botulinum NCTC 2916]
 gi|182673177|gb|EDT85138.1| DNA-binding response regulator [Clostridium botulinum Bf]
 gi|226841937|gb|ACO84603.1| DNA-binding response regulator [Clostridium botulinum A2 str.
           Kyoto]
 gi|229261601|gb|ACQ52634.1| DNA-binding response regulator [Clostridium botulinum Ba4 str. 657]
 gi|295320874|gb|ADG01252.1| DNA-binding response regulator [Clostridium botulinum F str.
           230613]
 gi|322807868|emb|CBZ05443.1| response regulator (CheY-like receiver domain and HTH-type
           DNA-binding domain) [Clostridium botulinum H04402 065]
          Length = 228

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 59/133 (44%), Gaps = 8/133 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + +V +    + G+      +  EA+E    E  P+ +++D  +  +   
Sbjct: 7   KVLVVDDDENIAEVIKMYLENSGYDTRVCYNGKEAQEGFL-EYKPDLVLLDIMLPHIDGV 65

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+    + + +  L  + D    +     GA+ +++KPF  + L   ++ + + 
Sbjct: 66  DVLKWIRKD---STIPIIMLTAKGDTFDKVLALELGADDYIVKPFEPKELLARVKAVLRR 122

Query: 121 QKSKDENQFLDAI 133
               +EN+  +A+
Sbjct: 123 YNVDNENK--EAL 133


>gi|330446710|ref|ZP_08310362.1| phosphate regulon transcriptional regulatory protein PhoB
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
 gi|328490901|dbj|GAA04859.1| phosphate regulon transcriptional regulatory protein PhoB
           [Photobacterium leiognathi subsp. mandapamensis
           svers.1.1.]
          Length = 229

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 25/121 (20%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A E    E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAIEAEDYDTALEKMC-EPYPELILMDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  L   + V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHLKRDELTRQIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARLKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|302552415|ref|ZP_07304757.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces viridochromogenes DSM 40736]
 gi|302470033|gb|EFL33126.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces viridochromogenes DSM 40736]
          Length = 245

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 27/119 (22%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A +       P+ +V+D  M  +  
Sbjct: 11  QRILIVDDEPAVREALQRSLAFEGYGTEVAVDGADALDKAAA-YRPDLVVLDIQMPRMDG 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 70  LTAARRIRATGDTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 128


>gi|226310980|ref|YP_002770874.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226093928|dbj|BAH42370.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 231

 Score =  153 bits (388), Expect = 7e-36,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 55/128 (42%), Gaps = 5/128 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    + K+ +      GF V  A    +A E  + E  P+++++D  +  + 
Sbjct: 1   MIKVLVVDDEASIVKLLQFNLEKSGFQVVTAFDGKQALEVVKSE-QPDFIILDLMLPKMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +RQ     +  +  L  + D    I G   GA+ +L KPF+   +   ++ + 
Sbjct: 60  GMDVCKTLRQERN--NTPILMLTAKDDELDKILGLELGADDYLTKPFSPREVIARVKAIL 117

Query: 119 QMQKSKDE 126
           +  ++  E
Sbjct: 118 RRFQNTPE 125


>gi|258515194|ref|YP_003191416.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778899|gb|ACV62793.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 236

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 52/127 (40%), Gaps = 3/127 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+VD    V ++ R      G+ V  A     A E   +   P+ +V+D  M G+ 
Sbjct: 1   MPNILVVDDEQNVLEIVRFNLERAGYKVITAKDGNIALELA-RSRNPDLIVLDLLMPGLD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +++ P    + +  L    D    + G   GA+ ++ KPF+   L   +    
Sbjct: 60  GYSICRLLQRDPATRRIPIIMLSARSDELDKVLGLEMGADDYITKPFSPRELVARVNARL 119

Query: 119 QMQKSKD 125
           +  K ++
Sbjct: 120 RRDKKEE 126


>gi|170760192|ref|YP_001788883.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169407181|gb|ACA55592.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 228

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 59/133 (44%), Gaps = 8/133 (6%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + +V +    + G+      +  EA+E    E  P+ +++D  +  +   
Sbjct: 7   KVLVVDDDENIAEVIKMYLENSGYDTRVCYNGKEAQEGFL-EYKPDLVLLDIMLPHIDGV 65

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+    + + +  L  + D    +     GA+ +++KPF  + L   ++ + + 
Sbjct: 66  DVLKWIRKD---STIPIIMLTAKGDTFDKVLALELGADDYIVKPFEPKELLARVKAVLRR 122

Query: 121 QKSKDENQFLDAI 133
               +EN+  +A+
Sbjct: 123 YNVDNENK--EAL 133


>gi|116333280|ref|YP_794807.1| DNA-binding response regulator [Lactobacillus brevis ATCC 367]
 gi|116098627|gb|ABJ63776.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus brevis ATCC 367]
          Length = 235

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 17/125 (13%), Positives = 45/125 (36%), Gaps = 1/125 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + ++      + V  A    +A      E   + +++D  +  + 
Sbjct: 1   MSRVLVVDDEPAIVTLLQYNLEQADYQVVTAIDGEQALNLALHEK-FDVILLDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R         +  +  +      + G   GA+ ++ KPF+   +   M+ + + 
Sbjct: 60  GVEVTKRLRQEKVKTPIIMITAKTSEFDTVFGLELGADDYITKPFSPREVIARMKAVMRR 119

Query: 121 QKSKD 125
              ++
Sbjct: 120 YHEEE 124


>gi|328956405|ref|YP_004373791.1| two-component response regulator [Carnobacterium sp. 17-4]
 gi|328672729|gb|AEB28775.1| two-component response regulator [Carnobacterium sp. 17-4]
          Length = 235

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  + +      G+ VF A    EA E  E E+LP+ +++D  +    
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGYEVFTAYDGEEALEKVE-EVLPDLIILDLMLPKKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    VR+     D+ +  +  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCREVRKN---HDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELTARVKANL 116

Query: 119 QMQKSKD 125
           +   +  
Sbjct: 117 RRHDNAK 123


>gi|282860432|ref|ZP_06269498.1| two component transcriptional regulator, winged helix family
           [Streptomyces sp. ACTE]
 gi|282564168|gb|EFB69704.1| two component transcriptional regulator, winged helix family
           [Streptomyces sp. ACTE]
          Length = 243

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A    E    P+ +V+D  M  +  
Sbjct: 9   QRVLIVDDEPAVREALQRSLAFEGYGTEVAVDGYDALAKVEA-YAPDLIVLDIQMPRMDG 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+   +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 68  LTAARRIRSTGSTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 126


>gi|323701350|ref|ZP_08113024.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323533609|gb|EGB23474.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 235

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 50/124 (40%), Gaps = 3/124 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    + ++ ++        V  A    E     ++E  P+ +++D  +    
Sbjct: 1   MAKILVVDDETNILELIKYNLEKDNHRVITALDGEEGLRLAQQEP-PDLIILDVMLPKVD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    +R  P  + + +  +    +    + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCRCLRSHPSTSRLPILMVSARRETVDHVVGLEMGADDYITKPFSPRELAARVKANL 119

Query: 119 QMQK 122
           +  +
Sbjct: 120 RRAQ 123


>gi|320009468|gb|ADW04318.1| two component transcriptional regulator, winged helix family
           [Streptomyces flavogriseus ATCC 33331]
          Length = 243

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A    E    P+ +V+D  M  +  
Sbjct: 9   QRVLIVDDEPAVREALQRSLAFEGYGTEVAVDGYDALAKAES-YAPDLIVLDIQMPRMDG 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+   +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 68  LTAARRIRSTGSTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 126


>gi|119511035|ref|ZP_01630155.1| Two component Transcriptional regulator, Winged helix family
           protein [Nodularia spumigena CCY9414]
 gi|119464286|gb|EAW45203.1| Two component Transcriptional regulator, Winged helix family
           protein [Nodularia spumigena CCY9414]
          Length = 242

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKSE-PDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|39996204|ref|NP_952155.1| DNA-binding response regulator [Geobacter sulfurreducens PCA]
 gi|39982969|gb|AAR34428.1| DNA-binding response regulator [Geobacter sulfurreducens PCA]
 gi|298505216|gb|ADI83939.1| winged-helix phosphate transcriptional response regulator
           [Geobacter sulfurreducens KN400]
          Length = 225

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 17/122 (13%), Positives = 48/122 (39%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+++    +  +        G+    A       E    +  P+ +++D  + G++
Sbjct: 1   MKTILIIEDERDLADLVAFNLEKEGYRTLTALDGANGLELARSQP-PDLILLDLMLPGMM 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +++      + V  L    +    + G   GA+ +++KPF+   L   ++ + 
Sbjct: 60  GMEVCKILKKSEKTAHIPVIMLTARGEEIDRVVGFEVGADDYVVKPFSTRELLLRVKAVL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|22124885|ref|NP_668308.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis KIM 10]
 gi|45440577|ref|NP_992116.1| phosphate regulon transcriptional regulator [Yersinia pestis biovar
           Microtus str. 91001]
 gi|165926563|ref|ZP_02222395.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|166011007|ref|ZP_02231905.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166212953|ref|ZP_02238988.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|167399213|ref|ZP_02304737.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167421696|ref|ZP_02313449.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167423518|ref|ZP_02315271.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|270489463|ref|ZP_06206537.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis KIM D27]
 gi|294504931|ref|YP_003568993.1| positive response regulator for pho regulon [Yersinia pestis
           Z176003]
 gi|21957719|gb|AAM84559.1|AE013701_4 positive response regulator for pho regulon [Yersinia pestis KIM
           10]
 gi|45435434|gb|AAS60993.1| phosphate regulon transcriptional regulatory protein [Yersinia
           pestis biovar Microtus str. 91001]
 gi|165921491|gb|EDR38688.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Orientalis str. F1991016]
 gi|165990007|gb|EDR42308.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Antiqua str. E1979001]
 gi|166205740|gb|EDR50220.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Antiqua str. B42003004]
 gi|166960615|gb|EDR56636.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Orientalis str. MG05-1020]
 gi|167051717|gb|EDR63125.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Antiqua str. UG05-0454]
 gi|167057688|gb|EDR67434.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis biovar Mediaevalis str. K1973002]
 gi|262362995|gb|ACY59716.1| positive response regulator for pho regulon [Yersinia pestis
           D106004]
 gi|262366919|gb|ACY63476.1| positive response regulator for pho regulon [Yersinia pestis
           D182038]
 gi|270337967|gb|EFA48744.1| phosphate regulon transcriptional regulatory protein PhoB [Yersinia
           pestis KIM D27]
 gi|294355390|gb|ADE65731.1| positive response regulator for pho regulon [Yersinia pestis
           Z176003]
          Length = 239

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 13  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVARL-SEPFPDLVLLDWMLPGGSG 71

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 72  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 131

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 132 RISPMAVEEVIE 143


>gi|229551746|ref|ZP_04440471.1| response regulator [Lactobacillus rhamnosus LMS2-1]
 gi|258507899|ref|YP_003170650.1| two-component response regulator [Lactobacillus rhamnosus GG]
 gi|258539145|ref|YP_003173644.1| two-component response regulator [Lactobacillus rhamnosus Lc 705]
 gi|229314877|gb|EEN80850.1| response regulator [Lactobacillus rhamnosus LMS2-1]
 gi|257147826|emb|CAR86799.1| Two-component response regulator [Lactobacillus rhamnosus GG]
 gi|257150821|emb|CAR89793.1| Two-component response regulator [Lactobacillus rhamnosus Lc 705]
 gi|259649226|dbj|BAI41388.1| two-component response regulator [Lactobacillus rhamnosus GG]
          Length = 234

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 51/126 (40%), Gaps = 1/126 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + ++      + V  AT   EA +    E   +++++D  +  + 
Sbjct: 1   MKKILIVDDEPAILTLLQYNLEAEHYQVETATDGQEALDKVRSEP-FDFIILDLMLPSLS 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +         +  L  + +    I G   GA+ ++ KPF+   +   ++ + + 
Sbjct: 60  GLDVTRKIREEKIQTPIMILTAKDNETDKIVGLELGADDYVTKPFSPREIIARIKAIERR 119

Query: 121 QKSKDE 126
            +S+ +
Sbjct: 120 SQSQPQ 125


>gi|149914856|ref|ZP_01903385.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. AzwK-3b]
 gi|149811044|gb|EDM70881.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. AzwK-3b]
          Length = 229

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           S+LLV+     R+V  +     GF V  A +  EA      E  P+ +V+D  +     +
Sbjct: 7   SVLLVEDEPAQREVLSYNLEADGFRVTTAENGEEAL-LLVDEAAPDIIVLDWMLPNVSGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++      +V +  L    +    + G   GA+ +++KP++   L   +R L + 
Sbjct: 66  EVCRQLKTRADTRNVPILMLSARSEEVDRVRGLETGADDYVVKPYSVIELMARVRALLRR 125

Query: 121 QKSKDENQFLD 131
            +     + L+
Sbjct: 126 SRPSAVGERLE 136


>gi|261420883|ref|YP_003254565.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC61]
 gi|319768554|ref|YP_004134055.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC52]
 gi|261377340|gb|ACX80083.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC61]
 gi|317113420|gb|ADU95912.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y412MC52]
          Length = 237

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 24/129 (18%), Positives = 51/129 (39%), Gaps = 6/129 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V  A    EA +  E E +P+ +++D  +     
Sbjct: 3   KRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVE-ETMPDLILLDIMLPLKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  MEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKSKDENQ 128
                   +
Sbjct: 119 RHAQTANQE 127


>gi|15640738|ref|NP_230368.1| DNA-binding response regulator PhoB [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|121590901|ref|ZP_01678224.1| DNA-binding response regulator PhoB [Vibrio cholerae 2740-80]
 gi|121728615|ref|ZP_01681635.1| DNA-binding response regulator PhoB [Vibrio cholerae V52]
 gi|147674650|ref|YP_001216209.1| DNA-binding response regulator PhoB [Vibrio cholerae O395]
 gi|153216130|ref|ZP_01950285.1| DNA-binding response regulator PhoB [Vibrio cholerae 1587]
 gi|153803530|ref|ZP_01958116.1| DNA-binding response regulator PhoB [Vibrio cholerae MZO-3]
 gi|153818850|ref|ZP_01971517.1| DNA-binding response regulator PhoB [Vibrio cholerae NCTC 8457]
 gi|153823136|ref|ZP_01975803.1| DNA-binding response regulator PhoB [Vibrio cholerae B33]
 gi|153827132|ref|ZP_01979799.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MZO-2]
 gi|153831184|ref|ZP_01983851.1| DNA-binding response regulator PhoB [Vibrio cholerae 623-39]
 gi|227080898|ref|YP_002809449.1| DNA-binding response regulator PhoB [Vibrio cholerae M66-2]
 gi|229505665|ref|ZP_04395175.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae BX 330286]
 gi|229510663|ref|ZP_04400142.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae B33]
 gi|229513140|ref|ZP_04402606.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae TMA 21]
 gi|229517785|ref|ZP_04407229.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae RC9]
 gi|229523456|ref|ZP_04412863.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae TM 11079-80]
 gi|229525367|ref|ZP_04414772.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae bv. albensis VL426]
 gi|229530150|ref|ZP_04419540.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae 12129(1)]
 gi|229608683|ref|YP_002879331.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MJ-1236]
 gi|254224992|ref|ZP_04918606.1| DNA-binding response regulator PhoB [Vibrio cholerae V51]
 gi|254285442|ref|ZP_04960406.1| DNA-binding response regulator PhoB [Vibrio cholerae AM-19226]
 gi|254847860|ref|ZP_05237210.1| DNA-binding response regulator PhoB [Vibrio cholerae MO10]
 gi|255744531|ref|ZP_05418482.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholera CIRS 101]
 gi|258623634|ref|ZP_05718625.1| DNA-binding response regulator PhoB [Vibrio mimicus VM573]
 gi|258626940|ref|ZP_05721742.1| DNA-binding response regulator PhoB [Vibrio mimicus VM603]
 gi|262161335|ref|ZP_06030446.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae INDRE 91/1]
 gi|262168827|ref|ZP_06036522.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae RC27]
 gi|262172206|ref|ZP_06039884.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           mimicus MB-451]
 gi|297581122|ref|ZP_06943046.1| DNA-binding response regulator PhoB [Vibrio cholerae RC385]
 gi|298499143|ref|ZP_07008950.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MAK 757]
 gi|9655162|gb|AAF93884.1| DNA-binding response regulator PhoB [Vibrio cholerae O1 biovar El
           Tor str. N16961]
 gi|99031006|gb|ABF61789.1| DNA-binding response regulator PhoB [Vibrio cholerae O395]
 gi|121547266|gb|EAX57389.1| DNA-binding response regulator PhoB [Vibrio cholerae 2740-80]
 gi|121629123|gb|EAX61567.1| DNA-binding response regulator PhoB [Vibrio cholerae V52]
 gi|124114445|gb|EAY33265.1| DNA-binding response regulator PhoB [Vibrio cholerae 1587]
 gi|124120940|gb|EAY39683.1| DNA-binding response regulator PhoB [Vibrio cholerae MZO-3]
 gi|125622379|gb|EAZ50699.1| DNA-binding response regulator PhoB [Vibrio cholerae V51]
 gi|126510632|gb|EAZ73226.1| DNA-binding response regulator PhoB [Vibrio cholerae NCTC 8457]
 gi|126519353|gb|EAZ76576.1| DNA-binding response regulator PhoB [Vibrio cholerae B33]
 gi|146316533|gb|ABQ21072.1| DNA-binding response regulator PhoB [Vibrio cholerae O395]
 gi|148873340|gb|EDL71475.1| DNA-binding response regulator PhoB [Vibrio cholerae 623-39]
 gi|149738998|gb|EDM53310.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MZO-2]
 gi|150424304|gb|EDN16241.1| DNA-binding response regulator PhoB [Vibrio cholerae AM-19226]
 gi|227008786|gb|ACP04998.1| DNA-binding response regulator PhoB [Vibrio cholerae M66-2]
 gi|227012543|gb|ACP08753.1| DNA-binding response regulator PhoB [Vibrio cholerae O395]
 gi|229333924|gb|EEN99410.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae 12129(1)]
 gi|229338948|gb|EEO03965.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae bv. albensis VL426]
 gi|229339819|gb|EEO04834.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae TM 11079-80]
 gi|229344500|gb|EEO09474.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae RC9]
 gi|229350033|gb|EEO14987.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae TMA 21]
 gi|229350628|gb|EEO15569.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae B33]
 gi|229357888|gb|EEO22805.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae BX 330286]
 gi|229371338|gb|ACQ61761.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MJ-1236]
 gi|254843565|gb|EET21979.1| DNA-binding response regulator PhoB [Vibrio cholerae MO10]
 gi|255737562|gb|EET92956.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholera CIRS 101]
 gi|258580764|gb|EEW05711.1| DNA-binding response regulator PhoB [Vibrio mimicus VM603]
 gi|258584085|gb|EEW08843.1| DNA-binding response regulator PhoB [Vibrio mimicus VM573]
 gi|261893282|gb|EEY39268.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           mimicus MB-451]
 gi|262022945|gb|EEY41651.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae RC27]
 gi|262029085|gb|EEY47738.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae INDRE 91/1]
 gi|297534438|gb|EFH73275.1| DNA-binding response regulator PhoB [Vibrio cholerae RC385]
 gi|297543476|gb|EFH79526.1| phosphate regulon transcriptional regulatory protein PhoB [Vibrio
           cholerae MAK 757]
 gi|327483513|gb|AEA77920.1| Phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Vibrio cholerae LMA3894-4]
          Length = 229

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMLCFVLEQKGYQAVEAEDYDSAMSKL-AEPFPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++  +  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLIKHMKREEMTRNIPVVMLTARGEEEDKVRGLEVGADDYITKPFSPKELVARLKAVIR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|304395459|ref|ZP_07377342.1| two component transcriptional regulator, winged helix family
           [Pantoea sp. aB]
 gi|304356753|gb|EFM21117.1| two component transcriptional regulator, winged helix family
           [Pantoea sp. aB]
          Length = 229

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAVGRLI-EPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELMARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|302390009|ref|YP_003825830.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
 gi|302200637|gb|ADL08207.1| two component transcriptional regulator, winged helix family
           [Thermosediminibacter oceani DSM 16646]
          Length = 227

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 54/131 (41%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    +  + +      GF V EA    +A +   K    N +++D  +  +   
Sbjct: 5   RILVVDDEEKIVDLVKLYLEKEGFKVDEAHDGQQALDMIAKGEY-NLIILDLMLPVIDGW 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                VR+    +D+ +  L    +    + G   GA+ +++KPF+   L   ++ L + 
Sbjct: 64  TVCKEVRKK---SDIPIIMLTARGEEFDKVLGFELGADDYVVKPFSPRELVARVKALLRR 120

Query: 121 QKSKDENQFLD 131
              K   Q L+
Sbjct: 121 LGPKGPEQTLE 131


>gi|330505652|ref|YP_004382521.1| two component transcriptional regulator [Pseudomonas mendocina
           NK-01]
 gi|328919938|gb|AEB60769.1| two component transcriptional regulator [Pseudomonas mendocina
           NK-01]
          Length = 229

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   KNILIVDDEAPIREMIAVALEMAGYECLEAENTQQA-HAVIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L +D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTSDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|219669756|ref|YP_002460191.1| transcriptional regulator [Desulfitobacterium hafniense DCB-2]
 gi|219540016|gb|ACL21755.1| two component transcriptional regulator, winged helix family
           [Desulfitobacterium hafniense DCB-2]
          Length = 230

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+++L++D    +R + R      G+ V EA +  EA E  +K+     +V D  M  + 
Sbjct: 1   MNAILVIDDEERIRHLVRMYLEREGYEVDEAGNGREALEKFQKQDYALLIV-DLMMPEID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  VR+    +D+ +  L    +    + G   GA+ +L+KPF+ + L   ++ L 
Sbjct: 60  GWKVCRDVRER---SDIPIIMLTARGEEFDRVLGFELGADDYLVKPFSTKELVARVKALL 116

Query: 119 QMQK 122
           +  +
Sbjct: 117 RRSR 120


>gi|292492323|ref|YP_003527762.1| phosphate regulon transcriptional regulatory protein PhoB
           [Nitrosococcus halophilus Nc4]
 gi|291580918|gb|ADE15375.1| phosphate regulon transcriptional regulatory protein PhoB
           [Nitrosococcus halophilus Nc4]
          Length = 229

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 52/120 (43%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+VD    +R++   +    G+    A    +A +    E  P+ +++D  + G+   
Sbjct: 4   TILVVDDETAIREMLGFVLTQEGYNYQAAADAEQAWQRL-NESHPDLILLDWMLPGISGV 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++ P    + +  L    D E  + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DLARRLKREPNTRSLPLIMLTARDDEEDKVRGLNVGADDYITKPFSPTELIARVKAVLRR 122


>gi|260584310|ref|ZP_05852057.1| DNA-binding response regulator VicR [Granulicatella elegans ATCC
           700633]
 gi|260157828|gb|EEW92897.1| DNA-binding response regulator VicR [Granulicatella elegans ATCC
           700633]
          Length = 238

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  + +   +  GF V  A    E       E  P+ +++D  +    
Sbjct: 1   MKKILVVDDEKPISDIVKFSLSKEGFEVVTAFDGEEGLAVFSAEN-PDLVILDLMLPKIE 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    +R+    ++V +  +  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCREIRK---TSNVPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELIARVKANL 116

Query: 119 QMQK 122
           + Q 
Sbjct: 117 RRQH 120


>gi|89895322|ref|YP_518809.1| hypothetical protein DSY2576 [Desulfitobacterium hafniense Y51]
 gi|89334770|dbj|BAE84365.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 230

 Score =  153 bits (388), Expect = 8e-36,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+++L++D    +R + R      G+ V EA +  EA E  +K+     +V D  M  + 
Sbjct: 1   MNAILVIDDEERIRHLVRMYLEREGYEVDEAGNGREALEKFQKQDYALLIV-DLMMPEID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  VR+    +D+ +  L    +    + G   GA+ +L+KPF+ + L   ++ L 
Sbjct: 60  GWKVCRDVRER---SDIPIIMLTARGEEFDRVLGFELGADDYLVKPFSTKELVARVKALL 116

Query: 119 QMQK 122
           +  +
Sbjct: 117 RRSR 120


>gi|319779219|ref|YP_004130132.1| Two-component system response regulator OmpR [Taylorella
           equigenitalis MCE9]
 gi|317109243|gb|ADU91989.1| Two-component system response regulator OmpR [Taylorella
           equigenitalis MCE9]
          Length = 247

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 24/119 (20%), Positives = 48/119 (40%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++ +    + G+ V       E  + C++E   N +V+D  + G   
Sbjct: 9   KKILVVDDDPRLRELLKKYLTEQGYTVTAVEDGKEMSKACQREN-FNIIVLDIMLPGEDG 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                R         +  L  + +    I G   GA+ +++KPFN   L   +  + + 
Sbjct: 68  LSICRRLRATNDMTPIIMLTAKSEDIDRIIGLEMGADDYIVKPFNPRELLARINAVLRR 126


>gi|226939099|ref|YP_002794170.1| PhoB [Laribacter hongkongensis HLHK9]
 gi|226714023|gb|ACO73161.1| PhoB [Laribacter hongkongensis HLHK9]
          Length = 229

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 57/124 (45%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++LLV+    ++++        G  V  A S   A +   K  LP+ +++D  + G   +
Sbjct: 4   TILLVEDEPAIQELIAFNLAQSGHQVLRAASAEAA-QTLVKNALPDLVLLDWMLPGQSGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           EF   +R      +V +  L    D +  IAG   GA+ ++ KPF+   L+  ++ + + 
Sbjct: 63  EFARRLRSDERTREVPIIMLTARSDEQDKIAGLETGADDYITKPFSPRELQARIKAVLRR 122

Query: 121 QKSK 124
           +  +
Sbjct: 123 RAPQ 126


>gi|146309422|ref|YP_001189887.1| two component transcriptional regulator [Pseudomonas mendocina ymp]
 gi|145577623|gb|ABP87155.1| two component transcriptional regulator, winged helix family
           [Pseudomonas mendocina ymp]
          Length = 229

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   KNILIVDDEAPIREMIAVALEMAGYECLEAENTQQA-HAVIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L +D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTSDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|90415561|ref|ZP_01223495.1| DNA-binding response regulator PhoB [marine gamma proteobacterium
           HTCC2207]
 gi|90332884|gb|EAS48054.1| DNA-binding response regulator PhoB [marine gamma proteobacterium
           HTCC2207]
          Length = 240

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 55/128 (42%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +L+VD    +R +        GF V +A +  +A         P+ +++D  M G   L
Sbjct: 12  RILIVDDEAAIRDMLSIALEAAGFNVLQADNAQQAHASIIDN-QPDLVLLDWMMPGTTGL 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E +  +++  L     +  L  + + +  IAG  +GA+ ++ KPF+   L   +  + + 
Sbjct: 71  ELLRRLKRDELTAKTPIIMLTAKAEEDSKIAGLDSGADDYIPKPFSPRELISRVNAVLRR 130

Query: 121 QKSKDENQ 128
              +   +
Sbjct: 131 IGREALKE 138


>gi|90961025|ref|YP_534941.1| two-component response regulator [Lactobacillus salivarius UCC118]
 gi|227891713|ref|ZP_04009518.1| response regulator [Lactobacillus salivarius ATCC 11741]
 gi|301299933|ref|ZP_07206164.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Lactobacillus salivarius ACS-116-V-Col5a]
 gi|90820219|gb|ABD98858.1| Two-component response regulator [Lactobacillus salivarius UCC118]
 gi|227866516|gb|EEJ73937.1| response regulator [Lactobacillus salivarius ATCC 11741]
 gi|300213968|gb|ADJ78384.1| Two-component response regulator [Lactobacillus salivarius CECT
           5713]
 gi|300852478|gb|EFK80131.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Lactobacillus salivarius ACS-116-V-Col5a]
          Length = 236

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 53/123 (43%), Gaps = 2/123 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V+ A    EA +   KE+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGYDVYTAYDGEEALQQV-KEVEPDLILLDLMLPKID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKTHDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118

Query: 121 QKS 123
           Q +
Sbjct: 119 QSA 121


>gi|88799154|ref|ZP_01114734.1| phosphate regulon transcriptional regulatory protein PhoB [Reinekea
           sp. MED297]
 gi|88778137|gb|EAR09332.1| phosphate regulon transcriptional regulatory protein PhoB [Reinekea
           sp. MED297]
          Length = 240

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 58/121 (47%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R+V        G+   EA++  +A      +  P+ +++D  M     
Sbjct: 9   RSILIVDDEAPIREVIAAALEMAGYRTLEASNAQDAHSIVVDQK-PDLILLDWMMPQVSG 67

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +EF   +++ PL  ++ +  L  + + +  I G  AGA+ ++ KPF+   L   ++ + +
Sbjct: 68  VEFARRLKRDPLTAEIPIIMLTAKGEEDHKITGLEAGADDYITKPFSPRELVARLKAVLR 127

Query: 120 M 120
            
Sbjct: 128 R 128


>gi|290959362|ref|YP_003490544.1| two-component systen response regulator [Streptomyces scabiei
           87.22]
 gi|260648888|emb|CBG72002.1| putative two-component systen response regulator [Streptomyces
           scabiei 87.22]
          Length = 244

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 45/119 (37%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR   R      G+    A    +A E       P+ +++D  M  +  
Sbjct: 11  QRILIVDDEPAVRDALRRSLAFEGYGTEVAVDGADALEKATA-YRPDLVILDVQMPRMDG 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 70  LTAARRIRGAGDTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARVRALLRR 128


>gi|86608817|ref|YP_477579.1| DNA-binding response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86557359|gb|ABD02316.1| DNA-binding response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 247

 Score =  153 bits (388), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 32/131 (24%), Positives = 61/131 (46%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +LLVD    +R+  +    D GF V  A +  +A +       P  ++ D  M G+   
Sbjct: 19  RILLVDDEPGLREAVQAYLEDSGFEVIPAANAQQALQLL-STAQPQLIISDIMMPGMDGY 77

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F+A +R++   + + V +L  +      I G RAG +++L KPF+ E L   +  L + 
Sbjct: 78  QFLAQLRKLEPYSHLPVVFLTAKGMTADRIQGYRAGVDAYLPKPFDPEELVAIVSNLIER 137

Query: 121 QKSKDENQFLD 131
            ++   ++ + 
Sbjct: 138 SRAASPSEVVA 148


>gi|219667295|ref|YP_002457730.1| transcriptional regulator [Desulfitobacterium hafniense DCB-2]
 gi|219537555|gb|ACL19294.1| two component transcriptional regulator, winged helix family
           [Desulfitobacterium hafniense DCB-2]
          Length = 234

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +LLV+   +++++  +     G+ V  A    +A E   KE  P+ +++D  +  + 
Sbjct: 1   MVKILLVEDDAVIQELVTYNLEREGYTVMIAEEGNKALELLNKEK-PDLVLLDVMLPELD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R      ++ +  L    +    + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLDVCKKIRGNQETANIPLIMLSARDEVADRVIGLELGADDYITKPFSPRELLARIKARL 119

Query: 119 QMQK 122
           + ++
Sbjct: 120 REER 123


>gi|15894977|ref|NP_348326.1| response regulator [Clostridium acetobutylicum ATCC 824]
 gi|15024664|gb|AAK79666.1|AE007679_12 Response regulator (CheY-like receiver domain and DNA-binding HTH
           domain) [Clostridium acetobutylicum ATCC 824]
 gi|325509114|gb|ADZ20750.1| Response regulator (CheY-like receiver domain and DNA-binding HTH
           domain) [Clostridium acetobutylicum EA 2018]
          Length = 232

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 54/122 (44%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + K+ +    + G+ V  A    EA E  + E +P  +++D  +  +   
Sbjct: 5   KILVVDDEEHIVKLIKFNLENNGYKVITAADGGEALEKAKGE-VPQLVLLDLMLPVMDGY 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +++ V  +  + +    I G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 64  DVCREIRRDQSISNMPVIMITAKGEELDKILGLELGADDYITKPFSVRELVARVKAVLRR 123

Query: 121 QK 122
            K
Sbjct: 124 TK 125


>gi|67921096|ref|ZP_00514615.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Crocosphaera watsonii WH 8501]
 gi|67857213|gb|EAM52453.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Crocosphaera watsonii WH 8501]
          Length = 243

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA +    E +P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDIF-HEAIPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|295104470|emb|CBL02014.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Faecalibacterium
           prausnitzii SL3/3]
          Length = 232

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 49/118 (41%), Gaps = 2/118 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++ R      G+ V  A    E  E     + P+ +++D  M  +   
Sbjct: 5   KILVVDDDANICELLRLYLTKEGYQVTVANDGEEGLEKFNA-VKPDMVLLDVMMPRMDGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               R    G +  V  L  + +    + G   GA+ +++KPF+ + +   ++ + + 
Sbjct: 64  EVCRRIRKAG-NTPVMMLTAKGETFDKVLGLELGADDYMVKPFDAKEVVARIKAVLRR 120


>gi|238787963|ref|ZP_04631759.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           frederiksenii ATCC 33641]
 gi|238723911|gb|EEQ15555.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           frederiksenii ATCC 33641]
          Length = 239

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 13  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPFPDLVLLDWMLPGGSG 71

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 72  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 131

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 132 RISPMAVEEVIE 143


>gi|238795585|ref|ZP_04639100.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           mollaretii ATCC 43969]
 gi|238720704|gb|EEQ12505.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           mollaretii ATCC 43969]
          Length = 239

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 13  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPYPDLVLLDWMLPGGSG 71

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 72  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 131

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 132 RISPMAVEEVIE 143


>gi|291616506|ref|YP_003519248.1| PhoB [Pantoea ananatis LMG 20103]
 gi|291151536|gb|ADD76120.1| PhoB [Pantoea ananatis LMG 20103]
          Length = 245

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 19  KRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAISKLI-EPWPDLILLDWMLPGGSG 77

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 78  IQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELMARIKAVMR 137

Query: 120 M 120
            
Sbjct: 138 R 138


>gi|260892544|ref|YP_003238641.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
 gi|260864685|gb|ACX51791.1| two component transcriptional regulator, winged helix family
           [Ammonifex degensii KC4]
          Length = 236

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 57/128 (44%), Gaps = 6/128 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+V+    + ++        GF V +A S  EA E  + E + + +V+D  + G+   
Sbjct: 9   TVLVVEDDRNIAELVSLYLEKHGFKVLKAASGAEALEILKNETV-DLVVLDLMLPGIDGW 67

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R     + + V  L  + + +  + G   GA+ +++KPF+ + L   ++ + + 
Sbjct: 68  EVCRQIRSN---SQLPVIMLTAKGELQDKLQGFELGADDYVVKPFDPQELIARVKAVLRR 124

Query: 121 QKSKDENQ 128
                  +
Sbjct: 125 AGETKPRR 132


>gi|47231509|gb|AAT12781.1| PhoB [Alcaligenes faecalis]
          Length = 236

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 22/125 (17%), Positives = 55/125 (44%), Gaps = 3/125 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+V+    ++++     +  G  V  A    +A +   +  LP+ +++D  + G   
Sbjct: 3   TSILVVEDEPAIQELISVNLSFAGHKVLRAFDAEQA-QILIRAELPDLILVDWMLPGSSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +     +R       + V  L  +   +  + G  AGA+ ++ KPF+ + L   ++ + +
Sbjct: 62  INLARKLRSDERTRHIPVIMLTAKGSEQDKVDGLEAGADDYITKPFSPKELIARIKAVLR 121

Query: 120 MQKSK 124
            +  +
Sbjct: 122 RRAPQ 126


>gi|323140625|ref|ZP_08075549.1| transcriptional regulatory protein ResD [Phascolarctobacterium sp.
           YIT 12067]
 gi|322414889|gb|EFY05684.1| transcriptional regulatory protein ResD [Phascolarctobacterium sp.
           YIT 12067]
          Length = 234

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 60/127 (47%), Gaps = 6/127 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+ D    +R++ R  F   GF V EA     A    + E  P+ L++D  M     
Sbjct: 6   QKILIADDEAQIREILRIYFEKEGFEVIEAEDGAAAILKVQSEK-PDILLLDIMMPVLDG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+M   +D+ +  +  + D +  IAG   GA+ ++ KPFN   +   ++ + +
Sbjct: 65  IEVCKQVRKM---SDLPIIMVTAKDDDDDRIAGLEIGADDYITKPFNSREVVARVKAVLR 121

Query: 120 MQKSKDE 126
              ++++
Sbjct: 122 RAGTQEK 128


>gi|239617306|ref|YP_002940628.1| two component transcriptional regulator, winged helix family
           [Kosmotoga olearia TBF 19.5.1]
 gi|239506137|gb|ACR79624.1| two component transcriptional regulator, winged helix family
           [Kosmotoga olearia TBF 19.5.1]
          Length = 221

 Score =  153 bits (387), Expect = 9e-36,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 61/128 (47%), Gaps = 3/128 (2%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M   +LLV+    +RK  +      G+ V  A +  +A +  EKE LP+ +++D  +  +
Sbjct: 1   MKAKVLLVEDDPHIRKFIQLELEHEGYEVKTAVTGPQALDELEKE-LPDVVLLDVMLPEM 59

Query: 60  LEFIAHVRQMPLGT-DVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             F    R     + ++ V  L    + E  + G ++GA+ +++KPF+ E L   +  + 
Sbjct: 60  NGFTVLERIREDFSTELPVIMLTARGELEDRVRGLKSGADDYIVKPFHIEELLARLEAVL 119

Query: 119 QMQKSKDE 126
           + +   ++
Sbjct: 120 RRKGYSEK 127


>gi|304317190|ref|YP_003852335.1| transcriptional regulator [Thermoanaerobacterium
           thermosaccharolyticum DSM 571]
 gi|302778692|gb|ADL69251.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium thermosaccharolyticum DSM 571]
          Length = 235

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 61/132 (46%), Gaps = 4/132 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+++    + ++ R+     G+ V    +  E  E C +EL P+ +++D  +  +   
Sbjct: 4   TILVIEDEAHILELLRYNLEAQGYNVILTDNGKEGLEKC-RELSPDLVLLDLMLPDIDGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++      ++ +  L  + +    I G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DVCKKIKSDEHLKNIPIIMLTAKSEEFDKILGLELGADDYITKPFSIRELLARIKVVLRR 122

Query: 121 QKSK-DENQFLD 131
            K++ +EN+ + 
Sbjct: 123 SKNETEENEIIK 134


>gi|89072346|ref|ZP_01158925.1| putative DNA-binding response regulator [Photobacterium sp. SKA34]
 gi|89051878|gb|EAR57330.1| putative DNA-binding response regulator [Photobacterium sp. SKA34]
          Length = 243

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 6/126 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++        GF V  A    E  + C     P+ +++D  M G   
Sbjct: 5   KQILVVDDDKEIRELLEEYLTKNGFEVQTAAEGEE-MKRCLAGGYPDLILLDIMMPGDDG 63

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F    H+R+    +DV +  L    +    I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 64  FTLCQHIRK---TSDVPIIMLTAVSEEMDQIIGLEIGADDYIAKPFSPRQLLARIKAILR 120

Query: 120 MQKSKD 125
             K  D
Sbjct: 121 RSKVSD 126


>gi|254388578|ref|ZP_05003812.1| two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
 gi|197702299|gb|EDY48111.1| two-component system response regulator [Streptomyces clavuligerus
           ATCC 27064]
          Length = 243

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    VR+  +      G+    A    +A    E    P+ LV+D  M  +   
Sbjct: 9   RILIVDDEPAVREALQRSLAFEGYATEVAVDGIDALAKAES-YRPDLLVLDIQMPRMDGL 67

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            A  R    G+ V V  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 68  TAARRLRATGSTVPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 125


>gi|327392936|dbj|BAK10358.1| phosphate regulon transcriptional regulatory protein PhoB [Pantoea
           ananatis AJ13355]
          Length = 245

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 19  KRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAVSKLI-EPWPDLILLDWMLPGGSG 77

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 78  IQFIKHLKREAMTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELMARIKAVMR 137

Query: 120 M 120
            
Sbjct: 138 R 138


>gi|119490790|ref|ZP_01623122.1| two-component hybrid sensor and regulator [Lyngbya sp. PCC 8106]
 gi|119453774|gb|EAW34932.1| two-component hybrid sensor and regulator [Lyngbya sp. PCC 8106]
          Length = 1111

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 60/122 (49%), Gaps = 2/122 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   +  +V  +  +   + + +AT+  EA    EK   P+ +++D  M  +   
Sbjct: 717 KILVVDDEPVNIQVIANNLSLQNYAITQATNGLEALTLIEKGFKPDLILLDVMMPRMTGY 776

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+  L +++ +  L  +     ++ G  +GAN +L KPF+++ L   ++   ++
Sbjct: 777 EVCQKLREKYLHSELPILMLTAKNQVTDLVDGLSSGANDYLSKPFSKQELLARIKTHLRL 836

Query: 121 QK 122
            K
Sbjct: 837 LK 838


>gi|254414140|ref|ZP_05027907.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196178815|gb|EDX73812.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 245

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E       P+ +V+D  M      
Sbjct: 10  KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETFRTSE-PDLVVLDVMMPKLDGY 68

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 69  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 125


>gi|123443385|ref|YP_001007359.1| phosphate regulon transcriptional regulatory protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
 gi|122090346|emb|CAL13214.1| phosphate regulon transcriptional regulatory protein [Yersinia
           enterocolitica subsp. enterocolitica 8081]
          Length = 229

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPYPDLVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|90577311|ref|ZP_01233122.1| putative DNA-binding response regulator [Vibrio angustum S14]
 gi|90440397|gb|EAS65577.1| putative DNA-binding response regulator [Vibrio angustum S14]
          Length = 243

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 53/126 (42%), Gaps = 6/126 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++        GF V  A    E  + C     P+ +++D  M G   
Sbjct: 5   KQILVVDDDKEIRELLEEYLTKNGFEVQTAAEGEE-MKRCLAGGYPDLILLDIMMPGDDG 63

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F    H+R+    +DV +  L    +    I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 64  FTLCQHIRK---TSDVPIIMLTAVSEEMDQIIGLEIGADDYIAKPFSPRQLLARIKAILR 120

Query: 120 MQKSKD 125
             K  D
Sbjct: 121 RSKVSD 126


>gi|56419443|ref|YP_146761.1| two-component response regulator [Geobacillus kaustophilus HTA426]
 gi|56379285|dbj|BAD75193.1| two-component response regulator [Geobacillus kaustophilus HTA426]
          Length = 224

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++  H  N  GF + EA +  EA +  E  +  + +++D  M  + 
Sbjct: 1   MTRILIVDDDAHIRELVSHFLNLEGFTIHEAANGKEALDVLET-VKVDLVIMDIMMPEMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R      DV +  L  + +  + + G   GA+ +L+KPF+   L   ++ L 
Sbjct: 60  GWELCRELR---DYDDVPILMLTAKGETRQKVKGFELGADDYLVKPFDPLELVARVKALL 116

Query: 119 QMQK 122
           +  +
Sbjct: 117 KRYR 120


>gi|116494441|ref|YP_806175.1| DNA-binding response regulator [Lactobacillus casei ATCC 334]
 gi|191637826|ref|YP_001986992.1| Putative response regulator [Lactobacillus casei BL23]
 gi|227535595|ref|ZP_03965644.1| response regulator [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|239631190|ref|ZP_04674221.1| DNA-binding response regulator [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|301065951|ref|YP_003787974.1| OmpR family DNA-binding response regulator [Lactobacillus casei
           str. Zhang]
 gi|116104591|gb|ABJ69733.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus casei ATCC 334]
 gi|190712128|emb|CAQ66134.1| Putative response regulator [Lactobacillus casei BL23]
 gi|227186725|gb|EEI66792.1| response regulator [Lactobacillus paracasei subsp. paracasei ATCC
           25302]
 gi|239525655|gb|EEQ64656.1| DNA-binding response regulator [Lactobacillus paracasei subsp.
           paracasei 8700:2]
 gi|300438358|gb|ADK18124.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactobacillus casei str. Zhang]
 gi|327381892|gb|AEA53368.1| VicR protein [Lactobacillus casei LC2W]
 gi|327385053|gb|AEA56527.1| VicR protein [Lactobacillus casei BD-II]
          Length = 235

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 51/126 (40%), Gaps = 1/126 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + ++      + V  AT   EA +    E   +++++D  +  + 
Sbjct: 1   MKKILIVDDEPAILTLLQYNLEAEHYQVETATDGQEALDKVRNEP-FDFIILDLMLPSLS 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +         +  L  + +    I G   GA+ ++ KPF+   +   ++ + + 
Sbjct: 60  GLDVTRKIREDKIQTPIMILTAKDNETDKIVGLELGADDYVTKPFSPREIIARIKAIERR 119

Query: 121 QKSKDE 126
            +S+ +
Sbjct: 120 SQSQPQ 125


>gi|297530901|ref|YP_003672176.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. C56-T3]
 gi|297254153|gb|ADI27599.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. C56-T3]
          Length = 226

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++  H  N  GF + EA +  EA +  E  +  + +++D  M  + 
Sbjct: 3   MTRILIVDDDAHIRELVSHFLNLEGFTIHEAANGKEALDVLET-VKVDLVIMDIMMPEMD 61

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R      DV +  L  + +  + + G   GA+ +L+KPF+   L   ++ L 
Sbjct: 62  GWELCRELR---DYDDVPILMLTAKGETRQKVKGFELGADDYLVKPFDPLELVARVKALL 118

Query: 119 QMQK 122
           +  +
Sbjct: 119 KRYR 122


>gi|238752749|ref|ZP_04614218.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           rohdei ATCC 43380]
 gi|238709007|gb|EEQ01256.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           rohdei ATCC 43380]
          Length = 239

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 13  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPYPDLVLLDWMLPGGSG 71

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 72  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 131

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 132 RISPMAVEEVIE 143


>gi|126731218|ref|ZP_01747025.1| phosphate regulon transcriptional regulatory protein PhoB
           [Sagittula stellata E-37]
 gi|126708129|gb|EBA07188.1| phosphate regulon transcriptional regulatory protein PhoB
           [Sagittula stellata E-37]
          Length = 229

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 54/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++LLV+     R+V  +     GF V  A +  EA      E  P+ +V+D  +     +
Sbjct: 7   TVLLVEDEPAQREVLSYNLEAEGFRVASAGNGEEAL-LMMAEENPDIVVLDWMLPNVSGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++  P   +V +  L    +    + G   GA+ +++KP++   L   +R   + 
Sbjct: 66  EVCRQIKTKPETRNVPIIMLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRAQLRR 125

Query: 121 QKSKDENQFLD 131
            +       L+
Sbjct: 126 ARPSAAGLRLE 136


>gi|15644403|ref|NP_229455.1| response regulator DrrA [Thermotoga maritima MSB8]
 gi|4982229|gb|AAD36722.1|AE001807_13 response regulator DrrA [Thermotoga maritima MSB8]
          Length = 247

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + ++  +  +  G+ V +A    EA +    E + +  ++D  + G+  
Sbjct: 12  KKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDV-DMFIVDIMLPGIDG 70

Query: 62  FI--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R M    +  V +L  + +    + G   GA+ ++ KPF+   L   ++ + +
Sbjct: 71  FELVRKIRSMEKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFR 130

Query: 120 M 120
            
Sbjct: 131 R 131


>gi|182437750|ref|YP_001825469.1| putative two-component systen response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
 gi|178466266|dbj|BAG20786.1| putative two-component systen response regulator [Streptomyces
           griseus subsp. griseus NBRC 13350]
          Length = 245

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A    E    P+ +V+D  M  +  
Sbjct: 9   QRILIVDDEPAVREALQRSLAFEGYGTQVAVDGYDALAMAEA-YDPDLIVLDIQMPRMDG 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+   +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 68  LTAARRIRATGSTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 126


>gi|218247106|ref|YP_002372477.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 8801]
 gi|257060175|ref|YP_003138063.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 8802]
 gi|218167584|gb|ACK66321.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 8801]
 gi|256590341|gb|ACV01228.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 8802]
          Length = 243

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA +   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEALDTFHKAD-PDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QK 122
            +
Sbjct: 123 VE 124


>gi|302559898|ref|ZP_07312240.1| DNA-binding response regulator [Streptomyces griseoflavus Tu4000]
 gi|302477516|gb|EFL40609.1| DNA-binding response regulator [Streptomyces griseoflavus Tu4000]
          Length = 244

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A E       P+ +V+D  M  +  
Sbjct: 11  QRILIVDDEPAVREALQRSLAFEGYGTEVAVDGADALEKAAA-YRPDLVVLDIQMPRMDG 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 70  LTAARRIRATGDTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 128


>gi|86608522|ref|YP_477284.1| LuxR family DNA-binding response regulator [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86557064|gb|ABD02021.1| DNA-binding response regulator, LuxR family [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 229

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 53/133 (39%), Gaps = 4/133 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD   +  KV        G+ V    S  E      +E  P+ +V D  M  + 
Sbjct: 1   MKRVLVVDDDPLSLKVLSRHLTQHGYRVCTGASGVEGLRLFAQE-QPDVVVSDVVMPEMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +RQ   G  V   +L    + +  + G   GA+ +++KPF    L   +    
Sbjct: 60  GFEFCRQLRQQRGGELVPFIFLSSRGEIDDRVQGYERGADDYIIKPFEPLELVAKIEAQI 119

Query: 119 QM-QKSKDENQFL 130
           +  ++++ E   L
Sbjct: 120 ERSRRTQSEILRL 132


>gi|298243980|ref|ZP_06967787.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
 gi|297557034|gb|EFH90898.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
          Length = 252

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 52/122 (42%), Gaps = 4/122 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME---GV 59
            +L+VD    + +  R      GF V  A           + + P+ +++D  M      
Sbjct: 18  RVLVVDDEENIIEFIRLGLRYEGFQVESANDGETGIATALR-INPDIIILDVMMPPGIDG 76

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+ P   ++ +  L    +    IAG R GA+ +L KPF+ + L   +R + +
Sbjct: 77  LEVCRRLRENPTTREIPILMLTARDEVRDRIAGLRTGADDYLTKPFDFDELLERIRAILR 136

Query: 120 MQ 121
            Q
Sbjct: 137 RQ 138


>gi|17231314|ref|NP_487862.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17132956|dbj|BAB75521.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 242

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA +   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALDTFRKSD-PDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|329296532|ref|ZP_08253868.1| winged helix family two component transcriptional regulator
           [Plautia stali symbiont]
          Length = 229

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +     +   EA     A      E  P+ +++D  + G   
Sbjct: 3   KRILVVEDEAPIREMLCFVLEQNDYQPIEAEDYDSAIGKLI-EPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREAMTRDIPVMMLTALGEEEDRVRGLELGADDYITKPFSPKELMARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|148243360|ref|YP_001228517.1| two-component system response regulator [Synechococcus sp. RCC307]
 gi|147851670|emb|CAK29164.1| Two-component system response regulator [Synechococcus sp. RCC307]
          Length = 244

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LLVD    +R   +  F D GF+V  A    E  E  + E +P+ ++ D  M      
Sbjct: 19  RVLLVDDEPGLRTAVQAYFEDEGFIVSTAADGEEGWEKAQSE-VPDVVLSDVMMPRVDGF 77

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+        V +L  +      IAG RAG + ++ KPF+ + L   +R + Q 
Sbjct: 78  GLLKLLREDERLGGTPVIFLTAKGMTADRIAGFRAGVDDYIPKPFDPDELVARVRNVVQR 137

Query: 121 QK 122
           Q+
Sbjct: 138 QE 139


>gi|326778385|ref|ZP_08237650.1| two component transcriptional regulator, winged helix family
           [Streptomyces cf. griseus XylebKG-1]
 gi|326658718|gb|EGE43564.1| two component transcriptional regulator, winged helix family
           [Streptomyces cf. griseus XylebKG-1]
          Length = 245

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A    E    P+ +V+D  M  +  
Sbjct: 9   QRILIVDDEPAVREALQRSLAFEGYGTQVAVDGYDALAMAEA-YAPDLIVLDIQMPRMDG 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+   +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 68  LTAARRIRATGSTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 126


>gi|86606063|ref|YP_474826.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86554605|gb|ABC99563.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 243

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   K+  P+ +V+D  M      
Sbjct: 8   RILVVDDEASIRRILETRLSMIGYDVVTAADGEEALEVFRKQD-PDLVVLDVMMPKLDGY 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 67  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 123


>gi|46579496|ref|YP_010304.1| phosphate regulon transcriptional regulator PhoB [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120602954|ref|YP_967354.1| two component transcriptional regulator [Desulfovibrio vulgaris
           DP4]
 gi|46448910|gb|AAS95563.1| phosphate regulon transcriptional regulator PhoB [Desulfovibrio
           vulgaris str. Hildenborough]
 gi|120563183|gb|ABM28927.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio vulgaris DP4]
 gi|311233311|gb|ADP86165.1| two component transcriptional regulator, winged helix family
           [Desulfovibrio vulgaris RCH1]
          Length = 229

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 54/126 (42%), Gaps = 3/126 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+    + ++ R      GF V  A +  +  E  ++  +P  +++D  + G+  F
Sbjct: 5   RILVVEDDEDILQLLRFTLEAAGFEVVTAATGRDGLESAQRH-VPGLVLLDLMLPGMSGF 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++ P    V V  L    +    I G   GA+ +++KPF+   L   +R + + 
Sbjct: 64  DVCRELKRTPATEHVPVIMLTARGEEVDRIVGLELGADDYVIKPFSPRELVLRIRAVLKR 123

Query: 121 QKSKDE 126
                E
Sbjct: 124 VTGAQE 129


>gi|15614507|ref|NP_242810.1| two-component response regulator [Bacillus halodurans C-125]
 gi|10174562|dbj|BAB05663.1| two-component response regulator [Bacillus halodurans C-125]
          Length = 229

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 59/124 (47%), Gaps = 2/124 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD    +R++        GF V+ A +  EA +  E+E + + +V+D  M+ +  F
Sbjct: 6   NILIVDDELDLRELVTSYLRKEGFAVYTAETGDEAIKRLEQEPM-DLVVLDVMMDEMDGF 64

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
            A  +++   + + +  L      +  + G + GA+ +++KPF+   L   +    +  +
Sbjct: 65  TAC-KEIRAFSQIPIIMLTARGGEDDKVMGLQIGADDYIVKPFSPRELVARIEVALRRTQ 123

Query: 123 SKDE 126
              +
Sbjct: 124 GIQQ 127


>gi|238786434|ref|ZP_04630353.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           bercovieri ATCC 43970]
 gi|238712660|gb|EEQ04753.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           bercovieri ATCC 43970]
          Length = 239

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 13  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPFPDLVLLDWMLPGGSG 71

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 72  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 131

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 132 RISPMAVEEVIE 143


>gi|30022664|ref|NP_834295.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Bacillus cereus ATCC 14579]
 gi|206969884|ref|ZP_03230838.1| DNA-binding response regulator PhoP [Bacillus cereus AH1134]
 gi|218233317|ref|YP_002369385.1| DNA-binding response regulator PhoP [Bacillus cereus B4264]
 gi|218899742|ref|YP_002448153.1| DNA-binding response regulator PhoP [Bacillus cereus G9842]
 gi|228903106|ref|ZP_04067242.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 4222]
 gi|228910413|ref|ZP_04074228.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 200]
 gi|228923333|ref|ZP_04086621.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar huazhongensis BGSC
           4BD1]
 gi|228941768|ref|ZP_04104315.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228954858|ref|ZP_04116878.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228960858|ref|ZP_04122491.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228967686|ref|ZP_04128706.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228974692|ref|ZP_04135258.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228981286|ref|ZP_04141586.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis Bt407]
 gi|229048296|ref|ZP_04193864.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH676]
 gi|229072091|ref|ZP_04205300.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus F65185]
 gi|229081841|ref|ZP_04214333.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock4-2]
 gi|229112054|ref|ZP_04241597.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-15]
 gi|229129873|ref|ZP_04258839.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-Cer4]
 gi|229147149|ref|ZP_04275507.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST24]
 gi|229152784|ref|ZP_04280967.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1550]
 gi|229180908|ref|ZP_04308243.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 172560W]
 gi|229192790|ref|ZP_04319748.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 10876]
 gi|296505061|ref|YP_003666761.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Bacillus thuringiensis BMB171]
 gi|29898223|gb|AAP11496.1| Alkaline phosphatase synthesis two-component response regulator
           phoP [Bacillus cereus ATCC 14579]
 gi|206735572|gb|EDZ52740.1| DNA-binding response regulator PhoP [Bacillus cereus AH1134]
 gi|218161274|gb|ACK61266.1| DNA-binding response regulator PhoP [Bacillus cereus B4264]
 gi|218542946|gb|ACK95340.1| DNA-binding response regulator PhoP [Bacillus cereus G9842]
 gi|228590629|gb|EEK48490.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 10876]
 gi|228602465|gb|EEK59951.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 172560W]
 gi|228630604|gb|EEK87250.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1550]
 gi|228636259|gb|EEK92731.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST24]
 gi|228653564|gb|EEL09436.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-Cer4]
 gi|228671377|gb|EEL26678.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-15]
 gi|228701429|gb|EEL53923.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock4-2]
 gi|228711025|gb|EEL62991.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus F65185]
 gi|228723021|gb|EEL74398.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH676]
 gi|228778486|gb|EEM26753.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis Bt407]
 gi|228785095|gb|EEM33108.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228792019|gb|EEM39601.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228798754|gb|EEM45734.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pakistani str.
           T13001]
 gi|228804847|gb|EEM51446.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228817980|gb|EEM64058.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228836287|gb|EEM81640.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar huazhongensis BGSC
           4BD1]
 gi|228849179|gb|EEM94018.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 200]
 gi|228856515|gb|EEN01039.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 4222]
 gi|296326113|gb|ADH09041.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Bacillus thuringiensis BMB171]
 gi|326942372|gb|AEA18268.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Bacillus thuringiensis serovar chinensis CT-43]
          Length = 239

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLDA 132
             K + E Q  +A
Sbjct: 120 RTKLQQEEQVAEA 132


>gi|152974825|ref|YP_001374342.1| two component transcriptional regulator [Bacillus cereus subsp.
           cytotoxis NVH 391-98]
 gi|152023577|gb|ABS21347.1| two component transcriptional regulator, winged helix family
           [Bacillus cytotoxicus NVH 391-98]
          Length = 223

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 62/131 (47%), Gaps = 6/131 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +LLVD    +R++     ++FG+   EA +  EA    E E   +++++D  M  +   
Sbjct: 5   KVLLVDDESDMRQLVGMYLDNFGYEWDEAENGKEALLKLE-EAHYDFVILDIMMPEMDGI 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  AVCKEIRK---TSDIPIIFLTAKGEEWNRVNGLRNGADDYVVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDENQFLD 131
              + + + L+
Sbjct: 121 YTKQGQQEELE 131


>gi|312135255|ref|YP_004002593.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor owensensis OL]
 gi|311775306|gb|ADQ04793.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor owensensis OL]
          Length = 223

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 57/126 (45%), Gaps = 7/126 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D    + +V +      GF V  A +  +      K  +P+ +++D  +    
Sbjct: 1   MK-ILVIDDDVKICEVIKLYLEKEGFEVVVAHNGMDGISVF-KNEMPDLVILDIMLPKKD 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             +    +R++   +++ +  L  + +    + G   GA+ +++KPF+ + L   ++ + 
Sbjct: 59  GYDVCRELRKI---SNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVL 115

Query: 119 QMQKSK 124
           +  + +
Sbjct: 116 RRTQGE 121


>gi|229543409|ref|ZP_04432469.1| two component transcriptional regulator, winged helix family
           [Bacillus coagulans 36D1]
 gi|229327829|gb|EEN93504.1| two component transcriptional regulator, winged helix family
           [Bacillus coagulans 36D1]
          Length = 224

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/133 (21%), Positives = 60/133 (45%), Gaps = 7/133 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  LLLVD    +  +        G+   + T   EA  + ++E   + +++D  M    
Sbjct: 1   MKKLLLVDDEERMLDLLALYLEPAGYACDKVTRGPEAIRYIQEETY-DLILLDIMMPETD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R+M   + V V  L    D   ++ G + GA+ ++ KPF+ + L   +  + 
Sbjct: 60  GWEVCRQIRKM---SQVPVIMLTARTDKPDVVKGLKIGADDYISKPFDEKELLARIDAVL 116

Query: 119 QMQKSKDENQFLD 131
           +   ++++N+ ++
Sbjct: 117 RRS-NQNQNETIE 128


>gi|217967623|ref|YP_002353129.1| two component transcriptional regulator, winged helix family
           [Dictyoglomus turgidum DSM 6724]
 gi|217336722|gb|ACK42515.1| two component transcriptional regulator, winged helix family
           [Dictyoglomus turgidum DSM 6724]
          Length = 232

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 53/125 (42%), Gaps = 6/125 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +LLV+    +      L N  G+ V  A    EA     K   P+ +++D  +    
Sbjct: 1   MKKILLVEDDKGIVNSLTLLLNKEGYEVEVAYDGVEALNKF-KLFNPDLVLLDIMLPEKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R++   ++V +  L  + +    + G + GA+ ++ KPF  + L   +  + 
Sbjct: 60  GWEVCKEIRKI---SNVPIIMLTAKDEEVDKVLGLKMGADDYITKPFGAKELLARIEAVL 116

Query: 119 QMQKS 123
           +  +S
Sbjct: 117 RRYQS 121


>gi|333026940|ref|ZP_08455004.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
 gi|332746792|gb|EGJ77233.1| putative two-component system response regulator [Streptomyces sp.
           Tu6071]
          Length = 276

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 43/119 (36%), Gaps = 2/119 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    V +V        G  V  A     A         P+ +V+D  + G+    
Sbjct: 19  VLVVDDDPTVAEVVAGYLLRAGCTVDRAGDGPSALARAHTH-RPDLVVLDLMLPGMDGLE 77

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              R       V V  L    D +  I G   GA+ ++ KPF+   L   +  + +  +
Sbjct: 78  VCRRMRERHP-VPVIMLTARGDEDDRILGLERGADDYVTKPFSPRELVLRVESVLRRTR 135


>gi|15672379|ref|NP_266553.1| two-component system regulator [Lactococcus lactis subsp. lactis
           Il1403]
 gi|116511254|ref|YP_808470.1| DNA-binding response regulator [Lactococcus lactis subsp. cremoris
           SK11]
 gi|125623281|ref|YP_001031764.1| two-component system regulator [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281490939|ref|YP_003352919.1| Two-component response regulator [Lactococcus lactis subsp. lactis
           KF147]
 gi|12483717|gb|AAG53732.1|AF178425_2 RrC [Lactococcus lactis subsp. cremoris MG1363]
 gi|12723270|gb|AAK04495.1|AE006276_10 two-component system regulator [Lactococcus lactis subsp. lactis
           Il1403]
 gi|116106908|gb|ABJ72048.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Lactococcus lactis subsp. cremoris SK11]
 gi|124492089|emb|CAL97018.1| two-component system regulator [Lactococcus lactis subsp. cremoris
           MG1363]
 gi|281374697|gb|ADA64217.1| Two-component response regulator [Lactococcus lactis subsp. lactis
           KF147]
 gi|300070032|gb|ADJ59432.1| Two-component response regulator [Lactococcus lactis subsp.
           cremoris NZ9000]
 gi|326405973|gb|ADZ63044.1| Two-component response regulator [Lactococcus lactis subsp. lactis
           CV56]
          Length = 233

 Score =  153 bits (387), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 51/120 (42%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      GF VF A    EA E   KE+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIVKFNLTKEGFEVFTAFDGEEALEAF-KEVQPDLILLDLMLPKLD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++   +D  +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLDVA-REIRKTSDTPIIMVSAKDSEFDKVIGLELGADDYVTKPFSNRELLARIKANLRR 118


>gi|34496017|ref|NP_900232.1| phosphate regulon transcriptional regulatory protein phoB
           [Chromobacterium violaceum ATCC 12472]
 gi|34101870|gb|AAQ58238.1| phosphate regulon transcriptional regulatory protein phoB
           [Chromobacterium violaceum ATCC 12472]
          Length = 229

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++LLV+    ++++        G  V  A +   A     +  LP+ +++D  + G   +
Sbjct: 4   NILLVEDEPAIQELIAFNLAQAGHHVLRAGTAEAALTLV-RNALPDLVLLDWMLPGASGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           +    +R       + +  L    D +  +AG   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DVAKRLRADERTRHIPIIMLTARSDEQDKVAGLETGADDYITKPFSPRELLARIKAVLRR 122

Query: 121 QKSK 124
           +  +
Sbjct: 123 RAPQ 126


>gi|307547006|ref|YP_003899485.1| phosphate regulon transcriptional regulator PhoB [Halomonas
           elongata DSM 2581]
 gi|307219030|emb|CBV44300.1| phosphate regulon transcriptional regulatory protein PhoB
           [Halomonas elongata DSM 2581]
          Length = 229

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++         + V EA +   A         P+ +++D  M G   
Sbjct: 4   KTVLIVDDEAPIREMIAVALEMADYHVLEADNAQAAHAMIVDH-QPDLVLLDWMMPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++     ++ +  L  + + +  I G  AGA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKREETTAEMPIIMLTAKSEEDNKIQGLDAGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|186683187|ref|YP_001866383.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
 gi|186465639|gb|ACC81440.1| multi-sensor hybrid histidine kinase [Nostoc punctiforme PCC 73102]
          Length = 1416

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 53/126 (42%), Gaps = 4/126 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +LL D +  +R   + L +   + V        A +   +  +P+ ++ D  M G+  F
Sbjct: 644 RILLADDNSDMRDYVKRLLSQQ-YEVESVADGLAALDSA-RGRVPDLVLTDVMMPGLDGF 701

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R  P    V +  L      E  + G  AGA+ +L+KPF+   L   +    +M
Sbjct: 702 GLLQELRANPQTKKVPIILLSARAGEEARVEGLEAGADDYLIKPFSARELLARVEAALKM 761

Query: 121 QKSKDE 126
              ++E
Sbjct: 762 AHLREE 767



 Score =  108 bits (272), Expect = 2e-22,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 37/121 (30%), Gaps = 5/121 (4%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
            +L+VD     R+    +    G  V    S  EA +    E  P+ L+ D  M       
Sbjct: 1295 ILVVDDDDDTREFHTFVLEQAGAKVMAVASAKEALQAL-AESEPDILLSDIGMPETDGYM 1353

Query: 62   FIAHVRQMP--LGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             +  +R +       +    L              +G    L KP   + L  A+  L  
Sbjct: 1354 LMRQIRALQLKQAKQIPAIALTAYAGEINQQQAIASGFQRHLSKPVEPDELVKAIATLIG 1413

Query: 120  M 120
             
Sbjct: 1414 R 1414


>gi|166364957|ref|YP_001657230.1| OmpR family two-component response regulator [Microcystis
           aeruginosa NIES-843]
 gi|166087330|dbj|BAG02038.1| two-component response regulator OmpR subfamily [Microcystis
           aeruginosa NIES-843]
          Length = 246

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 52/122 (42%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E       P+ +V+D  M      
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYEVVTAADGEEALETFRTAE-PDLVVLDVMMPKLDGY 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 70  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126

Query: 121 QK 122
            +
Sbjct: 127 VE 128


>gi|167040620|ref|YP_001663605.1| two component transcriptional regulator [Thermoanaerobacter sp.
           X514]
 gi|300914661|ref|ZP_07131977.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X561]
 gi|307724105|ref|YP_003903856.1| winged helix family two component transcriptional regulator
           [Thermoanaerobacter sp. X513]
 gi|166854860|gb|ABY93269.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X514]
 gi|300889596|gb|EFK84742.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X561]
 gi|307581166|gb|ADN54565.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X513]
          Length = 234

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 20/128 (15%), Positives = 57/128 (44%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++L+++    + ++ R+     G+ V  + +  E  +    E  P+ +++D  +     L
Sbjct: 4   TVLVIEDEIHILELLRYNLEAAGYKVITSENGKEGLDKAL-EGKPDLVILDLMLPDVDGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +++     ++ +  L  + +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  EICKILKKNDETKNIPIIMLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVLRR 122

Query: 121 QKSKDENQ 128
            +  DE +
Sbjct: 123 TQQPDEEK 130


>gi|282898613|ref|ZP_06306601.1| Two component Transcriptional regulator, Winged helix family
           [Cylindrospermopsis raciborskii CS-505]
 gi|281196481|gb|EFA71390.1| Two component Transcriptional regulator, Winged helix family
           [Cylindrospermopsis raciborskii CS-505]
          Length = 242

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKAD-PDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|124003498|ref|ZP_01688347.1| two-component system sensor histidine kinase/response regulator,
            hybrid [Microscilla marina ATCC 23134]
 gi|123991067|gb|EAY30519.1| two-component system sensor histidine kinase/response regulator,
            hybrid [Microscilla marina ATCC 23134]
          Length = 1338

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 54/126 (42%), Gaps = 4/126 (3%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            ++L+V+ +H +R+  R       + V EA    E  E      LP+ ++ D  M     L
Sbjct: 1089 TVLVVEDNHELRQFIRTEL-AVTYQVIEAADGVEGIEKA-SNQLPDLIISDLMMPKADGL 1146

Query: 61   EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            E +  +R  P    + +  L  +  FE  I G   G + +L KPF+   L   ++   + 
Sbjct: 1147 ELLRTLRNNPQTCHIPIIILSAKASFESKITGLETGGDDYLTKPFSPRELVLRIKNTLER 1206

Query: 121  QKSKDE 126
            ++   E
Sbjct: 1207 REKLKE 1212


>gi|125973803|ref|YP_001037713.1| two component transcriptional regulator [Clostridium thermocellum
           ATCC 27405]
 gi|125714028|gb|ABN52520.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum ATCC 27405]
 gi|316940004|gb|ADU74038.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 1313]
          Length = 228

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 57/128 (44%), Gaps = 6/128 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L++D    + ++ R      GF V    +  +A E    E  PN +++D  + G   
Sbjct: 5   TKVLVIDDDVNICELIRLYMEKEGFEVVTVYNGSKALEVFRNE-APNIVILDIMLPGADG 63

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R++   +++ V  L  + +    + G   GA+ +L+KPF  + L   ++ + +
Sbjct: 64  WQVCREIRKI---SNIPVIMLSAKGETFDKVLGLELGADDYLVKPFEPKELVARVKAVLR 120

Query: 120 MQKSKDEN 127
             + KD +
Sbjct: 121 RYEHKDSD 128


>gi|313890279|ref|ZP_07823913.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus pseudoporcinus SPIN 20026]
 gi|313121384|gb|EFR44489.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus pseudoporcinus SPIN 20026]
          Length = 236

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ +  A    EA    E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIMTAFDGREAIAAFE-EGKPDLVILDLMLPEMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|302519214|ref|ZP_07271556.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. SPB78]
 gi|302428109|gb|EFK99924.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. SPB78]
          Length = 290

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 43/119 (36%), Gaps = 2/119 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    V +V        G  V  A     A         P+ +V+D  + G+    
Sbjct: 19  VLVVDDDPTVAEVVAGYLLRAGCTVDRAGDGPSALARAHTH-RPDLVVLDLMLPGMDGLE 77

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              R       V V  L    D +  I G   GA+ ++ KPF+   L   +  + +  +
Sbjct: 78  VCRRMRARHP-VPVIMLTARGDEDDRILGLERGADDYVTKPFSPRELVLRVESVLRRTR 135


>gi|15600553|ref|NP_254047.1| two-component response regulator PhoB [Pseudomonas aeruginosa PAO1]
 gi|116053507|ref|YP_793834.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|152987707|ref|YP_001351454.1| two-component response regulator PhoB [Pseudomonas aeruginosa PA7]
 gi|218894463|ref|YP_002443333.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           LESB58]
 gi|254237949|ref|ZP_04931272.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           C3719]
 gi|254243755|ref|ZP_04937077.1| two-component response regulator PhoB [Pseudomonas aeruginosa 2192]
 gi|296392220|ref|ZP_06881695.1| two-component response regulator PhoB [Pseudomonas aeruginosa PAb1]
 gi|313106787|ref|ZP_07793002.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           39016]
 gi|12230950|sp|P23620|PHOB_PSEAE RecName: Full=Phosphate regulon transcriptional regulatory protein
           phoB
 gi|9951681|gb|AAG08745.1|AE004948_1 two-component response regulator PhoB [Pseudomonas aeruginosa PAO1]
 gi|115588728|gb|ABJ14743.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           UCBPP-PA14]
 gi|126169880|gb|EAZ55391.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           C3719]
 gi|126197133|gb|EAZ61196.1| two-component response regulator PhoB [Pseudomonas aeruginosa 2192]
 gi|150962865|gb|ABR84890.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas aeruginosa PA7]
 gi|218774692|emb|CAW30509.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           LESB58]
 gi|310879504|gb|EFQ38098.1| two-component response regulator PhoB [Pseudomonas aeruginosa
           39016]
          Length = 229

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   KTILIVDDEAPIREMIAVALEMAGYECLEAENTQQA-HAVIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTVDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|238795237|ref|ZP_04638821.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           intermedia ATCC 29909]
 gi|238725430|gb|EEQ17000.1| Phosphate regulon transcriptional regulatory protein phoB [Yersinia
           intermedia ATCC 29909]
          Length = 239

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 57/132 (43%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P+ +++D  + G   
Sbjct: 13  RRILVVEDEAPIREMVCFVLEQNGYQPLEAEDYDSAVTRL-SEPFPDLVLLDWMLPGGSG 71

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 72  IQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 131

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 132 RISPMAVEEVIE 143


>gi|328949779|ref|YP_004367114.1| two component transcriptional regulator, winged helix family
           [Marinithermus hydrothermalis DSM 14884]
 gi|328450103|gb|AEB11004.1| two component transcriptional regulator, winged helix family
           [Marinithermus hydrothermalis DSM 14884]
          Length = 221

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 52/127 (40%), Gaps = 3/127 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R+V         F V EA    +A E        + +++D  + G+ 
Sbjct: 1   MARVLVVDDDPAIREVLAAYLARERFEVLEAEDGLQALEQA---PGADLVILDLMLPGMD 57

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            +           D+ +  L    + E+ + G   GA+ ++ KPF+   +   +R L + 
Sbjct: 58  GWRVAQELRRDWPDLPILMLTARGEEEERVRGFELGADDYVTKPFSPREVVARVRALLRR 117

Query: 121 QKSKDEN 127
              KDE 
Sbjct: 118 VGLKDEL 124


>gi|257062785|ref|YP_003142457.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Slackia heliotrinireducens DSM
           20476]
 gi|256790438|gb|ACV21108.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Slackia heliotrinireducens DSM
           20476]
          Length = 240

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/130 (21%), Positives = 50/130 (38%), Gaps = 6/130 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +LLV+    +R           + V       +A E   K    + +++D  +  V  
Sbjct: 9   RRILLVEDEKAIRDAVAAYLERENYWVTAVGDGQDALEEFSKHH-FDLVILDLMLPRVPG 67

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R     +DV +  L  + + E  I G   GA+ +L+KPF+   L   +R L +
Sbjct: 68  ERVCRAIR---DNSDVPIIMLTAKGEVEDRIIGLELGADDYLVKPFSPRELVARVRALLR 124

Query: 120 MQKSKDENQF 129
              +  E Q 
Sbjct: 125 RVHADSEPQR 134


>gi|206900113|ref|YP_002250961.1| response regulator DrrA [Dictyoglomus thermophilum H-6-12]
 gi|206739216|gb|ACI18274.1| response regulator DrrA [Dictyoglomus thermophilum H-6-12]
          Length = 232

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 53/125 (42%), Gaps = 6/125 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +LLV+    +      L N  G+ V  A    EA     K   P+ +++D  +    
Sbjct: 1   MKKILLVEDDKGIVNSLSLLLNKEGYEVEVAYDGVEALNKF-KLFNPDLVLLDIMLPEKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R++   ++V +  L  + +    + G + GA+ ++ KPF  + L   +  + 
Sbjct: 60  GWEVCKEIRKI---SNVPIIMLTAKDEEVDKVLGLKMGADDYITKPFGAKELLARIEAVL 116

Query: 119 QMQKS 123
           +  +S
Sbjct: 117 RRYQS 121


>gi|170078637|ref|YP_001735275.1| two-component response regulator [Synechococcus sp. PCC 7002]
 gi|169886306|gb|ACB00020.1| two-component response regulator [Synechococcus sp. PCC 7002]
          Length = 219

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 32/135 (23%), Positives = 61/135 (45%), Gaps = 4/135 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D   I++K+  +L    G++V    S  +  +    E  P+ +V D  M  + 
Sbjct: 1   MKRILVIDDDPILQKILENLLTQAGYLVAVVLSGKQGLDIWL-EFQPDLIVSDVRMPEMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F    ++R  P G  +   +L  + D E  + G  +GA+ ++ KPF  + L   +    
Sbjct: 60  GFEFCRYIRSQPTGQLIPFLFLSSQTDVEARVEGHFSGADDYIAKPFEMKELLAKIERQL 119

Query: 119 QMQKS-KDENQFLDA 132
              ++ + E Q L A
Sbjct: 120 ARIENIRAEMQRLAA 134


>gi|121535983|ref|ZP_01667776.1| two component transcriptional regulator, winged helix family
           [Thermosinus carboxydivorans Nor1]
 gi|121305443|gb|EAX46392.1| two component transcriptional regulator, winged helix family
           [Thermosinus carboxydivorans Nor1]
          Length = 231

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 56/127 (44%), Gaps = 6/127 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
            ++L+VD    +R++    F   GF V EA    EA    E ++ P+ +++D  M     
Sbjct: 4   KTVLIVDDEKQIREILAIYFTQSGFTVAEAADGAEALIKVE-QVKPDIVILDIMMPVLDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +R+    + V +  L      +  I G   GA+ ++ KPFN + +   ++ + +
Sbjct: 63  FEVCQQIRK---YSPVPIIMLTSRTQDDDRIMGLEIGADDYVTKPFNPKEVVARVKAILR 119

Query: 120 MQKSKDE 126
              +  +
Sbjct: 120 RTAAPQQ 126


>gi|89893567|ref|YP_517054.1| hypothetical protein DSY0821 [Desulfitobacterium hafniense Y51]
 gi|89333015|dbj|BAE82610.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 227

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 25/130 (19%), Positives = 55/130 (42%), Gaps = 6/130 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    +R++ R      GF   EA +   A E   +    + +++D  + G+   
Sbjct: 2   RILVVDDDERIREIVRLYLEAEGFETDEAENGNIALEKV-RNGTFDLIILDLMIPGLDGW 60

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    T + +  L  + +    I G   GA+ +++KPF+   L   ++ + + 
Sbjct: 61  TVCKVLRKE---TQIPIIMLTAKGEENDRILGFDLGADDYIVKPFSPRELCARVKAVLRR 117

Query: 121 QKSKDENQFL 130
              +   + L
Sbjct: 118 LDGETSKEHL 127


>gi|304569547|ref|NP_441728.2| OmpR subfamily [Synechocystis sp. PCC 6803]
          Length = 243

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA      E  P+ +V+D  M      
Sbjct: 7   RILVVDDEASIRRILETRLSMIGYEVVTAADGEEAIATF-HESDPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|217968684|ref|YP_002353918.1| two component transcriptional regulator PhoB, winged helix family
           [Thauera sp. MZ1T]
 gi|217506011|gb|ACK53022.1| two component transcriptional regulator PhoB, winged helix family
           [Thauera sp. MZ1T]
          Length = 236

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 54/124 (43%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++LLV+    ++++        G  V  A     A +   +E LP+ +++D  + G   +
Sbjct: 4   NILLVEDEPAIQELIAANLARAGHHVVRANDAESA-QRIVREALPDLVLLDWMLPGASGV 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           EF   +R      D+ +  L    + +  +     GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  EFARRLRADERTRDIPIIMLTARGEEQDKVTALEVGADDYVTKPFSPRELVARIKAVLRR 122

Query: 121 QKSK 124
           +  +
Sbjct: 123 RAPQ 126


>gi|256004535|ref|ZP_05429514.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 2360]
 gi|281417959|ref|ZP_06248979.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum JW20]
 gi|255991540|gb|EEU01643.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum DSM 2360]
 gi|281409361|gb|EFB39619.1| two component transcriptional regulator, winged helix family
           [Clostridium thermocellum JW20]
          Length = 230

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 57/128 (44%), Gaps = 6/128 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L++D    + ++ R      GF V    +  +A E    E  PN +++D  + G   
Sbjct: 7   TKVLVIDDDVNICELIRLYMEKEGFEVVTVYNGSKALEVFRNE-APNIVILDIMLPGADG 65

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R++   +++ V  L  + +    + G   GA+ +L+KPF  + L   ++ + +
Sbjct: 66  WQVCREIRKI---SNIPVIMLSAKGETFDKVLGLELGADDYLVKPFEPKELVARVKAVLR 122

Query: 120 MQKSKDEN 127
             + KD +
Sbjct: 123 RYEHKDSD 130


>gi|186685833|ref|YP_001869029.1| two component transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186468285|gb|ACC84086.1| two component transcriptional regulator, winged helix family
           [Nostoc punctiforme PCC 73102]
          Length = 242

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRK-TEPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|158338752|ref|YP_001519929.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
 gi|158308993|gb|ABW30610.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
          Length = 243

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA +      +P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAADGEEAIDTF-HHAIPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|315639590|ref|ZP_07894730.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus italicus DSM 15952]
 gi|315484551|gb|EFU75007.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus italicus DSM 15952]
          Length = 235

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 48/120 (40%), Gaps = 1/120 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  +        G+ V  AT   EA E    +   +++++D  +  + 
Sbjct: 1   MKKILVVDDEPSIVTLLTFNLEKEGYQVTSATDGQEALEIALMQS-FDFILLDVMLPHMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R      ++ +  L  + D    I G   GA+ +L KPF+   +   ++ + + 
Sbjct: 60  GIEITKRLRQEKVNIPIIILTAKDDPIDRILGLEIGADDYLSKPFSPREVIARIKAIARR 119


>gi|253990976|ref|YP_003042332.1| phosphate regulon transcriptional regulatory protein phob
           [Photorhabdus asymbiotica subsp. asymbiotica ATCC 43949]
 gi|253782426|emb|CAQ85590.1| phosphate regulon transcriptional regulatory protein phob
           [Photorhabdus asymbiotica]
          Length = 229

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A   C  E  P+ +++D  + G   
Sbjct: 3   RRILVVEDETPIREMVCFVLEKNGYQPVEAEDYDSAL-ACLSEPYPDLVLLDWMIPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I  +++     D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQIIKQMKRDNNVRDIPVMMLTARGEEEDRVRGLEIGADDYITKPFSPKELVARVKAVLR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|317968094|ref|ZP_07969484.1| two-component response regulator [Synechococcus sp. CB0205]
          Length = 249

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 53/120 (44%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++     +  G+ V  A    EA E   +   P+ +V+D  M      
Sbjct: 11  TILVVDDEPSIRRILETRLSMIGYQVVTACDGQEALEAF-RNTNPDLVVLDVMMPKLDGY 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 70  GVCQELRKE---SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 126


>gi|257884144|ref|ZP_05663797.1| transcriptional regulator [Enterococcus faecium 1,231,501]
 gi|257819982|gb|EEV47130.1| transcriptional regulator [Enterococcus faecium 1,231,501]
          Length = 234

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 52/128 (40%), Gaps = 1/128 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  +        G+ V  AT   E  E   ++   +++++D  +  + 
Sbjct: 1   MKKILVVDDEPSIVTLLTFNLEKEGYKVTSATDGGEGLELALEQS-FDFIILDVMLPTMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R      +  +  L  + D    I G   GA+ +L KPF+   +   M+ + + 
Sbjct: 60  GMEITQRLRQEKNETPILMLTAKDDQVDRIIGLEIGADDYLTKPFSPREVLARMKAIFRR 119

Query: 121 QKSKDENQ 128
            + + +++
Sbjct: 120 IEPRKQSK 127


>gi|227551905|ref|ZP_03981954.1| response regulator [Enterococcus faecium TX1330]
 gi|257886932|ref|ZP_05666585.1| transcriptional regulator [Enterococcus faecium 1,141,733]
 gi|257895504|ref|ZP_05675157.1| transcriptional regulator [Enterococcus faecium Com12]
 gi|257898119|ref|ZP_05677772.1| transcriptional regulator [Enterococcus faecium Com15]
 gi|293378369|ref|ZP_06624538.1| response regulator receiver domain protein [Enterococcus faecium
           PC4.1]
 gi|293571527|ref|ZP_06682550.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E980]
 gi|227178977|gb|EEI59949.1| response regulator [Enterococcus faecium TX1330]
 gi|257822986|gb|EEV49918.1| transcriptional regulator [Enterococcus faecium 1,141,733]
 gi|257832069|gb|EEV58490.1| transcriptional regulator [Enterococcus faecium Com12]
 gi|257836031|gb|EEV61105.1| transcriptional regulator [Enterococcus faecium Com15]
 gi|291608393|gb|EFF37692.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E980]
 gi|292643233|gb|EFF61374.1| response regulator receiver domain protein [Enterococcus faecium
           PC4.1]
          Length = 234

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 1/128 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  +        G+ V  A    E  E   ++   +++++D  +  + 
Sbjct: 1   MKKILVVDDEPSIVTLLTFNLEKEGYKVTSAADGGEGLELALEQS-FDFIILDVMLPTMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R      +  +  L  + D    I G   GA+ +L KPF+   +   M+ + + 
Sbjct: 60  GMEITQRLRQEKNETPILMLTAKDDQVDRIIGLEIGADDYLTKPFSPREVLARMKAIFRR 119

Query: 121 QKSKDENQ 128
            + + +++
Sbjct: 120 IEPRKQSK 127


>gi|86739037|ref|YP_479437.1| two component transcriptional regulator [Frankia sp. CcI3]
 gi|86565899|gb|ABD09708.1| two component transcriptional regulator, winged helix family
           [Frankia sp. CcI3]
          Length = 406

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 49/124 (39%), Gaps = 1/124 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++        G+ V  A     A     ++  P+ +V+D  +  +   
Sbjct: 160 RVLVVDDETTLAELLSMALRYEGWEVRSAADGRGALRLA-RDFRPDAVVLDIMLPDMDGL 218

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R      DV V +L      E  +AG  AG + ++ KPF+ E L   +R L +   
Sbjct: 219 EVLRRLRAESPDVPVLFLTARDAVEDRVAGLTAGGDDYVTKPFSLEELVARLRGLMRRAA 278

Query: 123 SKDE 126
              E
Sbjct: 279 RTTE 282


>gi|307328971|ref|ZP_07608139.1| two component transcriptional regulator, winged helix family
           [Streptomyces violaceusniger Tu 4113]
 gi|306885333|gb|EFN16351.1| two component transcriptional regulator, winged helix family
           [Streptomyces violaceusniger Tu 4113]
          Length = 274

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/123 (22%), Positives = 46/123 (37%), Gaps = 6/123 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    V +V        GF V +A     A         P+ +V+D  + G+  
Sbjct: 8   TRVLVVDDDPTVAEVVAGYLGRAGFAVDQAADGPGALARAAARW-PDLVVLDLMLPGMDG 66

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R       V V  L    D E  I G   GA+ ++ KPF+   L   +  + +
Sbjct: 67  LEVCRALRGRGP---VPVIMLTARGDEEDRILGLEIGADDYVTKPFSPRELVLRVESVLR 123

Query: 120 MQK 122
             +
Sbjct: 124 RGR 126


>gi|284993022|ref|YP_003411576.1| winged helix family two component transcriptional regulator
           [Geodermatophilus obscurus DSM 43160]
 gi|284066267|gb|ADB77205.1| two component transcriptional regulator, winged helix family
           [Geodermatophilus obscurus DSM 43160]
          Length = 240

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 28/118 (23%), Positives = 48/118 (40%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    +R++        GF V  A    +A         P+ LV+D  M G+  F
Sbjct: 13  RLLVVDDEPNIRELLSASLRYAGFEVATAADGHQALAMA-ASFRPDLLVLDVMMPGLDGF 71

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               R    G    V +L      E  ++G   G + ++ KPF+ + +   +R + + 
Sbjct: 72  GVVRRLRESGRHTPVLFLTARDAAEDKVSGLTLGGDDYVTKPFSLDEVLARIRAVLRR 129


>gi|160942672|ref|ZP_02089915.1| hypothetical protein FAEPRAM212_00144 [Faecalibacterium prausnitzii
           M21/2]
 gi|158446027|gb|EDP23030.1| hypothetical protein FAEPRAM212_00144 [Faecalibacterium prausnitzii
           M21/2]
          Length = 232

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 49/118 (41%), Gaps = 2/118 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++ R      G+ V  A    E  E     + P+ +++D  M  +   
Sbjct: 5   KILVVDDDANICELLRLYLTKEGYQVTVANDGEEGLEKFNA-VKPDMVLLDVMMPRMDGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               R    G +  V  L  + +    + G   GA+ +++KPF+ + +   ++ + + 
Sbjct: 64  EVCRRIRKAG-NTPVMMLTAKGETFDKVLGLELGADDYMVKPFDAKEVVARIKAVLRR 120


>gi|228994533|ref|ZP_04154374.1| Two component transcriptional regulator, winged helix [Bacillus
           pseudomycoides DSM 12442]
 gi|228765212|gb|EEM13925.1| Two component transcriptional regulator, winged helix [Bacillus
           pseudomycoides DSM 12442]
          Length = 248

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/138 (19%), Positives = 58/138 (42%), Gaps = 9/138 (6%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME-- 57
           M   +L+++    +R+V +      G+ V+ A +  E  +       P+ +++D  M   
Sbjct: 9   MKQRILIIEDEENIREVCKRYLEREGYEVYTAMNGMEGWDLFLTH-QPDLILLDLMMSKK 67

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              E    +RQ    ++V +  L  + +    I G   GA+ ++ KPF+   L   ++ +
Sbjct: 68  DGWELCEEIRQQ---SNVPIIMLTAKGEERDRILGLTIGADDYVTKPFSPRELVLRVQII 124

Query: 118 PQMQKS--KDENQFLDAI 133
            +        E +FL  +
Sbjct: 125 LKRGNQIPIQEEEFLSEV 142


>gi|225728859|ref|YP_002735123.1| response regulator protein [Streptococcus uberis 0140J]
 gi|222113533|emb|CAR41322.1| response regulator protein [Streptococcus uberis 0140J]
          Length = 236

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ +  A    EA     +E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGKEAV-LAFEEEKPDLVILDLMLPEMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|158340554|ref|YP_001521548.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
 gi|158310795|gb|ABW32409.1| two-component transcriptional regulator [Acaryochloris marina
           MBIC11017]
          Length = 237

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 54/124 (43%), Gaps = 6/124 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLE 61
           +L+VD    +R+V     +  G+ V+ A    EA +    +  P+ +++D  M       
Sbjct: 8   ILVVDDEASIRRVLSTRLSKIGYQVYTAADGVEALDVFYDQ-RPDLIILDVMMPKLDGYG 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               VR+    + V +  L    D    I G   GA+ +++KPF+ + L   +R + +  
Sbjct: 67  VCQAVRK---ASRVPIIMLTALSDVVDRITGLEMGADDYVVKPFSLKELESRVRSILRRM 123

Query: 122 KSKD 125
           ++  
Sbjct: 124 ETTK 127


>gi|161524068|ref|YP_001579080.1| two component transcriptional regulator [Burkholderia multivorans
           ATCC 17616]
 gi|160341497|gb|ABX14583.1| two component transcriptional regulator, winged helix family
           [Burkholderia multivorans ATCC 17616]
          Length = 305

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 2/124 (1%)

Query: 1   MDS-LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M + +L+VD    +R + R      G  V          E   +   P+ +V+D  M GV
Sbjct: 65  MTTQILIVDDDQELRDLLRDYLVRQGMEVSVLHDAAT-LEKRLERERPDLIVLDLMMPGV 123

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
               A  +    G D+ V  L    D    I G   GA+ +L KPFN   L   ++ + +
Sbjct: 124 DGLTALRQLRAAGDDIPVIMLTARADDVDRIVGLELGADDYLGKPFNPRELLARVQAVLR 183

Query: 120 MQKS 123
            +++
Sbjct: 184 RRRA 187


>gi|308233471|ref|ZP_07664208.1| two component transcriptional regulator, winged helix family
           protein [Atopobium vaginae DSM 15829]
 gi|328943477|ref|ZP_08240942.1| DNA-binding response regulator [Atopobium vaginae DSM 15829]
 gi|327491446|gb|EGF23220.1| DNA-binding response regulator [Atopobium vaginae DSM 15829]
          Length = 241

 Score =  152 bits (386), Expect = 1e-35,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +LLV+    +R          G+ V        A E  EK    + +++D  +  +  
Sbjct: 6   KRILLVEDEKTIRDAVAAYLEREGYFVRSVGDGQSALEEFEKHS-FDLIILDLMLPKLSG 64

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R +   ++V +  L  + + E  I G   GA+ +L+KPF+   L   +R L +  
Sbjct: 65  -ERVCRAVRETSNVPIIMLTAKGEVEDRIIGLELGADDYLIKPFSPRELVARVRALLRRA 123

Query: 122 KSKDE 126
            ++ E
Sbjct: 124 HTESE 128


>gi|332709113|ref|ZP_08429081.1| two component transcriptional regulator, winged helix family
           [Lyngbya majuscula 3L]
 gi|332352119|gb|EGJ31691.1| two component transcriptional regulator, winged helix family
           [Lyngbya majuscula 3L]
          Length = 242

 Score =  152 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA     ++  P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYEVVTAADGEEALNTF-RDTEPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|294340410|emb|CAZ88791.1| Phosphate regulon transcriptional regulatory protein phoB
           [Thiomonas sp. 3As]
          Length = 244

 Score =  152 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+V+    + ++        G     A S  EA     +++LP+ L+ID  + G+   
Sbjct: 6   NILIVEDEPAIAELLAMNLQHAGHCPIRAGSAEEAL-RVIRDVLPDVLLIDWMLPGMSGV 64

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R       + +  L    +    + G  AGA+ ++ KPF+ + L   +R + + 
Sbjct: 65  ALARALRTDARTKAIPIIMLTARSEEGDKVQGLDAGADDYITKPFSPKELLARIRAVLRR 124

Query: 121 QKSK 124
           +  +
Sbjct: 125 RAPQ 128


>gi|148261933|ref|YP_001236060.1| two component transcriptional regulator [Acidiphilium cryptum JF-5]
 gi|326405441|ref|YP_004285523.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acidiphilium multivorum AIU301]
 gi|146403614|gb|ABQ32141.1| two component transcriptional regulator, winged helix family
           [Acidiphilium cryptum JF-5]
 gi|325052303|dbj|BAJ82641.1| phosphate regulon transcriptional regulatory protein PhoB
           [Acidiphilium multivorum AIU301]
          Length = 236

 Score =  152 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 54/119 (45%), Gaps = 3/119 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+V+    +  + R+     GF V EA    EA      E +P+ +++D  +  +  +E
Sbjct: 9   VLVVEDEAPLVTLLRYNLEKSGFRVDEAGDGGEALGRI-NEAMPDLVLLDWMLPTMSGIE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               +R+ P    + V  L    + +  + G   GA+ ++ KPF+ E L   +R L + 
Sbjct: 68  VCRQLRRKPSTRHLPVIMLTARAEDQDTVRGLETGADDYITKPFSPEALIARIRALLRR 126


>gi|300867045|ref|ZP_07111713.1| putative adenylate/guanylate cyclase [Oscillatoria sp. PCC 6506]
 gi|300334942|emb|CBN56879.1| putative adenylate/guanylate cyclase [Oscillatoria sp. PCC 6506]
          Length = 1122

 Score =  152 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 25/123 (20%), Positives = 56/123 (45%), Gaps = 2/123 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   I R+V  +  + + + + EA++  EA    E   +P+ +++D  M  +   
Sbjct: 712 KVLIVDDEPINRQVLINNLSLYNYAITEASNGQEALTAMENGFIPDLILLDLMMPQMTGY 771

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R      ++ +  L  +     ++ G  +GAN +L KP  ++ +   ++    +
Sbjct: 772 EVCQKIRARFPTYELPIVMLTAKNQVADIVEGFESGANDYLSKPIQKQEMLARIKTHISL 831

Query: 121 QKS 123
            K 
Sbjct: 832 AKL 834


>gi|284053232|ref|ZP_06383442.1| two component transcriptional regulator [Arthrospira platensis str.
           Paraca]
 gi|291565873|dbj|BAI88145.1| two-component response regulator [Arthrospira platensis NIES-39]
          Length = 233

 Score =  152 bits (386), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 55/120 (45%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+    +  + R      GF    + +   A E  +++  P+ +++D  + G+   
Sbjct: 2   NILIVEDEPEIALLIRRTLEGEGFSCQISQNGLSALEIFQQQ-RPDVIILDLMLPGLDGL 60

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              A +RQ P   D ++  L  + +    I G   GA+ +++KPF+   L   +R L + 
Sbjct: 61  EVCARIRQQPGQKDPYILMLTAKGEEIDRIVGLSTGADDYMVKPFSPRELVARVRALLRR 120


>gi|311897404|dbj|BAJ29812.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 249

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 54/133 (40%), Gaps = 7/133 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           LL+VD    +R++        GF V  A +  EA +    E  P+ +V+D  +  +  F 
Sbjct: 17  LLVVDDEPNIRELLSASLRFSGFRVASAATGQEALDAVAAE-RPDLVVLDVMLPDLDGFT 75

Query: 64  --AHVRQMPLGT----DVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
               +R           V V +L  +      + G   GA+ ++ KPF+ E L   +R +
Sbjct: 76  VVRRLRDQTQWPQSPEHVPVLFLTAKDGTGDKVQGLAVGADDYVTKPFSLEELIARIRAI 135

Query: 118 PQMQKSKDENQFL 130
            +      ++  L
Sbjct: 136 LRRAGGPADDGRL 148


>gi|307267065|ref|ZP_07548578.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|326391596|ref|ZP_08213126.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus JW 200]
 gi|306917896|gb|EFN48157.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter wiegelii Rt8.B1]
 gi|325992378|gb|EGD50840.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus JW 200]
          Length = 234

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 18/128 (14%), Positives = 56/128 (43%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+++    + ++ R+     G+ V  + +  E  +    E  P+ +++D  +  V   
Sbjct: 4   TVLVIEDEIHILELLRYNLEAAGYKVITSENGKEGLDKAL-EGKPDLVILDLMLPDVDGL 62

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++     ++ +  L  + +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  EICKILKKNDETKNIPIIMLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVLRR 122

Query: 121 QKSKDENQ 128
            +  +E +
Sbjct: 123 TQQPEEEK 130


>gi|301052937|ref|YP_003791148.1| response regulator [Bacillus anthracis CI]
 gi|300375106|gb|ADK04010.1| response regulator [Bacillus cereus biovar anthracis str. CI]
          Length = 223

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 61/127 (48%), Gaps = 6/127 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +   
Sbjct: 5   RVLVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + + 
Sbjct: 64  SVCKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRR 120

Query: 121 QKSKDEN 127
              +++ 
Sbjct: 121 YTKQEQQ 127


>gi|296133628|ref|YP_003640875.1| two component transcriptional regulator, winged helix family
           [Thermincola sp. JR]
 gi|296032206|gb|ADG82974.1| two component transcriptional regulator, winged helix family
           [Thermincola potens JR]
          Length = 236

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 27/135 (20%), Positives = 57/135 (42%), Gaps = 5/135 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +L+VD    + ++ R      G+ V  A     A E   +E  P+ +V+D  + G   L
Sbjct: 5   KILVVDDEQYIVELIRFNLEKEGYTVITAGDGKIALEQTFREK-PDLIVLDIMLPGVDGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +++      + +  L  + +    + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 64  EVCRTLQRDKETQLIPIIMLTAKGEEIDKVLGLELGADDYMTKPFSPRELVARIKARLRR 123

Query: 121 --QKSKDENQFLDAI 133
             +  + +NQ  + I
Sbjct: 124 NFKAQQSDNQEKENI 138


>gi|229918113|ref|YP_002886759.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sp. AT1b]
 gi|229469542|gb|ACQ71314.1| two component transcriptional regulator, winged helix family
           [Exiguobacterium sp. AT1b]
          Length = 229

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 53/128 (41%), Gaps = 2/128 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+ D    +R +        G+    A++  EA E  ++E   + +++D  M  + 
Sbjct: 5   MFRILVTDDEEQMRDLLVSNLEKEGYETVTASNGLEAIERLKEET-FHLVLLDVMMPELD 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              A +R     ++V +  L    +    I G + GA+ ++ KPF+   L   +    + 
Sbjct: 64  GLTACMRIRE-FSNVPIILLTARSEELDRIHGLKIGADDYITKPFSPRELLARIEATLRR 122

Query: 121 QKSKDENQ 128
             S  + Q
Sbjct: 123 THSFSKEQ 130


>gi|86609993|ref|YP_478755.1| DNA-binding response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
 gi|86558535|gb|ABD03492.1| DNA-binding response regulator [Synechococcus sp. JA-2-3B'a(2-13)]
          Length = 246

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 54/120 (45%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A+   EA E   K+  P+ +V+D  M      
Sbjct: 8   RILVVDDEASIRRILETRLSMIGYDVVTASDGEEALEVFHKQD-PDLVVLDVMMPKLDGY 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 67  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 123


>gi|149922748|ref|ZP_01911173.1| two component transcriptional regulator, winged helix family
           protein [Plesiocystis pacifica SIR-1]
 gi|149816368|gb|EDM75869.1| two component transcriptional regulator, winged helix family
           protein [Plesiocystis pacifica SIR-1]
          Length = 256

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 46/127 (36%), Gaps = 2/127 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+V+    +           G+    A S     E    E  P+ +++D  +     
Sbjct: 3   TTILIVEDEQDLLDTLEFNLQREGYATRRAASGRAGLEAAALEPAPDLVLLDLMLPDISG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +R       V V  L    +    + G   GA+ ++ KPF+   L   +R + +
Sbjct: 63  TEVCRQLRAAERTRSVPVVMLTARGEEVDRVVGFEVGADDYVTKPFSVRELMLRVRAILR 122

Query: 120 MQKSKDE 126
              +K E
Sbjct: 123 RAGTKAE 129


>gi|69248477|ref|ZP_00604751.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Enterococcus faecium DO]
 gi|257878623|ref|ZP_05658276.1| transcriptional regulator [Enterococcus faecium 1,230,933]
 gi|257883117|ref|ZP_05662770.1| transcriptional regulator [Enterococcus faecium 1,231,502]
 gi|257891864|ref|ZP_05671517.1| transcriptional regulator [Enterococcus faecium 1,231,410]
 gi|257894434|ref|ZP_05674087.1| transcriptional regulator [Enterococcus faecium 1,231,408]
 gi|258616852|ref|ZP_05714622.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecium DO]
 gi|260559336|ref|ZP_05831518.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium C68]
 gi|261208012|ref|ZP_05922690.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium TC 6]
 gi|289566892|ref|ZP_06447299.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium D344SRF]
 gi|293556475|ref|ZP_06675049.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1039]
 gi|293563844|ref|ZP_06678277.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1162]
 gi|293567266|ref|ZP_06678620.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1071]
 gi|294615582|ref|ZP_06695438.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1636]
 gi|294619807|ref|ZP_06699197.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1679]
 gi|294622907|ref|ZP_06701820.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium U0317]
 gi|314938083|ref|ZP_07845391.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|314943605|ref|ZP_07850362.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|314949242|ref|ZP_07852591.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
 gi|314952608|ref|ZP_07855600.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|314992456|ref|ZP_07857878.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|314997382|ref|ZP_07862337.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|68194414|gb|EAN08919.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Enterococcus faecium DO]
 gi|257812851|gb|EEV41609.1| transcriptional regulator [Enterococcus faecium 1,230,933]
 gi|257818775|gb|EEV46103.1| transcriptional regulator [Enterococcus faecium 1,231,502]
 gi|257828224|gb|EEV54850.1| transcriptional regulator [Enterococcus faecium 1,231,410]
 gi|257830813|gb|EEV57420.1| transcriptional regulator [Enterococcus faecium 1,231,408]
 gi|260074696|gb|EEW63016.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium C68]
 gi|260077770|gb|EEW65483.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium TC 6]
 gi|289161298|gb|EFD09191.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium D344SRF]
 gi|291590015|gb|EFF21809.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1071]
 gi|291591525|gb|EFF23178.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1636]
 gi|291593940|gb|EFF25424.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1679]
 gi|291597679|gb|EFF28832.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium U0317]
 gi|291601354|gb|EFF31632.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1039]
 gi|291604214|gb|EFF33715.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1162]
 gi|313588550|gb|EFR67395.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|313592998|gb|EFR71843.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|313595276|gb|EFR74121.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|313597723|gb|EFR76568.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|313642572|gb|EFS07152.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|313644383|gb|EFS08963.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
          Length = 234

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 52/128 (40%), Gaps = 1/128 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  +        G+ V  AT   E  E   ++   +++++D  +  + 
Sbjct: 1   MKKILVVDDEPSIVTLLTFNLEKEGYKVTSATDGGEGLELALEQS-FDFIILDVMLPTMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R      +  +  L  + D    I G   GA+ +L KPF+   +   M+ + + 
Sbjct: 60  GMEITQRLRQEKNETPILMLTAKDDQVDRIIGLEIGADDYLTKPFSPREVLARMKAIFRR 119

Query: 121 QKSKDENQ 128
            + + +++
Sbjct: 120 IEPRKQSK 127


>gi|258512529|ref|YP_003185963.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
 gi|257479255|gb|ACV59574.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius subsp. acidocaldarius
           DSM 446]
          Length = 239

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 56/128 (43%), Gaps = 1/128 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE-LLPNYLVIDESMEGV 59
           M ++L+VD    +R +  + F+  GF V        A E  ++     + +V+D  + G+
Sbjct: 1   MPTVLVVDDEASIRTLVEYNFSRSGFDVETVDDGRVAYEKLKQGASKYDLVVLDLMLPGM 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                  R    G  + +  L    +   ++ G   GA+ ++ KPF+   L    R + +
Sbjct: 61  DGLEVCRRLRQEGVKIPIILLTARDEEVDLVLGLELGADDYVTKPFSPRELVARARAVLR 120

Query: 120 MQKSKDEN 127
             +S++E+
Sbjct: 121 RTESREED 128


>gi|312622321|ref|YP_004023934.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor kronotskyensis 2002]
 gi|312202788|gb|ADQ46115.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor kronotskyensis 2002]
          Length = 223

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 22/126 (17%), Positives = 57/126 (45%), Gaps = 7/126 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D    + +V +      GF V  A +  +      K  +PN +++D  +    
Sbjct: 1   MK-ILVIDDDVKICEVIKLYLEKEGFEVVIAHNGMDGIAMF-KNEMPNLVILDIMLPKKD 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R++   +++ +  L  + +    + G   GA+ +++KPF+ + L   ++ + 
Sbjct: 59  GYEVCRELRKI---SNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVL 115

Query: 119 QMQKSK 124
           +  + +
Sbjct: 116 RRTQGE 121


>gi|85711170|ref|ZP_01042230.1| Positive response regulator for pho regulon (CheY-wHTH) [Idiomarina
           baltica OS145]
 gi|85695083|gb|EAQ33021.1| Positive response regulator for pho regulon (CheY-wHTH) [Idiomarina
           baltica OS145]
          Length = 228

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 52/132 (39%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA            E  P+ +++D  + G   
Sbjct: 3   RRILIVEDEAPIREMLSFVMEQHGYQAVEAKDYDSGLAKI-AEPYPDMVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++      ++ +  L    + E  + G   GA+ ++ KPF+ + L   MR + +
Sbjct: 62  IQLAKKIKSDDFTRNIPIIMLTARGEEEDKVRGLEVGADDYITKPFSPKELMARMRAVFR 121

Query: 120 MQKSKDENQFLD 131
                  ++ L+
Sbjct: 122 RVAPTVLDEPLE 133


>gi|209527087|ref|ZP_03275602.1| two component transcriptional regulator, winged helix family
           [Arthrospira maxima CS-328]
 gi|209492515|gb|EDZ92855.1| two component transcriptional regulator, winged helix family
           [Arthrospira maxima CS-328]
          Length = 233

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 55/120 (45%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+    +  + R      GF    + +   A E  +++  P+ +++D  + G+   
Sbjct: 2   NILIVEDEPEIALLIRRTLEAEGFSCQISQNGLSALEIFQQQ-RPDVIILDLMLPGLDGL 60

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              A +RQ P   D ++  L  + +    I G   GA+ +++KPF+   L   +R L + 
Sbjct: 61  EVCARIRQQPGQKDPYILMLTAKGEEIDRIVGLSTGADDYMVKPFSPRELVARVRALLRR 120


>gi|194364602|ref|YP_002027212.1| winged helix family two component transcriptional regulator
           [Stenotrophomonas maltophilia R551-3]
 gi|194347406|gb|ACF50529.1| two component transcriptional regulator, winged helix family
           [Stenotrophomonas maltophilia R551-3]
          Length = 229

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 55/128 (42%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R++         +    A    EA +    + +P+ +++D  + G   
Sbjct: 3   KRILIVDDEPAIREMVAFALRKGDYEPVHAGDAREA-QTAIADRVPDLILLDWMLPGTSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+     R+  L  +V +  L    +    + G  AG + +++KPF+   L   +R + +
Sbjct: 62  LDLARRWRKETLTREVPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMR 121

Query: 120 MQKSKDEN 127
             +  DE+
Sbjct: 122 RAREDDED 129


>gi|229019811|ref|ZP_04176613.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1273]
 gi|229026037|ref|ZP_04182420.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1272]
 gi|228735253|gb|EEL85865.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1272]
 gi|228741482|gb|EEL91680.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1273]
          Length = 239

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLDA 132
             K + E Q  +A
Sbjct: 120 RTKLQQEEQVSEA 132


>gi|85703117|ref|ZP_01034221.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. 217]
 gi|85672045|gb|EAQ26902.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. 217]
          Length = 229

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++LLV+     R+V  +     GF V  A++  EA      E+ P+ +V+D  M     +
Sbjct: 7   TVLLVEDEPAQREVLGYNLQADGFHVLTASNGEEAL-LMVSEMPPDIIVLDWMMPNVSGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++       + +  L    +    + G   GA+ +++KP++   L   +R   + 
Sbjct: 66  EVCRQLKTRSETRGIPIIMLSARSEEVDRVRGLETGADDYVIKPYSLVELMARVRAQLRR 125

Query: 121 QKSKDENQFLD 131
            +     + L+
Sbjct: 126 TRPATVGERLE 136


>gi|229195595|ref|ZP_04322361.1| Two-component response regulator [Bacillus cereus m1293]
 gi|228587844|gb|EEK45896.1| Two-component response regulator [Bacillus cereus m1293]
          Length = 218

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E     +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWEEAENGKEALKKLETNHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ +   
Sbjct: 118 KQEQQEEFQ 126


>gi|15903150|ref|NP_358700.1| DNA-binding response regulator [Streptococcus pneumoniae R6]
 gi|182684045|ref|YP_001835792.1| DNA-binding response regulator [Streptococcus pneumoniae CGSP14]
 gi|15458732|gb|AAK99910.1| Response regulator [Streptococcus pneumoniae R6]
 gi|182629379|gb|ACB90327.1| DNA-binding response regulator [Streptococcus pneumoniae CGSP14]
          Length = 251

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 52/122 (42%), Gaps = 2/122 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 18  MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-QPDIIILDLMLPEID 76

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 77  GLEVA-KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 135

Query: 121 QK 122
            +
Sbjct: 136 SQ 137


>gi|159902728|ref|YP_001550072.1| two-component response regulator [Prochlorococcus marinus str. MIT
           9211]
 gi|159887904|gb|ABX08118.1| two-component response regulator [Prochlorococcus marinus str. MIT
           9211]
          Length = 242

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LLVD    +R   +    D GF V  A    E  +   ++++P+ ++ D  M      
Sbjct: 16  RILLVDDEPGIRTAVQAYLEDEGFAVTTAIDGEEGWQKA-QQIVPDVVISDVMMPRCDGY 74

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+        V +L  +        G +AG + ++ KPF+ + L   +R + + 
Sbjct: 75  GLLKRLREDERLGGTPVIFLTAKGMTIDRTQGYQAGVDDYIPKPFDPDELIARVRNVVKR 134

Query: 121 QK 122
           Q+
Sbjct: 135 QE 136


>gi|325571333|ref|ZP_08146833.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus casseliflavus ATCC 12755]
 gi|325155809|gb|EGC68005.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus casseliflavus ATCC 12755]
          Length = 234

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 51/128 (39%), Gaps = 1/128 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  +        G+ V  A+   +A E    +   +++++D  +  + 
Sbjct: 1   MKKILVVDDEPSIVTLLTFNLEKEGYQVVSASDGQKAYELALSKP-FDFIILDVMLPNMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +      +  +  L  + D    I G   GA+ +L KPF+   +   M+ + + 
Sbjct: 60  GIEITKKLRQEKIETPILVLTAKDDPIDRILGLEIGADDYLTKPFSPREVLARMKAIFRR 119

Query: 121 QKSKDENQ 128
            + + + +
Sbjct: 120 LEPRQQTR 127


>gi|260430664|ref|ZP_05784636.1| phosphate regulon transcriptional regulatory protein PhoB
           [Silicibacter lacuscaerulensis ITI-1157]
 gi|260418105|gb|EEX11363.1| phosphate regulon transcriptional regulatory protein PhoB
           [Silicibacter lacuscaerulensis ITI-1157]
          Length = 228

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 56/131 (42%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++L+V+     R++ R+     GF V +A +  EA     KE  P+ +++D  + G   +
Sbjct: 6   TILVVEDEPSQREIIRYNLEAEGFTVVQAENGDEALLQI-KEAPPDLILLDWMLPGVSGI 64

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++       + V  L    D    + G   GA+ ++ KP++   L   ++   + 
Sbjct: 65  EICRQLKMTAATRAIPVIMLSARSDEVDKVRGLETGADDYVTKPYSVIELMARVKSQFRR 124

Query: 121 QKSKDENQFLD 131
            +     + L+
Sbjct: 125 TRPAAVGERLE 135


>gi|26991996|ref|NP_747421.1| winged helix family two component transcriptional regulator
           [Pseudomonas putida KT2440]
 gi|24987128|gb|AAN70885.1|AE016732_10 DNA-binding response regulator PhoB [Pseudomonas putida KT2440]
          Length = 242

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 17  RNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 75

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 76  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 135

Query: 120 M 120
            
Sbjct: 136 R 136


>gi|226329135|ref|ZP_03804653.1| hypothetical protein PROPEN_03038 [Proteus penneri ATCC 35198]
 gi|225202321|gb|EEG84675.1| hypothetical protein PROPEN_03038 [Proteus penneri ATCC 35198]
          Length = 229

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A  F   +  P+ +++D  + G   
Sbjct: 3   RRILVVEDETAIREMICFVLEQNGFQPIEAEDYDSALSFLI-DPYPDLVLLDWMIPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I  +++     D+ +  L  + + E  + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 62  LQIIKQMKRESNTRDIPIIMLTAKGEEEDKVQGLETGADDYVIKPFSPKELVARVKAILR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|149202581|ref|ZP_01879553.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. TM1035]
 gi|149143863|gb|EDM31897.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. TM1035]
          Length = 229

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++LLV+     R+V  +     GF V  A++  EA      E+ P+ +V+D  M     +
Sbjct: 7   TVLLVEDEPAQREVLGYNLQADGFHVLTASNGEEAL-LMVAEMPPDIIVLDWMMPNVSGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++       + +  L    +    + G   GA+ +++KP++   L   +R   + 
Sbjct: 66  EVCRQLKTRSETRGIPIIMLSARSEEVDRVRGLETGADDYVIKPYSLVELMARVRAQLRR 125

Query: 121 QKSKDENQFLD 131
            +     + L+
Sbjct: 126 TRPATVGERLE 136


>gi|229119190|ref|ZP_04248509.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock1-3]
 gi|228664279|gb|EEL19801.1| Two component transcriptional regulator, winged helix [Bacillus
           cereus Rock1-3]
          Length = 256

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 52/123 (42%), Gaps = 7/123 (5%)

Query: 1   MDS-LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME-- 57
           M   +L+V+    +R+V +       + V+ A +  E  +       P+ +++D  M   
Sbjct: 20  MKRRVLIVEDEENIREVCKRYLEREEYEVYTAVNGTEGWDLFLTH-QPDLIILDLMMPKK 78

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              E    +RQ    ++V +  L  + +    I G   GA+ ++ KPF+   L   ++ +
Sbjct: 79  DGWELCEEIRQQ---SNVPIIMLTAKGEERDRILGLTMGADDYVTKPFSPRELVLRVQII 135

Query: 118 PQM 120
            + 
Sbjct: 136 LRR 138


>gi|138897044|ref|YP_001127497.1| two-component response regulater [Geobacillus thermodenitrificans
           NG80-2]
 gi|196249865|ref|ZP_03148561.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. G11MC16]
 gi|134268557|gb|ABO68752.1| Two-component response regulater [Geobacillus thermodenitrificans
           NG80-2]
 gi|196210741|gb|EDY05504.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. G11MC16]
          Length = 237

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 50/128 (39%), Gaps = 6/128 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V  A    EA +  E E +P+ +++D  +     
Sbjct: 3   KRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVE-ETMPDLILLDIMLPLKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  MEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKSKDEN 127
                   
Sbjct: 119 RHAQTATQ 126


>gi|241765260|ref|ZP_04763241.1| two component transcriptional regulator, winged helix family
           [Acidovorax delafieldii 2AN]
 gi|241365051|gb|EER59943.1| two component transcriptional regulator, winged helix family
           [Acidovorax delafieldii 2AN]
          Length = 243

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 45/123 (36%), Gaps = 1/123 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R + R      GF V  A     A          + +V+D  M G    
Sbjct: 10  KILVVDDDARIRDLLRRYLTQEGFEVMVAEDGK-ALNRLLLRETVDLIVLDLMMPGEDGL 68

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R         +  L  + +    I G   GA+ +L KPFN   L   +  + + + 
Sbjct: 69  SICRRLRAANDRTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARVHAVLRRRP 128

Query: 123 SKD 125
           +++
Sbjct: 129 AQE 131


>gi|269138436|ref|YP_003295136.1| phosphate regulon transcriptional regulatory protein [Edwardsiella
           tarda EIB202]
 gi|267984096|gb|ACY83925.1| phosphate regulon transcriptional regulatory protein [Edwardsiella
           tarda EIB202]
 gi|304558462|gb|ADM41126.1| Phosphate regulon transcriptional regulatory protein PhoB
           [Edwardsiella tarda FL6-60]
          Length = 229

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R +   +    G+   EA S   A      E  P+ +++D  + G    
Sbjct: 4   RILVVEDETPIRDMVSFVLEQNGYQPLEAESYDGALSQLC-EPYPDLILLDWMLPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             I  +++ P   ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  QLIKQLKREPATREIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMRR 122

Query: 121 QKSKDENQFLD 131
                  + ++
Sbjct: 123 ISPMALEETIN 133


>gi|296136175|ref|YP_003643417.1| two component transcriptional regulator, winged helix family
           [Thiomonas intermedia K12]
 gi|295796297|gb|ADG31087.1| two component transcriptional regulator, winged helix family
           [Thiomonas intermedia K12]
          Length = 244

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+V+    + ++        G     A S  EA     +++LP+ L+ID  + G+   
Sbjct: 6   NILIVEDEPAIAELLAMNLQHAGHCPIRAGSAEEAL-RVIRDVLPDVLLIDWMLPGMSGV 64

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R       + +  L    +    + G  AGA+ ++ KPF+ + L   +R + + 
Sbjct: 65  ALARALRTDARTKAIPIIMLTARSEEGDKVQGLDAGADDYITKPFSPKELLARIRAVLRR 124

Query: 121 QKSK 124
           +  +
Sbjct: 125 RAPQ 128


>gi|313112960|ref|ZP_07798604.1| response regulator receiver domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
 gi|310624725|gb|EFQ08036.1| response regulator receiver domain protein [Faecalibacterium cf.
           prausnitzii KLE1255]
          Length = 232

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 22/118 (18%), Positives = 50/118 (42%), Gaps = 2/118 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++ R      G+ V  A    E  E    ++ P+ +++D  M  +   
Sbjct: 5   KILVVDDDTNICELLRLYLTKEGYQVTVANDGEEGLEKF-NQVKPDMVLLDVMMPKMDGL 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               R    G +  V  L  + +    + G   GA+ +++KPF+ + +   ++ + + 
Sbjct: 64  EVCRRIRKAG-NTPVMMLTAKGETFDKVLGLELGADDYMVKPFDAKEVVARIKAVLRR 120


>gi|326202731|ref|ZP_08192599.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
 gi|325987315|gb|EGD48143.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
          Length = 231

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/123 (19%), Positives = 51/123 (41%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+    +R+         GF V EA S  EA    + E   + +++D  + G+ 
Sbjct: 1   MKRVLIVEDEEDIREFIVINLKRTGFEVVEAESGEEALAIIQNEKNLDIMLLDIMLPGID 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            +    +     + + V  L  +      + G   GA+ +++KPF+   L   +  + + 
Sbjct: 61  GYKVLKKTRENNSSIGVIMLTAKSQEIDKVTGLSYGADDYIVKPFSPIELIARIDAILRR 120

Query: 121 QKS 123
             +
Sbjct: 121 INN 123


>gi|153870385|ref|ZP_01999797.1| Response regulator receiver protein [Beggiatoa sp. PS]
 gi|152073147|gb|EDN70201.1| Response regulator receiver protein [Beggiatoa sp. PS]
          Length = 855

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/131 (19%), Positives = 58/131 (44%), Gaps = 2/131 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   +   V  +  +   +   +A S  EA    E+ L+P+ +++D  M  +   
Sbjct: 562 KILIVDDEAVNLHVLANHLSLNHYATIQAASGREALSILEEGLIPDLILLDVMMPHMTGY 621

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+     ++ +  L  +     ++ G   GAN +L+KP ++  L   ++    +
Sbjct: 622 EVTQKIREHWEANELPIVLLTAKNQVSDLVMGLEVGANDYLIKPISKNELLARIKTHLHI 681

Query: 121 QKSKDENQFLD 131
           ++ + E   L 
Sbjct: 682 KQLRAETLRLA 692


>gi|298490023|ref|YP_003720200.1| winged helix family two component transcriptional regulator
           ['Nostoc azollae' 0708]
 gi|298231941|gb|ADI63077.1| two component transcriptional regulator, winged helix family
           ['Nostoc azollae' 0708]
          Length = 242

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   K   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTAGDGEEALETFRKAE-PDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|146321223|ref|YP_001200934.1| response regulator [Streptococcus suis 98HAH33]
 gi|253753905|ref|YP_003027046.1| response regulator protein [Streptococcus suis P1/7]
 gi|253755220|ref|YP_003028360.1| response regulator protein [Streptococcus suis BM407]
 gi|330832445|ref|YP_004401270.1| response regulator [Streptococcus suis ST3]
 gi|145692029|gb|ABP92534.1| Response regulator consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Streptococcus suis
           98HAH33]
 gi|251817684|emb|CAZ55432.1| response regulator protein [Streptococcus suis BM407]
 gi|251820151|emb|CAR46488.1| response regulator protein [Streptococcus suis P1/7]
 gi|292558663|gb|ADE31664.1| Response regulator receiver: Transcriptional regulatory protein,
           C-terminal [Streptococcus suis GZ1]
 gi|319758447|gb|ADV70389.1| response regulator [Streptococcus suis JS14]
 gi|329306668|gb|AEB81084.1| response regulator [Streptococcus suis ST3]
          Length = 234

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 56/132 (42%), Gaps = 2/132 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAE-FPDIVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R +   ++V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-RTIRKTSNVPILMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QKSKDENQFLDA 132
            +  +    +++
Sbjct: 119 SELAETQTNIES 130


>gi|253575382|ref|ZP_04852720.1| multi-component transcriptional regulator [Paenibacillus sp. oral
           taxon 786 str. D14]
 gi|251845379|gb|EES73389.1| multi-component transcriptional regulator [Paenibacillus sp. oral
           taxon 786 str. D14]
          Length = 248

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 52/131 (39%), Gaps = 6/131 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
           +L+VD    +R + R      GF V EAT+  EA E        + +++D  +  +    
Sbjct: 16  VLVVDDEWNMRNLLRIYLTREGFEVKEATNGNEALEMA-ANHHFDIILLDLMLPDMDGWQ 74

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+      V +  L    + +  + G   GA+ +L KPF  E L   +  L +  
Sbjct: 75  VCKKIREKD---HVAILMLTARSETKDKVYGLGIGADDYLTKPFEPEELLARVYSLIRRS 131

Query: 122 KSKDENQFLDA 132
                 +  +A
Sbjct: 132 AITQSIRRQEA 142


>gi|323492021|ref|ZP_08097186.1| chitin catabolic cascade sensor histidine kinase ChiS [Vibrio
           brasiliensis LMG 20546]
 gi|323313750|gb|EGA66849.1| chitin catabolic cascade sensor histidine kinase ChiS [Vibrio
           brasiliensis LMG 20546]
          Length = 1128

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 38/130 (29%), Positives = 57/130 (43%), Gaps = 5/130 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
           LL+VD   +  +V        G+ V  A    EA E  EKE  P  L++D  M G+    
Sbjct: 724 LLVVDDEPVNLRVLDSFLRLEGYRVRTAKDGHEALEAVEKEK-PELLLLDIMMPGMSGYQ 782

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+      + V  L      +  I G  AGAN +L KPFN++ L   +  +  + 
Sbjct: 783 VCETLRKSYDHAALPVIMLTALNQTDDRIRGFNAGANDYLSKPFNKQELAARI--IAHLT 840

Query: 122 KSKDENQFLD 131
            SK E + L+
Sbjct: 841 ASKAEQRRLE 850


>gi|242240331|ref|YP_002988512.1| two component transcriptional regulator PhoB, winged helix family
           [Dickeya dadantii Ech703]
 gi|242132388|gb|ACS86690.1| two component transcriptional regulator PhoB, winged helix family
           [Dickeya dadantii Ech703]
          Length = 229

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQPVEAEDYDVAVSRL-AEPYPELVLLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  LQFIKHMKREALTRDIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RISPMAVEEVIE 133


>gi|89896867|ref|YP_520354.1| hypothetical protein DSY4121 [Desulfitobacterium hafniense Y51]
 gi|89336315|dbj|BAE85910.1| hypothetical protein [Desulfitobacterium hafniense Y51]
          Length = 238

 Score =  152 bits (385), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 25/124 (20%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +LLV+   I++++  +     G+ V  A     A +  +KE  P+ +++D  +    
Sbjct: 5   MVKILLVEDDVIIQELVNYNLQREGYTVIIAEEGNSALQLLDKEK-PDLVLLDVMLPELD 63

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    +R       + +  L    +    + G   GA+ ++ KPF+   L   ++   
Sbjct: 64  GLEVCKKIRGNQETASLPIIMLSARDEVADRVIGLELGADDYVTKPFSPRELLARIKARL 123

Query: 119 QMQK 122
           + +K
Sbjct: 124 REEK 127


>gi|300868157|ref|ZP_07112789.1| Response regulator receiver domain protein [Oscillatoria sp. PCC
           6506]
 gi|300333781|emb|CBN57969.1| Response regulator receiver domain protein [Oscillatoria sp. PCC
           6506]
          Length = 228

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 53/133 (39%), Gaps = 4/133 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD     + V        G+ V  A+S  EA    E    P+ ++ D  M  + 
Sbjct: 1   MQKILVVDDELDCQAVLAIYLESRGYQVECASSGLEALSIFESNP-PDLVISDVMMPHMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R   LG  V   +L  + + E  + G   G + +L+KPF  + +   ++   
Sbjct: 60  GFEFCRRLRSSRLGQLVPFIFLSGQGELESKVEGHSIGGDDYLVKPFQPKEILAKVKGQL 119

Query: 119 QM-QKSKDENQFL 130
           +   +   E   L
Sbjct: 120 ERSHRIHAEIVRL 132


>gi|289578661|ref|YP_003477288.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
 gi|297544881|ref|YP_003677183.1| winged helix family two component transcriptional regulator
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|289528374|gb|ADD02726.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
 gi|296842656|gb|ADH61172.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 234

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 19/128 (14%), Positives = 57/128 (44%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +L+++    + ++ R+     G+ V  + +  E  +   +E  P+ +++D  +     L
Sbjct: 4   RVLVIEDEVHILELLRYNLEAAGYKVITSENGKEGLDKALEEK-PDLVILDLMLPDVDGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +++     ++ +  L  + +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  EICKILKKNDETKNIPIIMLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVLRR 122

Query: 121 QKSKDENQ 128
            +  +E +
Sbjct: 123 TQQPEEEK 130


>gi|239988860|ref|ZP_04709524.1| putative two-component systen response regulator [Streptomyces
           roseosporus NRRL 11379]
          Length = 246

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  R      G+    A    +A    E    P+ +V+D  M  +  
Sbjct: 9   QRILIVDDEPAVREALRRSLAFEGYGTQVAVDGYDALAMAEA-YAPDLIVLDIQMPRMDG 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+   +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 68  LTAARRIRATGSTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 126


>gi|281412572|ref|YP_003346651.1| two component transcriptional regulator, winged helix family
           [Thermotoga naphthophila RKU-10]
 gi|281373675|gb|ADA67237.1| two component transcriptional regulator, winged helix family
           [Thermotoga naphthophila RKU-10]
          Length = 239

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 57/129 (44%), Gaps = 3/129 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + ++  +  +  G+ V +A    EA +    E + +  ++D  + G+  
Sbjct: 4   KKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDV-DMFIVDIMLPGIDG 62

Query: 62  FI--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R +    +  V +L  + +    + G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  FELVRKIRAIEKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAVFR 122

Query: 120 MQKSKDENQ 128
              +  +++
Sbjct: 123 RLSAATQSK 131


>gi|223936068|ref|ZP_03627982.1| two component transcriptional regulator, winged helix family
           [bacterium Ellin514]
 gi|223895290|gb|EEF61737.1| two component transcriptional regulator, winged helix family
           [bacterium Ellin514]
          Length = 226

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 26/126 (20%), Positives = 52/126 (41%), Gaps = 1/126 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+++    +R   +      G+ V  A    E  +    E  P+ +++D  M  + 
Sbjct: 1   MARILIIEDEVPMRTALKDCLEGEGYRVITAADGEEGLKRVMAEK-PDLVLLDVMMPKLD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F        L   V +  L  +   E  + G  AGA+ +L+KPF+ + L   +R + + 
Sbjct: 60  GFALCAELRRLANPVPILMLTAKGQIEDRVTGLDAGADDYLVKPFSTDELLARVRAMLRR 119

Query: 121 QKSKDE 126
            + +  
Sbjct: 120 HQREKR 125


>gi|159027454|emb|CAO89419.1| ycf27 [Microcystis aeruginosa PCC 7806]
          Length = 246

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 52/122 (42%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E       P+ +V+D  M      
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYEVVTAADGEEALETFRTAE-PDLVVLDVMMPKLDGY 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 70  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 126

Query: 121 QK 122
            +
Sbjct: 127 VE 128


>gi|315186290|gb|EFU20051.1| two component transcriptional regulator, winged helix family
           [Spirochaeta thermophila DSM 6578]
          Length = 226

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 56/120 (46%), Gaps = 3/120 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD    + ++ R      G+ V       +A E   + LLP+ +++D  + G+  L
Sbjct: 2   TILVVDDEPDIVELVRFHLEREGYEVVSTGEGRDALEKA-RNLLPDAIILDLMLPGMSGL 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +RQ    + + +  L  + +   ++ G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 61  EVCRLLRQQDRTSHIPILMLTAKSEETDVVVGLELGADDYITKPFSPRILLARLKAVLKR 120


>gi|301059336|ref|ZP_07200263.1| putative Sensory transduction protein regX3 [delta proteobacterium
           NaphS2]
 gi|300446565|gb|EFK10403.1| putative Sensory transduction protein regX3 [delta proteobacterium
           NaphS2]
          Length = 235

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 48/129 (37%), Gaps = 5/129 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M  +L+ +    +           G+ V  A+   EA +   K    + +++D  M G  
Sbjct: 2   MAHILVAEDDRHILSGLVDTLESEGYQVMPASDGEEALDLF-KNNPFDLVLLDIMMPGKS 60

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             +    +R      D+ +  L  + +    + G + GA+ ++ KPF    L   +  + 
Sbjct: 61  GYDVCREIRSTDE--DIPIIMLTAKGEEIDKVVGLQLGADDYITKPFGVHELLARIAAVL 118

Query: 119 QMQKSKDEN 127
           +  +   E 
Sbjct: 119 RRARRNHEE 127


>gi|311032627|ref|ZP_07710717.1| two-component response regulator [Bacillus sp. m3-13]
          Length = 227

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 52/126 (41%), Gaps = 5/126 (3%)

Query: 1   MDS---LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
           M +   +L+VD    +R++         + V  A +  EA +      + + +++D  M 
Sbjct: 1   MKNAFCVLVVDDEAEMREMLGMYLQKENYQVLHAENGEEALDMLYDHEV-DLIILDVMMP 59

Query: 58  GVLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            +  F A  +       + +  L  + D    + G + GA+ +++KPF+ + L   +  L
Sbjct: 60  DMDGFTACKKIREKYM-MPILMLTAKSDELDKVRGLKLGADDYVMKPFSPKELLARVEAL 118

Query: 118 PQMQKS 123
            +    
Sbjct: 119 LRRSNQ 124


>gi|197103973|ref|YP_002129350.1| phosphate regulon response regulator PhoB [Phenylobacterium
           zucineum HLK1]
 gi|196477393|gb|ACG76921.1| phosphate regulon response regulator PhoB [Phenylobacterium
           zucineum HLK1]
          Length = 230

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+V+    +  + ++     G+ V  A    EA     +E LP+ +V+D  +     +
Sbjct: 5   RILIVEDEDSLATLLQYNLEKEGYEVAAAGDGEEALLQV-QERLPDLIVLDWMLPKVSGI 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +RQ P   +V +  L    +    I G   GA+ +++KPF    L   +R + + 
Sbjct: 64  EVCRRLRQRPESRNVPIIMLTARGEETDRIRGLDTGADDYVVKPFAMSELAARIRAVLRR 123

Query: 121 QK 122
            +
Sbjct: 124 LR 125


>gi|197283966|ref|YP_002149838.1| phosphate regulon transcriptional regulator [Proteus mirabilis
           HI4320]
 gi|194681453|emb|CAR40291.1| phosphate regulon transcriptional regulator (two-component response
           regulator) [Proteus mirabilis HI4320]
          Length = 229

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A  F   +  P+ +++D  + G   
Sbjct: 3   RRILVVEDETAIREMICFVLEQNGFQPIEAEDYDTALSFLI-DPYPDLVLLDWMIPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I  +++     D+ +  L  + + E  + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 62  IQVIKQMKRENNTRDIPIIMLTAKGEEEDKVKGLETGADDYVIKPFSPKELVARVKAILR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|332523446|ref|ZP_08399698.1| transcriptional regulatory protein WalR [Streptococcus porcinus
           str. Jelinkova 176]
 gi|332314710|gb|EGJ27695.1| transcriptional regulatory protein WalR [Streptococcus porcinus
           str. Jelinkova 176]
          Length = 236

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ +  A    EA    E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIMTAFDGREAITIFE-EDKPDLVILDLMLPEMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|42783766|ref|NP_981013.1| DNA-binding response regulator PhoP [Bacillus cereus ATCC 10987]
 gi|222098050|ref|YP_002532107.1| DNA-binding response regulator phop [Bacillus cereus Q1]
 gi|229198737|ref|ZP_04325435.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1293]
 gi|42739696|gb|AAS43621.1| DNA-binding response regulator PhoP [Bacillus cereus ATCC 10987]
 gi|221242108|gb|ACM14818.1| DNA-binding response regulator PhoP [Bacillus cereus Q1]
 gi|228584759|gb|EEK42879.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1293]
 gi|324328481|gb|ADY23741.1| DNA-binding response regulator PhoP [Bacillus thuringiensis serovar
           finitimus YBT-020]
          Length = 239

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLDA 132
             K + E Q  ++
Sbjct: 120 RTKLQQEEQVTES 132


>gi|220930753|ref|YP_002507662.1| transcriptional regulator [Clostridium cellulolyticum H10]
 gi|220001081|gb|ACL77682.1| two component transcriptional regulator, winged helix family
           [Clostridium cellulolyticum H10]
          Length = 230

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 46/119 (38%), Gaps = 2/119 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +  + +      G+   EA    EA      +  P+ +++D  +  +  
Sbjct: 3   KKILIVDDEKNIVDILKFNLKKEGYDTIEAYDGEEAVNLALSQS-PDLILLDIMLPKMDG 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           F    R++       +  L  + +    + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 62  FTVC-RKLRQSISTPILMLTAKEEEVDKVLGLELGADDYITKPFSPRELMARVKANLRR 119


>gi|297193530|ref|ZP_06910928.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197718196|gb|EDY62104.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 237

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/118 (24%), Positives = 48/118 (40%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    VR+  +      G+    A    +A    E    P+ +V+D  M  +   
Sbjct: 6   RILIVDDEPAVREALQRSLAFEGYGTEVAADGIDALARAEV-YAPDLIVLDIQMPRMDGL 64

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            A  R    G+ V +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 65  TAARRLRAAGSTVPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 122


>gi|332296828|ref|YP_004438750.1| two component transcriptional regulator, winged helix family
           [Treponema brennaborense DSM 12168]
 gi|332179931|gb|AEE15619.1| two component transcriptional regulator, winged helix family
           [Treponema brennaborense DSM 12168]
          Length = 248

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 54/127 (42%), Gaps = 4/127 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    + ++  +     GF V  A +  +A +    E  P+ +++D  +  + 
Sbjct: 1   MK-ILVVDDEMPILELVSYNLQKEGFSVVTAENGTKALQIARSEH-PDLIILDLMLPDMS 58

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R       + +     + +   +++G   GA+ ++ KPF+ + L   ++ + 
Sbjct: 59  GFDICRILRNDKTTAVIPIVMATAKTEDTDVVSGLELGADDYVTKPFSPKVLVARVKNIL 118

Query: 119 QMQKSKD 125
           +  +   
Sbjct: 119 RRAQEAK 125


>gi|114765354|ref|ZP_01444471.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pelagibaca bermudensis HTCC2601]
 gi|114542334|gb|EAU45363.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseovarius sp. HTCC2601]
          Length = 229

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 27/131 (20%), Positives = 56/131 (42%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++L+V+     R+V R+     GF V  A +  EA    ++E  P+ +V+D  +     +
Sbjct: 7   TVLVVEDEASQREVLRYNLEAEGFRVAAAGNGEEALVMLDEEE-PDVIVLDWMLPNLSGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++  P    V V  L    +    + G   GA+ +++KP++   L   ++   + 
Sbjct: 66  EVCRQIKTRPETRGVPVIMLSARSEEIDRVRGLETGADDYVVKPYSLRELMARVKAQLRR 125

Query: 121 QKSKDENQFLD 131
            +       L+
Sbjct: 126 ARPAAAGLRLE 136


>gi|302336523|ref|YP_003801730.1| two component transcriptional regulator, winged helix family
           [Olsenella uli DSM 7084]
 gi|301320363|gb|ADK68850.1| two component transcriptional regulator, winged helix family
           [Olsenella uli DSM 7084]
          Length = 241

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 52/128 (40%), Gaps = 2/128 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +LLV+    +R          G++V        A E  EK    + +V+D  +  +  
Sbjct: 6   KRILLVEDEKAIRDAVAAYLEREGYVVRGVGDGQSALEEFEKHS-FDLIVLDLMLPKLSG 64

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R +   + V +  L  + + E  I G   GA+ +++KPF+   L   +R L +  
Sbjct: 65  -ERVCRAVRETSSVPIIMLTAKGEVEDRIIGLELGADDYVIKPFSPRELVARVRALLRRA 123

Query: 122 KSKDENQF 129
            ++ E Q 
Sbjct: 124 HAEAEPQL 131


>gi|22297889|ref|NP_681136.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22294067|dbj|BAC07898.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 121

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+V+ S   R++   L    GF V  AT   EA E  ++   P+ +V+D  M  + 
Sbjct: 1   MTKVLVVEDSPPQREMISELLAKTGFEVTVATDGVEAMEQLQQST-PDVVVLDIVMPRMN 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    ++  P    + V     + +      G + GA++++ KPF+ + L   +++L 
Sbjct: 60  GYEVCRQIKSDPRTQSIPVVMCSSKGEEFDRYWGMKQGADAYITKPFDPKELVGTIKQLL 119

Query: 119 Q 119
           +
Sbjct: 120 R 120


>gi|332664922|ref|YP_004447710.1| adenylate/guanylate cyclase [Haliscomenobacter hydrossis DSM 1100]
 gi|332333736|gb|AEE50837.1| adenylate/guanylate cyclase [Haliscomenobacter hydrossis DSM 1100]
          Length = 1603

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 54/124 (43%), Gaps = 2/124 (1%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
            +L+VD   I ++V +   +   + +  A +  +A +        + +++D  M  +   E
Sbjct: 1193 ILVVDDEPINQQVLKSHLSALKYDITSALNGEDALKALSNGKHFDLVLLDVMMPRMSGYE 1252

Query: 62   FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                +R+  L +++ V  +  +   + ++ G   GAN ++ KPF ++     ++    + 
Sbjct: 1253 VCEQIRKKFLPSELPVIMITAKNQVQDLVHGLNTGANDYITKPFTKDEFLARVKTHLNLH 1312

Query: 122  KSKD 125
            +   
Sbjct: 1313 QIHA 1316


>gi|327395749|dbj|BAK13171.1| transcriptional regulatory protein CpxR [Pantoea ananatis AJ13355]
          Length = 249

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 52/131 (39%), Gaps = 7/131 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M+ +LLVD    +  + + L    GF V  A+   +A      +   + L++D  M    
Sbjct: 18  MNKILLVDDDRELTSLLKELLEMEGFEVVVASDGEQALNLL--DNSIDLLLLDVMMPKKN 75

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++ +  +RQ        V  L         + G   GA+ +L KPFN   L   +R + 
Sbjct: 76  GIDTLKELRQQ---YQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAIL 132

Query: 119 QMQKSKDENQF 129
           +     ++ Q 
Sbjct: 133 RRSNWSEQQQQ 143


>gi|229175297|ref|ZP_04302812.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus MM3]
 gi|228608129|gb|EEK65436.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus MM3]
          Length = 239

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLDA 132
             K + E Q  +A
Sbjct: 120 RTKLQQEEQVKEA 132


>gi|254432325|ref|ZP_05046028.1| DNA-binding response regulator [Cyanobium sp. PCC 7001]
 gi|197626778|gb|EDY39337.1| DNA-binding response regulator [Cyanobium sp. PCC 7001]
          Length = 253

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++     +  G+ V  A+   EA E C +E  P+ +V+D  M      
Sbjct: 15  TILVVDDEASIRRILETRLSMIGYQVVTASDGMEALE-CFRESHPDLVVLDVMMPKLDGY 73

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 74  GVCQELRKE---SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 130

Query: 121 QKSKD 125
            + + 
Sbjct: 131 VEKEQ 135


>gi|229013792|ref|ZP_04170920.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides DSM 2048]
 gi|228747461|gb|EEL97336.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides DSM 2048]
          Length = 239

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRIM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLDA 132
             K + E Q  ++
Sbjct: 120 RTKLQQEEQVSES 132


>gi|190573011|ref|YP_001970856.1| putative phosphate regulon two-component response regulator
           transcriptional regulator [Stenotrophomonas maltophilia
           K279a]
 gi|254521224|ref|ZP_05133279.1| phosphate regulon transcriptional regulatory protein PhoB
           [Stenotrophomonas sp. SKA14]
 gi|190010933|emb|CAQ44542.1| putative phosphate regulon two-component response regulator
           transcriptional regulatory protein [Stenotrophomonas
           maltophilia K279a]
 gi|219718815|gb|EED37340.1| phosphate regulon transcriptional regulatory protein PhoB
           [Stenotrophomonas sp. SKA14]
          Length = 229

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 55/128 (42%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R++         +    A    EA +    + +P+ +++D  + G   
Sbjct: 3   KRILIVDDEPAIREMVAFALRKGDYEPVHAGDAREA-QTAIADRVPDLILLDWMLPGTSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+     R+  L  +V +  L    +    + G  AG + +++KPF+   L   +R + +
Sbjct: 62  LDLARRWRKETLTREVPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMR 121

Query: 120 MQKSKDEN 127
             +  DE+
Sbjct: 122 RAREDDED 129


>gi|149072098|ref|YP_001293493.1| OmpR-like protein [Rhodomonas salina]
 gi|134303049|gb|ABO70853.1| OmpR-like protein [Rhodomonas salina]
          Length = 248

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA    +KE  PN +V+D  +      
Sbjct: 11  KILVVDDEASIRRILETRLSMIGYNVVTAADGEEALNLLKKEN-PNLIVLDIMIPKLDGY 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 70  GVCQEIRKE---SDVPIIMLTALGDVADRITGLELGADDYVIKPFSPKELEARIRSVLRR 126

Query: 121 QK 122
            +
Sbjct: 127 VE 128


>gi|6687469|emb|CAB64972.1| VicR protein [Enterococcus faecalis]
          Length = 283

 Score =  151 bits (384), Expect = 2e-35,   Method: Composition-based stats.
 Identities = 23/119 (19%), Positives = 52/119 (43%), Gaps = 2/119 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + ++ ++     G+ VF A    EA E  E E+ P+ +++D  +  +  
Sbjct: 51  KKILVVDDEKPISEIVKYNLVKEGYEVFTAYDGEEALEKVE-EVEPDLIILDLMLPKMDG 109

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 110 LEVA-REVRKTHDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 167


>gi|332669166|ref|YP_004452174.1| winged helix family transcriptional regulator [Cellulomonas fimi
           ATCC 484]
 gi|332338204|gb|AEE44787.1| two component transcriptional regulator, winged helix family
           [Cellulomonas fimi ATCC 484]
          Length = 242

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 50/121 (41%), Gaps = 1/121 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    +R++        GF V  A     A     +++ P+ +V+D  +  +  F
Sbjct: 11  RLLVVDDEPNIRELLATSLRFAGFEVHAAADGGAALRLA-RDVEPDLVVLDVMLPDMDGF 69

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V +L    D    + G   G + ++ KPF+ E +   +R + +   
Sbjct: 70  TVTRRLREKGQHVPVLFLTARDDTADKVQGLTVGGDDYVTKPFSLEEVVARIRAILRRTS 129

Query: 123 S 123
           +
Sbjct: 130 A 130


>gi|284052014|ref|ZP_06382224.1| two component transcriptional regulator [Arthrospira platensis str.
           Paraca]
 gi|291569758|dbj|BAI92030.1| two-component response regulator [Arthrospira platensis NIES-39]
          Length = 243

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A    EA E   +   P+ +V+D  M      
Sbjct: 7   RILVVDDEASIRRILETRLSMIGYDVVTAADGEEALETF-RLTEPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDIPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122


>gi|1575577|gb|AAC44436.1| DNA-binding response regulator [Thermotoga maritima]
          Length = 239

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + ++  +  +  G+ V +A    EA +    E + +  ++D  + G+  
Sbjct: 4   KKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDV-DMFIVDIMLPGIDG 62

Query: 62  FI--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R M    +  V +L  + +    + G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  FELVRKIRSMEKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|285017381|ref|YP_003375092.1| two-component system regulatory protein phob [Xanthomonas
           albilineans GPE PC73]
 gi|283472599|emb|CBA15104.1| probable two-component system regulatory protein phob [Xanthomonas
           albilineans]
          Length = 229

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 54/128 (42%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R +         F    A    EA +    + +P+ +++D  + G   
Sbjct: 3   KRILIVDDEPAIRDMVAFALRKGDFEPVHAGDAREA-QSLIADRVPDLILLDWMLPGTSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE     R+  +  +V +  L    +    + G  AG + +++KPF+   L   +R + +
Sbjct: 62  LELARRWRKDAMTREVPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMR 121

Query: 120 MQKSKDEN 127
             +  DE+
Sbjct: 122 RTREDDED 129


>gi|153875667|ref|ZP_02003366.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
 gi|152067869|gb|EDN66634.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
          Length = 365

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 50/128 (39%), Gaps = 3/128 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           LL+VD      K+  ++     F V  A    +A E       P+ +++D  M G+  F 
Sbjct: 9   LLIVDDIPTNLKLLMNVLRHLDFTVQVAQDGEDALEQVAYAK-PDLILLDVMMPGMDGFE 67

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++      D+ V ++    +    + G   GA  ++ KP   E +   +    +++
Sbjct: 68  TCRRLKADEKTHDIPVIFMTALTETVDKVKGFEIGAVDYITKPVQPEEVLARVNTHLKLR 127

Query: 122 KSKDENQF 129
           K +   + 
Sbjct: 128 KQQKRLEQ 135


>gi|119484444|ref|ZP_01619061.1| Response Regulator Receiver Signal Transduction Histidine Kinase
           [Lyngbya sp. PCC 8106]
 gi|119457918|gb|EAW39041.1| Response Regulator Receiver Signal Transduction Histidine Kinase
           [Lyngbya sp. PCC 8106]
          Length = 437

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 33/136 (24%), Positives = 61/136 (44%), Gaps = 7/136 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+VD S +  KV      + G+ V  A +   A +    +  P+ +++D  M G+  F 
Sbjct: 11  ILIVDDSPVHLKVLSESLVNAGYEVAVAINGETALKQALYDP-PDLILLDIQMPGMDGFE 69

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM- 120
               ++  P    V + ++    D    I G +AGA  +L KPF +E +   ++   Q+ 
Sbjct: 70  TCHQLKAHPSTQAVPIIFMTALADTSSKIKGLKAGAVDYLTKPFQQEEVLARIKVHLQIK 129

Query: 121 ---QKSKDENQFLDAI 133
              Q   ++N  LD +
Sbjct: 130 DLTQSLLEKNLLLDQL 145


>gi|229068949|ref|ZP_04202243.1| Two-component response regulator [Bacillus cereus F65185]
 gi|229078583|ref|ZP_04211141.1| Two-component response regulator [Bacillus cereus Rock4-2]
 gi|228704727|gb|EEL57155.1| Two-component response regulator [Bacillus cereus Rock4-2]
 gi|228714233|gb|EEL66114.1| Two-component response regulator [Bacillus cereus F65185]
          Length = 218

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 61/129 (47%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E     +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|223932685|ref|ZP_03624684.1| two component transcriptional regulator, winged helix family
           [Streptococcus suis 89/1591]
 gi|223898655|gb|EEF65017.1| two component transcriptional regulator, winged helix family
           [Streptococcus suis 89/1591]
          Length = 234

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 56/132 (42%), Gaps = 2/132 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAE-FPDIVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R +   ++V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-RTIRKTSNVPILMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QKSKDENQFLDA 132
            +  +    +++
Sbjct: 119 SELAETQTNIES 130


>gi|254524305|ref|ZP_05136360.1| two component transcriptional regulator, winged helix family
           [Stenotrophomonas sp. SKA14]
 gi|219721896|gb|EED40421.1| two component transcriptional regulator, winged helix family
           [Stenotrophomonas sp. SKA14]
          Length = 239

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 30/131 (22%), Positives = 54/131 (41%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +  + R    D G+ V  A S        E+E   + LV+D  + GV  
Sbjct: 4   KRVLIVEDDAHIADLLRMHLGDEGYDVAHAASGDAGLRLLEQEGPWDALVLDVMLPGVDG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R   +   V +  +       + I G   GA+ +L KPF+   L   +R L +  
Sbjct: 64  LQVCQRARAMARYVPIIIISARGSETQRIVGLELGADDYLAKPFSMPELVARVRALLRRA 123

Query: 122 KSKDENQFLDA 132
           ++  ++  +DA
Sbjct: 124 EAMAQSARIDA 134


>gi|56461211|ref|YP_156492.1| positive response regulator for pho regulon (CheY-wHTH) [Idiomarina
           loihiensis L2TR]
 gi|56180221|gb|AAV82943.1| Positive response regulator for pho regulon (CheY-wHTH) [Idiomarina
           loihiensis L2TR]
          Length = 228

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 54/132 (40%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A +    E  P+ +++D  + G   
Sbjct: 3   RRILIVEDEAPIREMLSFVMEQHGYQAVEANDFDAAVDKI-AEPYPDMVLLDWMLPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 ++      ++ +  L    + E  + G   GA+ ++ KPF+ + L   MR + +
Sbjct: 62  LQLAKKIKGDDFTRNIPIIMLTARGEEEDKVKGLEVGADDYITKPFSPKELMARMRAVFR 121

Query: 120 MQKSKDENQFLD 131
                  ++ L+
Sbjct: 122 RVAPTVLDEPLE 133


>gi|22298806|ref|NP_682053.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22294987|dbj|BAC08815.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 226

 Score =  151 bits (384), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 56/125 (44%), Gaps = 3/125 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            LLLVD    VR+       D GF V    +   A E+ E   +P+ ++ D  M  +   
Sbjct: 4   KLLLVDDEPGVREAVSAYLEDSGFEVTAVANAQAALEYLETH-VPDVIITDIMMPQMDGY 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F+  VRQ P  + + V +L         I G  AG +++L KPF+ + L   ++ L + 
Sbjct: 63  AFLETVRQQPHLSHIPVIFLTARGMTRDRIQGYDAGCDAYLAKPFDPDELVAIIKNLLRR 122

Query: 121 QKSKD 125
           Q +  
Sbjct: 123 QAAAR 127


>gi|320012489|gb|ADW07339.1| two component transcriptional regulator, winged helix family
           [Streptomyces flavogriseus ATCC 33331]
          Length = 275

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 49/124 (39%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-VLE 61
            +L+VD    V +V        G+ V  A     A E     L P+ +V+D  + G +  
Sbjct: 44  RVLVVDDDPTVAEVAAGYLGRAGYDVGRADDGPAALESVAA-LRPDLVVLDLMLPGGMDG 102

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F    R    G  V V  L    D +  I G   GA+ ++ KPF+   L   +  + +  
Sbjct: 103 FEVCRRIRARGP-VPVIMLTARGDEDDRILGLETGADDYVTKPFSPRELVLRVEAVLRRW 161

Query: 122 KSKD 125
           +  +
Sbjct: 162 RRTE 165


>gi|291287962|ref|YP_003504778.1| multi-sensor signal transduction histidine kinase [Denitrovibrio
           acetiphilus DSM 12809]
 gi|290885122|gb|ADD68822.1| multi-sensor signal transduction histidine kinase [Denitrovibrio
           acetiphilus DSM 12809]
          Length = 537

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 25/130 (19%), Positives = 55/130 (42%), Gaps = 3/130 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           S+L+VD S    +V   L     F +  A     A +       P+ +++D  M G+   
Sbjct: 8   SILIVDDSPENIRVLADLLGS-DFDIKIAKDGATALKILASPPYPDLILLDIMMPGMDGY 66

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++     ++ V ++  +   E ++ G   G   ++ KPFN + L   ++   ++
Sbjct: 67  EVCREIKKSFNTRNIPVIFITAKSLTEDIVLGFELGGVDYITKPFNEKELMARIQTHLEL 126

Query: 121 QKSKDENQFL 130
           +   +E + L
Sbjct: 127 KSINEELETL 136


>gi|320160915|ref|YP_004174139.1| putative OmpR family two-component system response regulator
           [Anaerolinea thermophila UNI-1]
 gi|319994768|dbj|BAJ63539.1| putative OmpR family two-component system response regulator
           [Anaerolinea thermophila UNI-1]
          Length = 244

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 55/122 (45%), Gaps = 2/122 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            S+L+VD    + +  R      GF V  A    EA E    E +P+ +++D  +  +  
Sbjct: 8   RSILVVDDEERMVRFIRLNLEHDGFQVISAYRGYEALEKVRTE-MPDLVLLDVMLPDLDG 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F   ++ +   ++  V  L  + + +  + G   GA+ ++ KPF+   L   ++ + +  
Sbjct: 67  F-EVLKLIRESSNTPVIMLTAKGEEDDRVRGLELGADDYITKPFSPRELVSRVKAVLRRV 125

Query: 122 KS 123
           ++
Sbjct: 126 EA 127


>gi|307718247|ref|YP_003873779.1| transcriptional regulatory protein [Spirochaeta thermophila DSM
           6192]
 gi|306531972|gb|ADN01506.1| transcriptional regulatory protein [Spirochaeta thermophila DSM
           6192]
          Length = 226

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 57/122 (46%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+VD    + ++ R      G+ V       +A E   + LLP+ +++D  + G+  L
Sbjct: 2   TILVVDDEPDIVELVRFHLEREGYDVVSTGEGRDALEKA-RNLLPDAIILDLMLPGMSGL 60

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +RQ    + + +  L  + +   ++ G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 61  EVCRLLRQQDRTSHIPILMLTAKSEETDVVVGLELGADDYITKPFSPRILLARLKAVLKR 120

Query: 121 QK 122
            +
Sbjct: 121 TR 122


>gi|229163581|ref|ZP_04291530.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus R309803]
 gi|228619831|gb|EEK76708.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus R309803]
          Length = 239

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRIM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLDA 132
             K + E Q  +A
Sbjct: 120 RTKLQQEEQVAEA 132


>gi|187479560|ref|YP_787585.1| phosphate regulon two-component response regulator [Bordetella
           avium 197N]
 gi|115424147|emb|CAJ50700.1| phosphate regulon two-component response regulator [Bordetella
           avium 197N]
          Length = 232

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 59/131 (45%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+    ++++     +  G  V  A    +A+     E LP+ +++D  + G+   
Sbjct: 4   TILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAQTLIRAE-LPDLILLDWMLPGMSGL 62

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R      +V V  L  +   +  + G  AGA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  SLARKLRDDERTRNVPVIMLTAKGAEQDKVDGLEAGADDYITKPFSPKELMARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
           +  +  +  +D
Sbjct: 123 RAPQLTDDIID 133


>gi|224823455|ref|ZP_03696564.1| two component transcriptional regulator PhoB, winged helix family
           [Lutiella nitroferrum 2002]
 gi|224603910|gb|EEG10084.1| two component transcriptional regulator PhoB, winged helix family
           [Lutiella nitroferrum 2002]
          Length = 229

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++LLV+    ++++        G  V  A++   A     K  LP+ +++D  + G   +
Sbjct: 4   NILLVEDEPAIQELIAFNLTQAGHHVLRASTAEAAL-MLVKNALPDLVLLDWMLPGGSGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           +    +R       V +  L    D +  I G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DIAKRLRADERTRQVPIIMLTARSDEQDKIVGLETGADDYITKPFSPRELLARIKAVLRR 122

Query: 121 QKSK 124
           +  +
Sbjct: 123 RAPQ 126


>gi|229076091|ref|ZP_04209059.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock4-18]
 gi|229099049|ref|ZP_04229983.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-29]
 gi|229105217|ref|ZP_04235866.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-28]
 gi|229118080|ref|ZP_04247439.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-3]
 gi|228665303|gb|EEL20786.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-3]
 gi|228678143|gb|EEL32371.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-28]
 gi|228684277|gb|EEL38221.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-29]
 gi|228706954|gb|EEL59159.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock4-18]
          Length = 239

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/133 (18%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLDA 132
             K + E Q  +A
Sbjct: 120 RTKLQQEEQVAEA 132


>gi|159896979|ref|YP_001543226.1| two component transcriptional regulator [Herpetosiphon aurantiacus
           ATCC 23779]
 gi|159890018|gb|ABX03098.1| two component transcriptional regulator, winged helix family
           [Herpetosiphon aurantiacus ATCC 23779]
          Length = 229

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 55/128 (42%), Gaps = 4/128 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +      L    G+ + +A S+ +AR   +    P+ +++D  +    
Sbjct: 1   MSRILIVDDDPAILSGVSTLLEQAGYEIAQAASLAQARSHLQAFNPPSLVILDLMLPDGD 60

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +RQ   G  + +  L    + +  + G   GA+ +L KPF    L   +R + 
Sbjct: 61  GFELCRQIRQ--GGQYLPILMLSARDELQDRVEGLTVGADDYLTKPFAPAELVARVRAIL 118

Query: 119 QMQKSKDE 126
           ++ + + E
Sbjct: 119 RLAQHQRE 126


>gi|310825369|ref|YP_003957727.1| sensor protein [Stigmatella aurantiaca DW4/3-1]
 gi|309398441|gb|ADO75900.1| Sensor protein [Stigmatella aurantiaca DW4/3-1]
          Length = 1002

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 4/130 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +LL D +  +R   R L     F V       EA    E   LP+ ++ D  M G+  F 
Sbjct: 634 ILLADDNADMRDYVRRLLESR-FTVETVADGTEALRAAEA-RLPDLVLSDVMMPGMDGFA 691

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +   R  P    V    L      E  + G +AGA+ +L+KPF+   L   +  + ++ 
Sbjct: 692 LLREFRAKPRTAAVPFILLSARAGEEATVGGLQAGADDYLVKPFSARELLARVEGVLRLA 751

Query: 122 KSKDENQFLD 131
           + + + + L 
Sbjct: 752 RERAKRERLA 761


>gi|46810476|gb|AAT01619.1| PhoB [Pseudomonas stutzeri]
          Length = 229

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   KSILIVDDEAPIREMIVVALEMAGYDCLEAENTQQAHALII-DRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D  +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTADTPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|317122420|ref|YP_004102423.1| transcriptional regulator [Thermaerobacter marianensis DSM 12885]
 gi|315592400|gb|ADU51696.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter marianensis DSM 12885]
          Length = 235

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 34/120 (28%), Positives = 55/120 (45%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    +R + R      GF V EA    EA E    E  P+ +++D  + G+   
Sbjct: 2   RILVVDDEAPMRALLRLFLEQHGFAVSEAEDGYEALERVRTE-RPDLVLLDIMLPGIDGW 60

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV V  L    D    ++G  AGA+ +L+KPF  E L   +R + + 
Sbjct: 61  AVCRILRRE---SDVPVIMLTARDDVRDRVSGLEAGADDYLVKPFAEEELLARIRAVLRR 117


>gi|228989676|ref|ZP_04149658.1| Two component transcriptional regulator, winged helix [Bacillus
           pseudomycoides DSM 12442]
 gi|228770010|gb|EEM18592.1| Two component transcriptional regulator, winged helix [Bacillus
           pseudomycoides DSM 12442]
          Length = 237

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 52/121 (42%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +++++    +R++ +      G+ V+ A +  E      ++  P+ +++D  M     
Sbjct: 3   KRIVIIEDEDNIREICKRYLEREGYEVYTAVNGTEGWNVF-QQYQPDLIILDLMMPKKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +RQ    ++V +  L    +    I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 62  WELCEEIRQ---YSNVPIIMLTARGEERDRILGLTMGADDYVTKPFSPRELVLRVQIILR 118

Query: 120 M 120
            
Sbjct: 119 R 119


>gi|192361393|ref|YP_001980674.1| phosphate regulon transcriptional regulatory protein PhoB
           [Cellvibrio japonicus Ueda107]
 gi|190687558|gb|ACE85236.1| phosphate regulon transcriptional regulatory protein PhoB
           [Cellvibrio japonicus Ueda107]
          Length = 232

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R + R       +   EA +  +A      E  P+ +++D  M G   
Sbjct: 4   RKILIVDDESAIRDMLRVALEMADYQCIEAGNAQDAHSLIIDEK-PDLILLDWMMPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  +  ++ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDEVTANLPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|148241349|ref|YP_001226506.1| two-component system response regulator [Synechococcus sp. RCC307]
 gi|147849659|emb|CAK27153.1| Two-component system response regulator [Synechococcus sp. RCC307]
          Length = 252

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 28/124 (22%), Positives = 55/124 (44%), Gaps = 6/124 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++     +  G+ V  A    EA E   +E   + +V+D  M      
Sbjct: 13  TILVVDDEASIRRILETRLSMIGYNVVTAADGEEALEAFHREPT-DLVVLDVMMPKLDGY 71

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 72  GVCQELRKE---SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 128

Query: 121 QKSK 124
            + +
Sbjct: 129 VEKE 132


>gi|332709747|ref|ZP_08429706.1| signal transduction histidine kinase [Lyngbya majuscula 3L]
 gi|332351574|gb|EGJ31155.1| signal transduction histidine kinase [Lyngbya majuscula 3L]
          Length = 1135

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 28/126 (22%), Positives = 57/126 (45%), Gaps = 4/126 (3%)

Query: 1   MD--SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG 58
           M    +L+VD   +  +V  +  +   + + +A +  +A     +   P+ +++D  M  
Sbjct: 726 MKAFKILIVDDEPVNLQVLVNHLSLHNYKITQAVNGLDAFTKIRQGYRPDLILLDIMMPK 785

Query: 59  V--LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +   EF   +R   L  ++ V  L  +     ++AG  AGAN +L KP ++  L   ++ 
Sbjct: 786 MTGYEFCKKIRNKYLPNELPVVLLTAKNQISDLVAGFAAGANDYLTKPISKNELLARIKT 845

Query: 117 LPQMQK 122
             Q+ K
Sbjct: 846 HLQLAK 851


>gi|302871747|ref|YP_003840383.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor obsidiansis OB47]
 gi|302574606|gb|ADL42397.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor obsidiansis OB47]
          Length = 223

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 56/126 (44%), Gaps = 7/126 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D    + +V +      GF V    +  +      K  +P+ +++D  +    
Sbjct: 1   MK-ILVIDDDIKICEVIKLYLEKEGFEVVVTHNGMDGISVF-KNEMPDLVILDIMLPKKD 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R++   +++ +  L  + +    + G   GA+ +++KPF+ + L   ++ + 
Sbjct: 59  GYEVCRELRKI---SNIPIIMLTAKGETFDKVLGLELGADDYIVKPFDPKELIARIKAVL 115

Query: 119 QMQKSK 124
           +  + +
Sbjct: 116 RRTQGE 121


>gi|298246255|ref|ZP_06970061.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
 gi|297553736|gb|EFH87601.1| two component transcriptional regulator, winged helix family
           [Ktedonobacter racemifer DSM 44963]
          Length = 247

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/125 (18%), Positives = 51/125 (40%), Gaps = 6/125 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+++    + ++ R      G+ V  A       E   +E  P+ +++D  +    
Sbjct: 1   MMKILVIEDEANIAQLLRLYLEQAGYAVVTANDGIAGIELHAREK-PDLVILDLMLPMLD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E    +R      +  +  L      E  IAG  +GA+ +L+KPF+   +   ++ + 
Sbjct: 60  GMEVCRRIR---TWANTPILMLTARQGEEDRIAGLDSGADDYLVKPFSPREVISRVKAIL 116

Query: 119 QMQKS 123
           +    
Sbjct: 117 RRAGL 121


>gi|294635418|ref|ZP_06713908.1| phosphate regulon transcriptional regulatory protein PhoB
           [Edwardsiella tarda ATCC 23685]
 gi|291091207|gb|EFE23768.1| phosphate regulon transcriptional regulatory protein PhoB
           [Edwardsiella tarda ATCC 23685]
          Length = 237

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA S   A      E  P+ +++D  + G   
Sbjct: 11  RRILVVEDETPIREMVSFVLEQNGYQPLEAESYDGALSRLC-EPYPDLILLDWMLPGGSG 69

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I H+++ P   D+ V  L    + E  + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 70  IQLIKHLKREPATRDIPVMMLTARGEEEDRVRGLEVGADDYIIKPFSPKELVARIKAVMR 129

Query: 120 M 120
            
Sbjct: 130 R 130


>gi|148270266|ref|YP_001244726.1| two component transcriptional regulator [Thermotoga petrophila
           RKU-1]
 gi|170288963|ref|YP_001739201.1| two component transcriptional regulator [Thermotoga sp. RQ2]
 gi|147735810|gb|ABQ47150.1| two component transcriptional regulator, winged helix family
           [Thermotoga petrophila RKU-1]
 gi|170176466|gb|ACB09518.1| two component transcriptional regulator, winged helix family
           [Thermotoga sp. RQ2]
          Length = 239

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + ++  +  +  G+ V +A    EA +    E + +  ++D  + G+  
Sbjct: 4   KKILVVDDDPAILELVGYNLSKEGYEVLKAYDGEEALKIANDEDV-DMFIVDIMLPGIDG 62

Query: 62  FI--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R +    +  V +L  + +    + G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  FELVRKIRAIEKYKNTPVIFLSAKGEEFDKVLGLELGADDYITKPFSVRELLARVKAIFR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|119468896|ref|ZP_01611921.1| phosphate regulon transcriptional regulatory protein phoB
           [Alteromonadales bacterium TW-7]
 gi|119447548|gb|EAW28815.1| phosphate regulon transcriptional regulatory protein phoB
           [Alteromonadales bacterium TW-7]
          Length = 229

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 51/132 (38%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RKVLVVDDEAPIREMLVFVLEQNGFQAIEAEDYDSAIAAMV-EPYPDMVLLDWMLPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                  +Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQIAKKFKQNEHTRQIPIIMLTARGEEEDKVRGLEVGADDYVTKPFSPKELMARIKAVIR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RVSPTSLEEAIE 133


>gi|148654922|ref|YP_001275127.1| two component transcriptional regulator [Roseiflexus sp. RS-1]
 gi|148567032|gb|ABQ89177.1| two component transcriptional regulator, winged helix family
           [Roseiflexus sp. RS-1]
          Length = 229

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 54/121 (44%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R + R      GF V EA S  +  +   +E  P+ +++D  M  +  
Sbjct: 7   RRILIVDDEPGLRDLVRINLEHEGFSVLEAESGAQGLQMV-REQHPDLMILDVMMPEMDG 65

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+    + + V  L      + ++ G  +GA+ +L KPFN + L   +R L +
Sbjct: 66  WEVCRRLRE---FSQIPVLMLTARTQSKDIVTGLESGADDYLTKPFNMDELTARIRALLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|167769697|ref|ZP_02441750.1| hypothetical protein ANACOL_01031 [Anaerotruncus colihominis DSM
           17241]
 gi|167668058|gb|EDS12188.1| hypothetical protein ANACOL_01031 [Anaerotruncus colihominis DSM
           17241]
          Length = 234

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 49/127 (38%), Gaps = 1/127 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKEL-LPNYLVIDESMEGV 59
           M  +L+V+   ++R          G+ V +  +  EA +  E+     +  V+D  M G+
Sbjct: 1   MKRILVVEDEDVIRDFEVINLKRAGYEVVDVPTGEEAIQVFERNPTHFDVAVLDVMMPGM 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             F    R     + + +  L  +      + G   GA+ ++ KPF+   L   +  L +
Sbjct: 61  DGFEVCRRIREKNSSIGIIMLTAKSQEMDKVNGLMIGADDYVTKPFSPSELVARVDALHR 120

Query: 120 MQKSKDE 126
                 E
Sbjct: 121 RVTVAAE 127


>gi|144900225|emb|CAM77089.1| phosphate regulon transcriptional regulatory protein phoB
           [Magnetospirillum gryphiswaldense MSR-1]
          Length = 233

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 27/130 (20%), Positives = 55/130 (42%), Gaps = 3/130 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+V+    +  + R+     G+ V EA    EA      E  P+ +V+D  +     +E
Sbjct: 7   ILIVEDEAALATMLRYNLEKEGYRVCEAGDGEEALTLV-SERKPDLMVLDWMLPSLSGIE 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+ P   ++ +  L    +    I G   GA+ ++ KPF+   L   +R + +  
Sbjct: 66  VCRQLRRKPATRELPIIMLTARGEEGDKIRGLNTGADDYMTKPFSLPELMARIRAMLRRV 125

Query: 122 KSKDENQFLD 131
           +   +   L+
Sbjct: 126 QPVPQKGMLE 135


>gi|323340909|ref|ZP_08081158.1| DNA-binding response regulator [Lactobacillus ruminis ATCC 25644]
 gi|323091571|gb|EFZ34194.1| DNA-binding response regulator [Lactobacillus ruminis ATCC 25644]
          Length = 235

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 52/123 (42%), Gaps = 2/123 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA +  E E+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIIKFNLTKEGYDVHTAYDGEEALKQVE-EVSPDLIILDLMLPKID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKTHDMPIIMVTAKDAEIDKVLGLEMGADDYVTKPFSNRELVARVKANLRR 118

Query: 121 QKS 123
           Q +
Sbjct: 119 QAA 121


>gi|329936252|ref|ZP_08286045.1| two-component systen response regulator [Streptomyces
           griseoaurantiacus M045]
 gi|329304362|gb|EGG48242.1| two-component systen response regulator [Streptomyces
           griseoaurantiacus M045]
          Length = 244

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A E       P+ LV+D  M  +  
Sbjct: 11  QRILIVDDEPAVREALQRSLAFEGYGTEVAVDGADALEKAAA-YRPDLLVLDIQMPRMDG 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 70  LTAARRIRAAGDTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 128


>gi|304311894|ref|YP_003811492.1| Phosphatase regulon transcriptional regulatory protein [gamma
           proteobacterium HdN1]
 gi|301797627|emb|CBL45848.1| Phosphatase regulon transcriptional regulatory protein [gamma
           proteobacterium HdN1]
          Length = 228

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 55/133 (41%), Gaps = 4/133 (3%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG- 58
           M  ++L+VD    + ++        GF V  A    EA      E  P+ L++D  + G 
Sbjct: 1   MKANILIVDDEIAICELLTLALEQAGFTVQAAYDGKEAWIKL-AEQAPDLLLLDWMLPGT 59

Query: 59  -VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
             +E    +RQ      + +  L  + + +  I G   GA+ ++ KPF+   L   ++ L
Sbjct: 60  SGIELARRIRQTDNLRTLPIIMLSAKSEEDNKITGLEIGADDYITKPFSTRELISRIKAL 119

Query: 118 PQMQKSKDENQFL 130
            + +      Q L
Sbjct: 120 LRRRAPDRLEQQL 132


>gi|17229772|ref|NP_486320.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17131371|dbj|BAB73979.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 421

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 55/129 (42%), Gaps = 3/129 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L++D   I++ + +    + G+ V  AT+  +  E  +K   P  ++ D  M+ +   
Sbjct: 37  KILVIDDDRIIQLILKQALQEQGYEVILATNGLQGIEQADKHH-PALIICDWQMDEMDGL 95

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++  P  +  F   L      E  + G   GA+ FL KP +   L+  +R   ++
Sbjct: 96  EVCRKIKSEPTLSTTFFILLTSRRAVEDRVEGLDTGADDFLSKPIDVNELKARVRSGLRL 155

Query: 121 QKSKDENQF 129
            ++  E Q 
Sbjct: 156 YQTNQELQR 164


>gi|260427208|ref|ZP_05781187.1| phosphate regulon transcriptional regulatory protein PhoB
           [Citreicella sp. SE45]
 gi|260421700|gb|EEX14951.1| phosphate regulon transcriptional regulatory protein PhoB
           [Citreicella sp. SE45]
          Length = 229

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++L+V+     R+V R+     GF V  A +  EA      E  P+ +V+D  +     +
Sbjct: 7   TVLVVEDEAAQREVLRYNLEAEGFRVAAAGNGEEAL-MMMDEESPDVIVLDWMLPNLSGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++  P    V V  L    +    I G   GA+ +++KP++   L   +R   + 
Sbjct: 66  EVCRQIKTRPETRGVPVIMLSARSEEVDRIRGLETGADDYVVKPYSLRELMARVRAQLRR 125

Query: 121 QKSKDENQFLD 131
            +       L+
Sbjct: 126 ARPAAAGLRLE 136


>gi|186686849|ref|YP_001870042.1| response regulator receiver sensor signal transduction histidine
           kinase [Nostoc punctiforme PCC 73102]
 gi|186469201|gb|ACC85001.1| response regulator receiver sensor signal transduction histidine
           kinase [Nostoc punctiforme PCC 73102]
          Length = 448

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 57/129 (44%), Gaps = 3/129 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD +    +V   + ++ G+ V  A S   A +  +    P+ +++D  M G+  F
Sbjct: 11  TILVVDDNPTNIQVLFDVLSEIGYRVAIAKSGEAALQRVQS-YHPDIILLDVMMPGIDGF 69

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++      D+ V ++    D    + G   GA  ++ KP   E     +R   Q+
Sbjct: 70  ETCQRLKADCATCDIPVIFMTALSDTVDKVKGLSLGAVDYITKPIQHEEALARIRVHLQL 129

Query: 121 QKSKDENQF 129
           ++S+  +Q 
Sbjct: 130 RESQKSSQQ 138


>gi|209695992|ref|YP_002263922.1| chitin degradation sensor protein [Aliivibrio salmonicida LFI1238]
 gi|208009945|emb|CAQ80259.1| chitin degradation sensor protein [Aliivibrio salmonicida LFI1238]
          Length = 1127

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 57/133 (42%), Gaps = 6/133 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+ D   +  +V        G+ V  A    E  +  E+E  P  +++D  M G+   E
Sbjct: 722 LLVADDEPVNLQVLSSFLKLEGYRVKTANDGPETLKQLEEET-PELVLLDVMMPGMSGYE 780

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               VR+    + + +  L      +  + G  +GAN +L KPFN++ L   ++   Q  
Sbjct: 781 VCQEVRKQYSHSQLPIIMLTALNQTQDRVRGFESGANDYLSKPFNKQELAARIKAHLQAS 840

Query: 122 KSK---DENQFLD 131
           +++    EN  L 
Sbjct: 841 QAEIRLTENDRLQ 853


>gi|253752080|ref|YP_003025221.1| response regulator protein [Streptococcus suis SC84]
 gi|251816369|emb|CAZ52000.1| response regulator protein [Streptococcus suis SC84]
          Length = 234

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 56/132 (42%), Gaps = 2/132 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTREGYEVVTAFDGREALEVFEAE-FPDIVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R +   ++V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-RTIRKTSNVPILMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QKSKDENQFLDA 132
            +  +    +++
Sbjct: 119 SELPETQTNIES 130


>gi|315646392|ref|ZP_07899510.1| two component transcriptional regulator, winged helix family
           protein [Paenibacillus vortex V453]
 gi|315278035|gb|EFU41355.1| two component transcriptional regulator, winged helix family
           protein [Paenibacillus vortex V453]
          Length = 238

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 52/126 (41%), Gaps = 6/126 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +R++ +      G+ + EA     A      E     +++D  + G+  
Sbjct: 6   NRILVVDDEERIRRLLKMYLEKEGYEIEEAEDGETALRKASSEDY-GLVILDVMLPGMDG 64

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +RQ+       +  L  + +    + G   GA+ +++KPF+   + + ++ + +
Sbjct: 65  VEVCTRLRQV---KSTPILMLTAKGEEINRVQGFEVGADDYVVKPFSPREVIYRVKAILR 121

Query: 120 MQKSKD 125
              +  
Sbjct: 122 RSSATA 127


>gi|307592311|ref|YP_003899902.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
 gi|306985956|gb|ADN17836.1| multi-sensor hybrid histidine kinase [Cyanothece sp. PCC 7822]
          Length = 1403

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 49/131 (37%), Gaps = 4/131 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+ D +  +R   + L +   + V        A         P+ ++ D  M G+  F
Sbjct: 629 RILIADDNADMRDYLKRLLSQQ-YEVEAVVDGLTAL-KAIHSCHPDLVLTDVMMPGLDGF 686

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R       + +  L      E  + G  AGA+ +L+KPF+   L   +    ++
Sbjct: 687 ELLKSLRADLSTQHIPIILLSARAGEESRVEGLEAGADDYLIKPFSARELLARVEATLKL 746

Query: 121 QKSKDENQFLD 131
              + E    +
Sbjct: 747 SYLRQEATRRE 757



 Score =  106 bits (265), Expect = 1e-21,   Method: Composition-based stats.
 Identities = 23/116 (19%), Positives = 35/116 (30%), Gaps = 6/116 (5%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
            +L+VD     R          G  V    S  EA +   +   PN +V D  M  +    
Sbjct: 1279 ILVVDDDEDTRYFLAFALQQSGATVTTVGSASEALQVLVRS-APNVIVSDVGMPDMDGYM 1337

Query: 62   FIAHVRQMPLGT---DVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
             I  +R +        +    L             R G    ++KP N   L   +
Sbjct: 1338 LIQQIRMLEAQQGREKIKAIALTAYAGEIDRQQALREGFQRHIIKPINPSVLIKTI 1393


>gi|190572650|ref|YP_001970495.1| putative two-component response regulator transcriptional regulator
           [Stenotrophomonas maltophilia K279a]
 gi|190010572|emb|CAQ44181.1| putative two-component response regulator transcriptional
           regulatory protein [Stenotrophomonas maltophilia K279a]
          Length = 239

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 30/131 (22%), Positives = 54/131 (41%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +  + R    D G+ V  A S        E+E   + LV+D  + GV  
Sbjct: 4   KRVLIVEDDAHIADLLRMHLGDEGYDVAHAASGDAGLRLLEQEGPWDALVLDVMLPGVDG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R   +   V +  +       + I G   GA+ +L KPF+   L   +R L +  
Sbjct: 64  LQVCQRARAMARYVPIIIISARGSETQRIVGLELGADDYLAKPFSMPELVARVRALLRRA 123

Query: 122 KSKDENQFLDA 132
           ++  ++  +DA
Sbjct: 124 EAMAQSARIDA 134


>gi|330836364|ref|YP_004411005.1| two component transcriptional regulator, winged helix family
           [Spirochaeta coccoides DSM 17374]
 gi|329748267|gb|AEC01623.1| two component transcriptional regulator, winged helix family
           [Spirochaeta coccoides DSM 17374]
          Length = 224

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 33/124 (26%), Positives = 57/124 (45%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+ +L+VD    +R++ R +    GF V+EA    EA    E     +  +ID  M  + 
Sbjct: 1   MNKILVVDDDPHLRELVRIILQKEGFAVYEAADGLEALSKLETSKA-DLAIIDLMMPNMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R      D+ V  L  + +  + I G +AGA+ +L+KPF    L   ++ L 
Sbjct: 60  GFELCQELRAS---YDIPVLMLTAKGETAQKIKGFQAGADDYLVKPFEPLELMARVKALL 116

Query: 119 QMQK 122
           +  +
Sbjct: 117 KRYQ 120


>gi|163847561|ref|YP_001635605.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222525411|ref|YP_002569882.1| winged helix family two component transcriptional regulator
           [Chloroflexus sp. Y-400-fl]
 gi|163668850|gb|ABY35216.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222449290|gb|ACM53556.1| two component transcriptional regulator, winged helix family
           [Chloroflexus sp. Y-400-fl]
          Length = 246

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 2/123 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +    R      G  V  AT+  EA E   +E +P+ +++D  M  +  
Sbjct: 7   KLVLVVDDEPRMITFMRMNLELEGMRVTTATNGREAVEKV-REEMPDIVLLDIMMPVMDG 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F   +R++   + V V  L  + + E  + G   GA+ ++ KPF++  L   +R + +  
Sbjct: 66  F-EALRRIRSFSQVPVIILTAKDEEEDRVRGLELGADDYVGKPFSQRELVSRIRAVLRRH 124

Query: 122 KSK 124
            ++
Sbjct: 125 YTQ 127


>gi|220906227|ref|YP_002481538.1| multi-sensor signal transduction histidine kinase [Cyanothece sp.
           PCC 7425]
 gi|219862838|gb|ACL43177.1| multi-sensor signal transduction histidine kinase [Cyanothece sp.
           PCC 7425]
          Length = 566

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 58/135 (42%), Gaps = 7/135 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD +    +V     ++ GF V  A     A +     + P+ +++D  M G+  F
Sbjct: 10  TILVVDDTPTNLEVLFDFLSNAGFKVLFAEDGESALQKANY-ITPDLILLDILMPGMDGF 68

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + V +L    D    + G   GA  F+ KP   E +   +    ++
Sbjct: 69  ETCQRLKQNGSTRSIPVIFLTALTDTVDKVKGFALGAVDFITKPLQYEEVLARVETHLRL 128

Query: 121 Q----KSKDENQFLD 131
           Q    K +++NQ L+
Sbjct: 129 QTLTRKLQEQNQRLE 143


>gi|255525674|ref|ZP_05392607.1| two component transcriptional regulator, winged helix family
           [Clostridium carboxidivorans P7]
 gi|296185432|ref|ZP_06853842.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
 gi|255510660|gb|EET86967.1| two component transcriptional regulator, winged helix family
           [Clostridium carboxidivorans P7]
 gi|296050266|gb|EFG89690.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
          Length = 231

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 19/125 (15%), Positives = 55/125 (44%), Gaps = 3/125 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + ++ +    + G+    A +  +A +  +++  PN +++D  + G+   
Sbjct: 5   KILIVDDEEHITELIKFNLENSGYKTICADNGLDAIKKAKRDT-PNLILLDIMLPGMDGY 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +   +  +  + +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 64  DVCKEIRKDNSISSTPIIMITAKGEEFDKVLGLELGADDYITKPFSIRELLARVKAILRR 123

Query: 121 QKSKD 125
             +K 
Sbjct: 124 TTAKS 128


>gi|308071608|ref|YP_003873213.1| transcriptional regulatory protein yycF [Paenibacillus polymyxa
           E681]
 gi|305860887|gb|ADM72675.1| Transcriptional regulatory protein yycF [Paenibacillus polymyxa
           E681]
          Length = 243

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 50/125 (40%), Gaps = 6/125 (4%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M  ++L+VD    +  + +      G+ V  A     A +   K+  P+ +++D  + G+
Sbjct: 1   MQGTILVVDDEQPIADILKFNLEKEGYQVICAFDGITAVDIAVKQ-QPDLILLDLMLPGM 59

Query: 60  LE--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                   VR   L     +  L  +      + G   GA+ ++ KPF+   L   ++  
Sbjct: 60  DGMDVCREVRGHQL--QTPIIMLTAKDGEIDKVLGLELGADDYVTKPFSTRELLARVKAQ 117

Query: 118 PQMQK 122
            + Q+
Sbjct: 118 MRRQQ 122


>gi|257880368|ref|ZP_05660021.1| transcriptional regulator [Enterococcus faecium 1,230,933]
 gi|257882229|ref|ZP_05661882.1| transcriptional regulator [Enterococcus faecium 1,231,502]
 gi|257885424|ref|ZP_05665077.1| transcriptional regulator [Enterococcus faecium 1,231,501]
 gi|257888221|ref|ZP_05667874.1| transcriptional regulator [Enterococcus faecium 1,141,733]
 gi|257891026|ref|ZP_05670679.1| transcriptional regulator [Enterococcus faecium 1,231,410]
 gi|257894279|ref|ZP_05673932.1| transcriptional regulator [Enterococcus faecium 1,231,408]
 gi|257896891|ref|ZP_05676544.1| transcriptional regulator [Enterococcus faecium Com12]
 gi|260562331|ref|ZP_05832845.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium C68]
 gi|261208378|ref|ZP_05923028.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium TC 6]
 gi|289566829|ref|ZP_06447239.1| transcriptional regulatory protein yycF [Enterococcus faecium
           D344SRF]
 gi|314939997|ref|ZP_07847192.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|314943532|ref|ZP_07850297.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|314948950|ref|ZP_07852317.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
 gi|314950769|ref|ZP_07853845.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|314994105|ref|ZP_07859422.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|314998036|ref|ZP_07862928.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|257814596|gb|EEV43354.1| transcriptional regulator [Enterococcus faecium 1,230,933]
 gi|257817887|gb|EEV45215.1| transcriptional regulator [Enterococcus faecium 1,231,502]
 gi|257821280|gb|EEV48410.1| transcriptional regulator [Enterococcus faecium 1,231,501]
 gi|257824275|gb|EEV51207.1| transcriptional regulator [Enterococcus faecium 1,141,733]
 gi|257827386|gb|EEV54012.1| transcriptional regulator [Enterococcus faecium 1,231,410]
 gi|257830658|gb|EEV57265.1| transcriptional regulator [Enterococcus faecium 1,231,408]
 gi|257833456|gb|EEV59877.1| transcriptional regulator [Enterococcus faecium Com12]
 gi|260073255|gb|EEW61596.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium C68]
 gi|260077439|gb|EEW65158.1| response regulator receiver:Transcriptional regulatory protein
           [Enterococcus faecium TC 6]
 gi|289161360|gb|EFD09250.1| transcriptional regulatory protein yycF [Enterococcus faecium
           D344SRF]
 gi|313587966|gb|EFR66811.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a01]
 gi|313591472|gb|EFR70317.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133B]
 gi|313597049|gb|EFR75894.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133A]
 gi|313597770|gb|EFR76615.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133C]
 gi|313640767|gb|EFS05347.1| response regulator receiver domain protein [Enterococcus faecium
           TX0133a04]
 gi|313644649|gb|EFS09229.1| response regulator receiver domain protein [Enterococcus faecium
           TX0082]
          Length = 244

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V+ A    EA E    E+ P+ +++D  +  + 
Sbjct: 11  MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKV-AEVEPDLILLDLMLPKMD 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 70  GLEVA-REVRKTYDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 128


>gi|16329558|ref|NP_440286.1| OmpR subfamily [Synechocystis sp. PCC 6803]
 gi|1652041|dbj|BAA16966.1| OmpR subfamily [Synechocystis sp. PCC 6803]
          Length = 245

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 54/128 (42%), Gaps = 3/128 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M ++L+V+    + ++ R       F                +E +P+ +V+D  +    
Sbjct: 11  MPNILIVEDDQEIAQLIRETLEREQFTCIVTNDGETGLRIF-QEQVPDLIVLDLMLPKLD 69

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    +RQ P   D ++  L  + +    I G   GA+ +L+KPF+   L   +R L 
Sbjct: 70  GLEVCTRIRQQPGSKDPYILMLTAKGEEIDRIIGLSTGADDYLVKPFSPRELVARVRALL 129

Query: 119 QMQKSKDE 126
           + Q  + +
Sbjct: 130 RRQLRQGQ 137


>gi|256827579|ref|YP_003151538.1| response regulator with CheY-like receiver domain protein and
           winged-helix DNA-binding domain protein [Cryptobacterium
           curtum DSM 15641]
 gi|256583722|gb|ACU94856.1| response regulator with CheY-like receiver domain protein and
           winged-helix DNA-binding domain protein [Cryptobacterium
           curtum DSM 15641]
          Length = 236

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 50/130 (38%), Gaps = 6/130 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +LLV+    +R           + V       EA E   K    + +++D  +  V  
Sbjct: 6   RRILLVEDEKAIRDAVAAYLERENYWVTAVGDGQEALEEFSKHH-FDLVILDLMLPRVPG 64

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R     +DV +  L  + + E  I G   GA+ +L+KPF+   L   +R L +
Sbjct: 65  ERVCRAIR---DNSDVPIIMLTAKGEVEDRIIGLELGADDYLVKPFSPRELVARVRALLR 121

Query: 120 MQKSKDENQF 129
              S  E Q 
Sbjct: 122 RVHSDVEPQR 131


>gi|254411201|ref|ZP_05024978.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196181702|gb|EDX76689.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 249

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +LL+D    + ++        G+ V +A    +  +    +L P+ +++D  +  V 
Sbjct: 1   MHRILLIDDDPAISELVSINLEMAGYEVHQAPDGIKG-QALALQLQPDLIMLDLMLPRVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+    TD+ V  L      +  + G  AGA+ +L KPF  E +   +R L 
Sbjct: 60  GFTVCQRLRRDERTTDIPVLMLTALGQTQDKVEGFNAGADDYLTKPFELEEMLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|163942322|ref|YP_001647206.1| two component transcriptional regulator [Bacillus
           weihenstephanensis KBAB4]
 gi|229062273|ref|ZP_04199594.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH603]
 gi|229135424|ref|ZP_04264211.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST196]
 gi|229169315|ref|ZP_04297025.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH621]
 gi|163864519|gb|ABY45578.1| two component transcriptional regulator, winged helix family
           [Bacillus weihenstephanensis KBAB4]
 gi|228614078|gb|EEK71193.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH621]
 gi|228647985|gb|EEL04033.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST196]
 gi|228717001|gb|EEL68682.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH603]
          Length = 239

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 52/133 (39%), Gaps = 5/133 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRIM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLDA 132
             K + E Q  ++
Sbjct: 120 RTKLQQEEQVSES 132


>gi|322834089|ref|YP_004214116.1| two component transcriptional regulator PhoB, winged helix family
           [Rahnella sp. Y9602]
 gi|321169290|gb|ADW74989.1| two component transcriptional regulator PhoB, winged helix family
           [Rahnella sp. Y9602]
          Length = 229

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    G+   EA     A      E  P  +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGYQAVEAEDFDSAIGQLV-EPYPELILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  L  ++ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKREALTREIPVMMLTARGEEEDRVRGLEVGADDYITKPFSPKELVARIKAVMR 121

Query: 120 MQKSKDENQFLD 131
                   + +D
Sbjct: 122 RISPMAVEEVID 133


>gi|322835012|ref|YP_004215039.1| transcriptional regulator [Rahnella sp. Y9602]
 gi|321170213|gb|ADW75912.1| two component transcriptional regulator, winged helix family
           [Rahnella sp. Y9602]
          Length = 233

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 52/130 (40%), Gaps = 7/130 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M+ +LLVD    +  + + L    GF V  A    +A E    +   + L++D  M    
Sbjct: 1   MNKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALEKI--DNTIDLLLLDVMMPKKN 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E +  +RQ        V  L         + G   GA+ +L KPFN   L   +R + 
Sbjct: 59  GIETLKELRQR---HQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAML 115

Query: 119 QMQKSKDENQ 128
           +     ++ Q
Sbjct: 116 RRSNWSEQQQ 125


>gi|148380484|ref|YP_001255025.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. ATCC 3502]
 gi|153932630|ref|YP_001384708.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. ATCC 19397]
 gi|153937638|ref|YP_001388229.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. Hall]
 gi|148289968|emb|CAL84081.1| two-component response regulator [Clostridium botulinum A str. ATCC
           3502]
 gi|152928674|gb|ABS34174.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. ATCC 19397]
 gi|152933552|gb|ABS39051.1| putative phosphate regulon DNA-binding response regulator
           [Clostridium botulinum A str. Hall]
 gi|322806798|emb|CBZ04367.1| phosphate regulon transcriptional regulatory protein PhoB (SphR)
           [Clostridium botulinum H04402 065]
          Length = 232

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 52/123 (42%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+ +L+VD    + ++ +    +  +    A +  EA     KE  P+ +++D  + G+ 
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNSYNCICALNGIEALNIA-KEEKPDLILLDLMLPGMD 61

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+        +  +  + +    + G   GA+ ++ KPF+   +   ++ + 
Sbjct: 62  GYEVCKEIRKDNNIATTPIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVL 121

Query: 119 QMQ 121
           + +
Sbjct: 122 RRR 124


>gi|269103478|ref|ZP_06156175.1| chitin catabolic cascade sensor histidine kinase ChiS
           [Photobacterium damselae subsp. damselae CIP 102761]
 gi|268163376|gb|EEZ41872.1| chitin catabolic cascade sensor histidine kinase ChiS
           [Photobacterium damselae subsp. damselae CIP 102761]
          Length = 1130

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 32/133 (24%), Positives = 60/133 (45%), Gaps = 6/133 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LL+VD   +  ++  +     G+ V  A S  +A E  +    P  +++D  M  +   E
Sbjct: 723 LLVVDDEPVNLQILNNFLRLEGYRVLTAESGKQALELVQSHK-PALILLDIMMPEMSGYE 781

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
             + +RQ     ++ +  L      +  + G   GAN +L KPFN+E L   ++   Q  
Sbjct: 782 VCSQLRQQYTPLELPIMMLSALGQVKDRVKGFECGANDYLTKPFNKEELTARIKAHLQAG 841

Query: 122 KS---KDENQFLD 131
           K+   +++N+ L 
Sbjct: 842 KTEFEREKNRQLA 854


>gi|257899652|ref|ZP_05679305.1| transcriptional regulator [Enterococcus faecium Com15]
 gi|257837564|gb|EEV62638.1| transcriptional regulator [Enterococcus faecium Com15]
          Length = 244

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V+ A    EA E    E+ P+ +++D  +  + 
Sbjct: 11  MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKV-AEVEPDLILLDLMLPKMD 69

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 70  GLEVA-REVRKTYDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 128


>gi|148653890|ref|YP_001280983.1| two component transcriptional regulator [Psychrobacter sp. PRwf-1]
 gi|148572974|gb|ABQ95033.1| two component transcriptional regulator, winged helix family
           [Psychrobacter sp. PRwf-1]
          Length = 233

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/133 (17%), Positives = 60/133 (45%), Gaps = 4/133 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG---V 59
           ++L+V+    +R++        GF   +A  V EA         P  +++D  + G    
Sbjct: 5   TILVVEDEPAIREMIVTTLEMAGFECLQAEDVSEAHSQVVDH-RPAMILLDWMLPGNQSG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           ++    +++  L +++ +  L    + +  + G  AGA+ ++ KPF+   L   ++ + +
Sbjct: 64  IDLCRRLKKDELLSEIPIIMLTARGEEDNKVQGLDAGADDYITKPFSTRELVSRIKAVLR 123

Query: 120 MQKSKDENQFLDA 132
              +   ++ ++A
Sbjct: 124 RSSALSGDKPIEA 136


>gi|310644837|ref|YP_003949596.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phop [Paenibacillus polymyxa SC2]
 gi|309249788|gb|ADO59355.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Paenibacillus polymyxa SC2]
          Length = 243

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 50/125 (40%), Gaps = 6/125 (4%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M  ++L+VD    +  + +      G+ V  A     A +   K+  P+ +++D  + G+
Sbjct: 1   MQGTILVVDDEQPIADILKFNLEKEGYEVICAFDGISAVDIAVKQ-QPDLILLDLMLPGM 59

Query: 60  LE--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                   VR   L     +  L  +      + G   GA+ ++ KPF+   L   ++  
Sbjct: 60  DGMDVCREVRGHQL--QTPIIMLTAKDGEIDKVLGLELGADDYVTKPFSTRELLARVKAQ 117

Query: 118 PQMQK 122
            + Q+
Sbjct: 118 MRRQQ 122


>gi|49081852|gb|AAT50326.1| PA5360 [synthetic construct]
          Length = 230

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   KTILIVDDEAPIREMIAVALEMAGYECLEAENTQQA-HAVIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTVDIPIIMLTAKGEEDNKIQGLGVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|28872582|ref|NP_795201.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213968546|ref|ZP_03396689.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato T1]
 gi|301383518|ref|ZP_07231936.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato Max13]
 gi|302062568|ref|ZP_07254109.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato K40]
 gi|302130235|ref|ZP_07256225.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato NCPPB 1108]
 gi|28855837|gb|AAO58896.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato str. DC3000]
 gi|213926834|gb|EEB60386.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tomato T1]
 gi|330878107|gb|EGH12256.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. morsprunorum str. M302280PT]
 gi|330967971|gb|EGH68231.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. actinidiae str. M302091]
 gi|331017829|gb|EGH97885.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. lachrymans str. M302278PT]
          Length = 229

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|78101053|pdb|1ZES|A Chain A, Bef3- Activated Phob Receiver Domain
 gi|78101054|pdb|1ZES|B Chain B, Bef3- Activated Phob Receiver Domain
 gi|78101055|pdb|1ZES|C Chain C, Bef3- Activated Phob Receiver Domain
          Length = 125

 Score =  151 bits (383), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|270289944|ref|ZP_06196170.1| two-component system, OmpR family, response regulator VicR
           [Pediococcus acidilactici 7_4]
 gi|304385805|ref|ZP_07368149.1| response regulator [Pediococcus acidilactici DSM 20284]
 gi|270281481|gb|EFA27313.1| two-component system, OmpR family, response regulator VicR
           [Pediococcus acidilactici 7_4]
 gi|304328309|gb|EFL95531.1| response regulator [Pediococcus acidilactici DSM 20284]
          Length = 233

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 52/126 (41%), Gaps = 2/126 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +   +  G+ V  A    EA E  E E  P+ +++D  +  + 
Sbjct: 1   MPKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALEKVESEE-PDLILLDLMLPKID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 RQ+    ++ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-RQVRAKHNIPIIMVTAKDSELDKVVGLELGADDYVTKPFSNRELVARVKANLRR 118

Query: 121 QKSKDE 126
           Q    +
Sbjct: 119 QDQFQQ 124


>gi|300865377|ref|ZP_07110187.1| two-component hybrid sensor and regulator [Oscillatoria sp. PCC
           6506]
 gi|300336628|emb|CBN55337.1| two-component hybrid sensor and regulator [Oscillatoria sp. PCC
           6506]
          Length = 424

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 49/131 (37%), Gaps = 3/131 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L++D    V+ V + L    G  V  A    +          P+ ++ D  M    
Sbjct: 1   MAKILVIDDDVTVQIVLQDLLESEGHEVAIAFDGQDGLSQA-HHRPPDLIICDWMMPYID 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    ++  P    VF   L    + +  + G   GA+ FL KP   E L   +R   
Sbjct: 60  GLEVCRQLKANPELATVFFILLTAREELDDRVKGLDNGADDFLSKPIETEELLARVRAGL 119

Query: 119 QMQKSKDENQF 129
           +++    + + 
Sbjct: 120 RLRGLTQQLER 130


>gi|149190144|ref|ZP_01868420.1| sensory box sensor histidine kinase/response regulator [Vibrio
           shilonii AK1]
 gi|148836033|gb|EDL52994.1| sensory box sensor histidine kinase/response regulator [Vibrio
           shilonii AK1]
          Length = 1128

 Score =  151 bits (382), Expect = 3e-35,   Method: Composition-based stats.
 Identities = 33/133 (24%), Positives = 55/133 (41%), Gaps = 6/133 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           LL+ D   +  ++        G+ V  A    E  +  E E  P+ L++D  M G+  F 
Sbjct: 724 LLVADDEPVNLRILESFLRLEGYQVKLAKDGLETLDIIEHEK-PDLLLLDIMMPGMSGFE 782

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+      + +  L      E  + G   GAN +L KPF++  L   +    Q  
Sbjct: 783 VCETIREQYDHAALPIIMLTALNQSEDRVRGFELGANDYLAKPFSKPELAARIAAHLQAS 842

Query: 122 KSKD---ENQFLD 131
           K+++   ENQ L 
Sbjct: 843 KAEERRAENQLLK 855


>gi|23464917|ref|NP_695520.1| response regulator of two-component system [Bifidobacterium longum
           NCC2705]
 gi|23325510|gb|AAN24156.1| response regulator of two-component system [Bifidobacterium longum
           NCC2705]
          Length = 256

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 23  MTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGID 81

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 82  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVM 138

Query: 119 QMQKSKDE 126
           +  ++  +
Sbjct: 139 RRNQATAQ 146


>gi|115376893|ref|ZP_01464114.1| multi-sensor Hybrid Histidine Kinase [Stigmatella aurantiaca
           DW4/3-1]
 gi|115366072|gb|EAU65086.1| multi-sensor Hybrid Histidine Kinase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 986

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 4/130 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +LL D +  +R   R L     F V       EA    E   LP+ ++ D  M G+  F 
Sbjct: 618 ILLADDNADMRDYVRRLLESR-FTVETVADGTEALRAAEA-RLPDLVLSDVMMPGMDGFA 675

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
            +   R  P    V    L      E  + G +AGA+ +L+KPF+   L   +  + ++ 
Sbjct: 676 LLREFRAKPRTAAVPFILLSARAGEEATVGGLQAGADDYLVKPFSARELLARVEGVLRLA 735

Query: 122 KSKDENQFLD 131
           + + + + L 
Sbjct: 736 RERAKRERLA 745


>gi|295402148|ref|ZP_06812107.1| two component transcriptional regulator, winged helix family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|312112732|ref|YP_003991048.1| transcriptional regulator [Geobacillus sp. Y4.1MC1]
 gi|294975831|gb|EFG51450.1| two component transcriptional regulator, winged helix family
           [Geobacillus thermoglucosidasius C56-YS93]
 gi|311217833|gb|ADP76437.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. Y4.1MC1]
          Length = 235

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 51/122 (41%), Gaps = 6/122 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V  A    EA +  E E++P+ +++D  +     
Sbjct: 3   KRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVE-EVMPDLILLDIMLPQKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   +R   +
Sbjct: 62  MEVCREVRKK---YDMPIIILTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVRANLR 118

Query: 120 MQ 121
             
Sbjct: 119 RH 120


>gi|269791708|ref|YP_003316612.1| two component transcriptional regulator, winged helix family
           [Thermanaerovibrio acidaminovorans DSM 6589]
 gi|269099343|gb|ACZ18330.1| two component transcriptional regulator, winged helix family
           [Thermanaerovibrio acidaminovorans DSM 6589]
          Length = 228

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 51/123 (41%), Gaps = 3/123 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R++    F   G+ V  A    +A +      +P+ +++D  +  +   
Sbjct: 4   RILVVEDEEGIREILSEAFRRQGYTVMCAADGDQAVDLALTA-VPDLIILDLMLPKMDGW 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+      V V  L    D    +AG  AGA+ ++ KPF+   L   +R   + 
Sbjct: 63  EVCRRIREEQELRHVPVIMLTARRDERDAVAGLEAGADDYVRKPFSIPELMARVRAHLRR 122

Query: 121 QKS 123
             S
Sbjct: 123 SDS 125


>gi|300742302|ref|ZP_07072323.1| DNA-binding response regulator PhoP [Rothia dentocariosa M567]
 gi|300381487|gb|EFJ78049.1| DNA-binding response regulator PhoP [Rothia dentocariosa M567]
          Length = 240

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    + ++        GF V  A +  EA E  E E  P+ +V+D  M G+  F
Sbjct: 12  KLLVVDDEFNILELLATSLRFAGFEVVTAGNGREAIEKAENE-QPDLIVLDVMMPGMDGF 70

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G    V +L  +   E  +AG  AG + ++ KPF+ + +   +R + +  +
Sbjct: 71  EVTRRLRDAGRTYPVLFLTAKDATEDKVAGLGAGGDDYVTKPFSLDEVIARIRAILRRSR 130

Query: 123 SKDEN 127
           +  E 
Sbjct: 131 NAQEE 135


>gi|302543578|ref|ZP_07295920.1| DNA-binding response regulator [Streptomyces hygroscopicus ATCC
           53653]
 gi|302461196|gb|EFL24289.1| DNA-binding response regulator [Streptomyces himastatinicus ATCC
           53653]
          Length = 246

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 46/118 (38%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    VR+  +      G+    A    +A E       P  +V+D  M  +   
Sbjct: 12  RILIVDDEPAVREALQRSLAFEGYATETAVDGLDALEKAGT-YDPELIVLDVLMPRMDGL 70

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            A  R    G  V V  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 71  TAARRLRATGVTVPVLMLTARDTVGDRVTGLDAGADDYLVKPFELDELLARIRALLRR 128


>gi|262275912|ref|ZP_06053721.1| putative DNA-binding response regulator [Grimontia hollisae CIP
           101886]
 gi|262219720|gb|EEY71036.1| putative DNA-binding response regulator [Grimontia hollisae CIP
           101886]
          Length = 240

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++ +   +  G+ V  A +  E +     +  P+ +++D  + G   
Sbjct: 5   KRILVVDDDLEIRELLQEYLSKAGYNVTTAQNGQEMKAKLAVQ-YPDLILLDIMLPGDDG 63

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F    +VRQ      V +  L    D    I G   GA+ ++ KPF+   L   +R L +
Sbjct: 64  FTLCKYVRQDSS---VPIIMLTAVSDETDQIIGLELGADDYIAKPFSPRQLVARIRALLR 120

Query: 120 MQKSKDE 126
             +   E
Sbjct: 121 RTQQLQE 127


>gi|328883961|emb|CCA57200.1| two-component system response regulator [Streptomyces venezuelae
           ATCC 10712]
          Length = 242

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 30/118 (25%), Positives = 49/118 (41%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    VR+  R      G+   +A    +A    E    P+ +V+D  M  +   
Sbjct: 10  RILIVDDEPAVREALRRSLAFEGYGTQDAVDGVDALARMES-YAPDLVVLDVQMPRMDGL 68

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            A  R    G+ V +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 69  TAARRIRASGSTVPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 126


>gi|323701174|ref|ZP_08112849.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323533776|gb|EGB23640.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 230

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+ D    +R++ R      GF V EA    +  +  + +   + +++D  M  + 
Sbjct: 1   MKTILIADDEERIRQLVRLYLEAEGFTVCEAEDGQQVLDIVKSQP-IDLVLLDLMMPVLD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      + +  L  + +    + G   GA+ +++KPF+   L   ++ + 
Sbjct: 60  GWTVCKMLRRE---RKIPIVMLTAKGEENDRVLGLDLGADDYIVKPFSTRELVARVKAVL 116

Query: 119 QMQKSKDE 126
           +  +   E
Sbjct: 117 RRAEGIGE 124


>gi|291445851|ref|ZP_06585241.1| two-component system response regulator [Streptomyces roseosporus
           NRRL 15998]
 gi|291348798|gb|EFE75702.1| two-component system response regulator [Streptomyces roseosporus
           NRRL 15998]
          Length = 228

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 29/119 (24%), Positives = 47/119 (39%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  R      G+    A    +A    E    P+ +V+D  M  +  
Sbjct: 30  QRILIVDDEPAVREALRRSLAFEGYGTQVAVDGYDALAMAEA-YAPDLIVLDIQMPRMDG 88

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G+   +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 89  LTAARRIRATGSTTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 147


>gi|283768598|ref|ZP_06341510.1| putative regulatory protein VanR [Bulleidia extructa W1219]
 gi|283104990|gb|EFC06362.1| putative regulatory protein VanR [Bulleidia extructa W1219]
          Length = 232

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 28/128 (21%), Positives = 59/128 (46%), Gaps = 2/128 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           MD +LLVD    + +  +   +   F +  AT+  EA E  +KE + + +++D  M  + 
Sbjct: 1   MDRILLVDDEKDIVEALKIFLSKEDFELLTATNGKEALEIVQKEKV-DLVLMDIMMPIMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++    ++ + +L  + + E  I G   GA+ ++ KPF+ E +   ++   + 
Sbjct: 60  GV-KATKEIRKNQNIPIIFLSAKGEREDKIEGLTIGADDYITKPFHPEEVIARIKAQLRR 118

Query: 121 QKSKDENQ 128
            K     Q
Sbjct: 119 FKELGSQQ 126


>gi|257440065|ref|ZP_05615820.1| DNA-binding response regulator SrrA [Faecalibacterium prausnitzii
           A2-165]
 gi|257197417|gb|EEU95701.1| DNA-binding response regulator SrrA [Faecalibacterium prausnitzii
           A2-165]
          Length = 232

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 20/120 (16%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++ R      G+ V  A    E  +    ++ P+ +++D  M  +   
Sbjct: 5   KILVVDDDTNICELLRLYLTKEGYQVTTANDGEEGLDKF-NQVKPDMVLLDVMMPKMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R++    +  V  L  + +    + G   GA+ +++KPF+ + +   ++ + + 
Sbjct: 64  EVCRRIRKLG---NTPVMMLTAKGETFDKVLGLELGADDYMVKPFDTKEVVARIKAVLRR 120


>gi|69247564|ref|ZP_00604398.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Enterococcus faecium DO]
 gi|227552548|ref|ZP_03982597.1| VicR family response regulator [Enterococcus faecium TX1330]
 gi|258614681|ref|ZP_05712451.1| DNA-binding response regulator VicR [Enterococcus faecium DO]
 gi|293378479|ref|ZP_06624642.1| response regulator receiver domain protein [Enterococcus faecium
           PC4.1]
 gi|293553004|ref|ZP_06673649.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1039]
 gi|293559841|ref|ZP_06676356.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1162]
 gi|293567713|ref|ZP_06679056.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1071]
 gi|294616677|ref|ZP_06696447.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1636]
 gi|294619190|ref|ZP_06698676.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecium E1679]
 gi|294623110|ref|ZP_06701996.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium U0317]
 gi|68194788|gb|EAN09265.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Enterococcus faecium DO]
 gi|227178297|gb|EEI59269.1| VicR family response regulator [Enterococcus faecium TX1330]
 gi|291589648|gb|EFF21453.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1071]
 gi|291590431|gb|EFF22170.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1636]
 gi|291594572|gb|EFF25963.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Enterococcus faecium E1679]
 gi|291597479|gb|EFF28644.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium U0317]
 gi|291602810|gb|EFF33017.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1039]
 gi|291606205|gb|EFF35624.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E1162]
 gi|292642808|gb|EFF60955.1| response regulator receiver domain protein [Enterococcus faecium
           PC4.1]
          Length = 234

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V+ A    EA E    E+ P+ +++D  +  + 
Sbjct: 1   MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKV-AEVEPDLILLDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKTYDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118


>gi|146280822|ref|YP_001170975.1| DNA-binding response regulator PhoB [Pseudomonas stutzeri A1501]
 gi|145569027|gb|ABP78133.1| DNA-binding response regulator PhoB [Pseudomonas stutzeri A1501]
 gi|327479090|gb|AEA82400.1| DNA-binding response regulator PhoB [Pseudomonas stutzeri DSM 4166]
          Length = 229

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   KSILIVDDEAPIREMIVVALEMAGYDCLEAENTQQAHALII-DRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D  +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTADTPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|332654085|ref|ZP_08419829.1| DNA-binding response regulator VicR [Ruminococcaceae bacterium D16]
 gi|332517171|gb|EGJ46776.1| DNA-binding response regulator VicR [Ruminococcaceae bacterium D16]
          Length = 240

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 55/128 (42%), Gaps = 2/128 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD   ++ K       + G+ V       EA E   +E   + +++D  M  + 
Sbjct: 8   MAKILVVDDERVLVKGITFNLKNEGYQVETGYDGEEAVELA-REGKFDLIILDLMMPKID 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              A +R     ++V +  L    +    I G   GA+ ++ KPFN   L+  +R L + 
Sbjct: 67  GLQACMRIRE-FSNVPIIMLTARSEDTDKIIGFECGADDYITKPFNILELKARVRALLRR 125

Query: 121 QKSKDENQ 128
             +  ++Q
Sbjct: 126 SGAAVQHQ 133


>gi|30264659|ref|NP_847036.1| DNA-binding response regulator PhoP [Bacillus anthracis str. Ames]
 gi|47530129|ref|YP_021478.1| DNA-binding response regulator PhoP [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47564999|ref|ZP_00236042.1| alkaline phosphatase synthesis two-component response regulator
           phoP [Bacillus cereus G9241]
 gi|49187479|ref|YP_030731.1| DNA-binding response regulator PhoP [Bacillus anthracis str.
           Sterne]
 gi|49481343|ref|YP_038634.1| alkaline phosphatase synthesis response regulator [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|52140920|ref|YP_085909.1| alkaline phosphatase synthesis response regulator [Bacillus cereus
           E33L]
 gi|65321956|ref|ZP_00394915.1| COG0745: Response regulators consisting of a CheY-like receiver
           domain and a winged-helix DNA-binding domain [Bacillus
           anthracis str. A2012]
 gi|118479736|ref|YP_896887.1| alkaline phosphatase synthesis response regulator [Bacillus
           thuringiensis str. Al Hakam]
 gi|165869762|ref|ZP_02214420.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0488]
 gi|167633879|ref|ZP_02392202.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0442]
 gi|167638246|ref|ZP_02396524.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0193]
 gi|170685683|ref|ZP_02876906.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0465]
 gi|170705363|ref|ZP_02895827.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0389]
 gi|177651214|ref|ZP_02934045.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0174]
 gi|190569075|ref|ZP_03021975.1| DNA-binding response regulator PhoP [Bacillus anthracis
           Tsiankovskii-I]
 gi|196032842|ref|ZP_03100255.1| DNA-binding response regulator PhoP [Bacillus cereus W]
 gi|196040861|ref|ZP_03108159.1| DNA-binding response regulator PhoP [Bacillus cereus NVH0597-99]
 gi|196047480|ref|ZP_03114691.1| DNA-binding response regulator PhoP [Bacillus cereus 03BB108]
 gi|206977153|ref|ZP_03238052.1| DNA-binding response regulator PhoP [Bacillus cereus H3081.97]
 gi|217962068|ref|YP_002340638.1| DNA-binding response regulator PhoP [Bacillus cereus AH187]
 gi|218905816|ref|YP_002453650.1| DNA-binding response regulator PhoP [Bacillus cereus AH820]
 gi|225866566|ref|YP_002751944.1| DNA-binding response regulator PhoP [Bacillus cereus 03BB102]
 gi|227817373|ref|YP_002817382.1| DNA-binding response regulator PhoP [Bacillus anthracis str. CDC
           684]
 gi|228917227|ref|ZP_04080784.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|228929636|ref|ZP_04092654.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228935896|ref|ZP_04098706.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228948313|ref|ZP_04110596.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228987836|ref|ZP_04147945.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|229093685|ref|ZP_04224784.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-42]
 gi|229124155|ref|ZP_04253347.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 95/8201]
 gi|229141314|ref|ZP_04269852.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST26]
 gi|229158191|ref|ZP_04286258.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 4342]
 gi|229186844|ref|ZP_04313999.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BGSC 6E1]
 gi|229604309|ref|YP_002868868.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0248]
 gi|254687396|ref|ZP_05151252.1| DNA-binding response regulator PhoP [Bacillus anthracis str.
           CNEVA-9066]
 gi|254724959|ref|ZP_05186742.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A1055]
 gi|254736696|ref|ZP_05194402.1| DNA-binding response regulator PhoP [Bacillus anthracis str.
           Western North America USA6153]
 gi|254741733|ref|ZP_05199420.1| DNA-binding response regulator PhoP [Bacillus anthracis str. Kruger
           B]
 gi|254754669|ref|ZP_05206704.1| DNA-binding response regulator PhoP [Bacillus anthracis str.
           Vollum]
 gi|254757501|ref|ZP_05209528.1| DNA-binding response regulator PhoP [Bacillus anthracis str.
           Australia 94]
 gi|301056094|ref|YP_003794305.1| alkaline phosphatase synthesis response regulator [Bacillus
           anthracis CI]
 gi|30259334|gb|AAP28522.1| DNA-binding response regulator PhoP [Bacillus anthracis str. Ames]
 gi|47505277|gb|AAT33953.1| DNA-binding response regulator PhoP [Bacillus anthracis str. 'Ames
           Ancestor']
 gi|47557785|gb|EAL16110.1| alkaline phosphatase synthesis two-component response regulator
           phoP [Bacillus cereus G9241]
 gi|49181406|gb|AAT56782.1| DNA-binding response regulator PhoP [Bacillus anthracis str.
           Sterne]
 gi|49332899|gb|AAT63545.1| alkaline phosphatase synthesis response regulator [Bacillus
           thuringiensis serovar konkukian str. 97-27]
 gi|51974389|gb|AAU15939.1| alkaline phosphatase synthesis response regulator [Bacillus cereus
           E33L]
 gi|118418961|gb|ABK87380.1| alkaline phosphatase synthesis response regulator [Bacillus
           thuringiensis str. Al Hakam]
 gi|164714591|gb|EDR20110.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0488]
 gi|167514063|gb|EDR89431.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0193]
 gi|167530680|gb|EDR93382.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0442]
 gi|170129488|gb|EDS98351.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0389]
 gi|170670147|gb|EDT20887.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0465]
 gi|172083040|gb|EDT68102.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0174]
 gi|190559857|gb|EDV13842.1| DNA-binding response regulator PhoP [Bacillus anthracis
           Tsiankovskii-I]
 gi|195994271|gb|EDX58226.1| DNA-binding response regulator PhoP [Bacillus cereus W]
 gi|196021695|gb|EDX60391.1| DNA-binding response regulator PhoP [Bacillus cereus 03BB108]
 gi|196028315|gb|EDX66924.1| DNA-binding response regulator PhoP [Bacillus cereus NVH0597-99]
 gi|206744638|gb|EDZ56046.1| DNA-binding response regulator PhoP [Bacillus cereus H3081.97]
 gi|217063985|gb|ACJ78235.1| DNA-binding response regulator PhoP [Bacillus cereus AH187]
 gi|218539540|gb|ACK91938.1| DNA-binding response regulator PhoP [Bacillus cereus AH820]
 gi|225790365|gb|ACO30582.1| DNA-binding response regulator PhoP [Bacillus cereus 03BB102]
 gi|227003433|gb|ACP13176.1| DNA-binding response regulator PhoP [Bacillus anthracis str. CDC
           684]
 gi|228596581|gb|EEK54246.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BGSC 6E1]
 gi|228625149|gb|EEK81909.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 4342]
 gi|228642095|gb|EEK98388.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST26]
 gi|228659457|gb|EEL15105.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 95/8201]
 gi|228689570|gb|EEL43378.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-42]
 gi|228771884|gb|EEM20341.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|228811300|gb|EEM57638.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228823664|gb|EEM69486.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228830023|gb|EEM75642.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228842428|gb|EEM87519.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|229268717|gb|ACQ50354.1| DNA-binding response regulator PhoP [Bacillus anthracis str. A0248]
 gi|300378263|gb|ADK07167.1| alkaline phosphatase synthesis response regulator [Bacillus cereus
           biovar anthracis str. CI]
          Length = 239

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 51/132 (38%), Gaps = 5/132 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQFLD 131
             K + E Q  +
Sbjct: 120 RTKLQQEEQVTE 131


>gi|323706155|ref|ZP_08117723.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534448|gb|EGB24231.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 231

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    + ++ ++     G+   EA    E  +   +E  P+ +++D  +  + 
Sbjct: 1   MSRILIVDDEKPIVEILKYNLEKNGYSTIEAYDGEEGLKMA-QEKNPDLILLDVMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F   +R +       +  L  + +    + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GFTV-LRILRQTMTTPILMLTAKEEEVDKVLGLELGADDYVTKPFSMRELIARVKANLRR 118


>gi|148550428|ref|YP_001270530.1| two component transcriptional regulator [Pseudomonas putida F1]
 gi|167036353|ref|YP_001671584.1| two component transcriptional regulator [Pseudomonas putida GB-1]
 gi|325275137|ref|ZP_08141111.1| winged helix family two component transcriptional regulator
           [Pseudomonas sp. TJI-51]
 gi|148514486|gb|ABQ81346.1| two component transcriptional regulator, winged helix family
           [Pseudomonas putida F1]
 gi|166862841|gb|ABZ01249.1| two component transcriptional regulator, winged helix family
           [Pseudomonas putida GB-1]
 gi|313501293|gb|ADR62659.1| PhoB [Pseudomonas putida BIRD-1]
 gi|324099745|gb|EGB97617.1| winged helix family two component transcriptional regulator
           [Pseudomonas sp. TJI-51]
          Length = 229

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|297625282|ref|YP_003687045.1| two-component response regulator [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
 gi|296921047|emb|CBL55585.1| two-component response regulator [Propionibacterium freudenreichii
           subsp. shermanii CIRM-BIA1]
          Length = 231

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 30/124 (24%), Positives = 50/124 (40%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    VR       +  G+ V  A    EA       L P+ +V+D  M  +    
Sbjct: 5   ILVVDDDQAVRDSLARSLHYSGYEVETAEDGLEALAKLSTNLHPDAVVMDVMMPRLDGLE 64

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
                   G DV +  L         + G  AGA+ +++KPF+ E L   +R L +  + 
Sbjct: 65  TTKMLRANGNDVPILVLTARDAVGDRVDGLDAGADDYMVKPFSLEELLARLRALTRRSRP 124

Query: 124 KDEN 127
           + + 
Sbjct: 125 ESQQ 128


>gi|260436657|ref|ZP_05790627.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Synechococcus sp. WH 8109]
 gi|260414531|gb|EEX07827.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Synechococcus sp. WH 8109]
          Length = 272

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 54/125 (43%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++     +  G+ V  A    EA E       P+ +V+D  M      
Sbjct: 34  TILVVDDEASIRRILETRLSMIGYNVVTACDGTEALELFPT-CTPDLVVLDVMMPKLDGY 92

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 93  GVCQELRKE---SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 149

Query: 121 QKSKD 125
            + + 
Sbjct: 150 VEKEQ 154


>gi|302530364|ref|ZP_07282706.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. AA4]
 gi|302439259|gb|EFL11075.1| phosphate regulon transcriptional regulatory protein PhoB
           [Streptomyces sp. AA4]
          Length = 233

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 34/123 (27%), Positives = 54/123 (43%), Gaps = 6/123 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +L+VD    VR V R      GF V  A     A      E +P+ +V+D  M G   L
Sbjct: 7   RVLVVDDDETVRDVVRRYLETAGFTVDLAGDGTAALAQF-AERVPDLVVLDVMMPGLNGL 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +RQ    + V +  L    + E  IAG + GA+ ++ KPF+ + L   +  + + 
Sbjct: 66  EVCRRLRQ---TSQVPIVMLTALGEEENRIAGLQLGADDYVTKPFSPKELTLRVASVLRR 122

Query: 121 QKS 123
            + 
Sbjct: 123 ARM 125


>gi|311112222|ref|YP_003983444.1| two component response regulator [Rothia dentocariosa ATCC 17931]
 gi|310943716|gb|ADP40010.1| two component response regulator [Rothia dentocariosa ATCC 17931]
          Length = 234

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 33/125 (26%), Positives = 56/125 (44%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    + ++        GF V  A +  EA E  E E  P+ +V+D  M G+  F
Sbjct: 6   KLLVVDDEFNILELLATSLRFAGFEVVTAGNGREAIEKAENE-QPDLIVLDVMMPGMDGF 64

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G    V +L  +   E  +AG  AG + ++ KPF+ + +   +R + +  +
Sbjct: 65  EVTRRLRDAGRTYPVLFLTAKDATEDKVAGLGAGGDDYVTKPFSLDEVIARIRAILRRSR 124

Query: 123 SKDEN 127
           +  E 
Sbjct: 125 NAQEE 129


>gi|293570841|ref|ZP_06681888.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E980]
 gi|291609109|gb|EFF38384.1| alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Enterococcus faecium E980]
          Length = 234

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 50/120 (41%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V+ A    EA E    E+ P+ +++D  +  + 
Sbjct: 1   MKKVLVVDDEKPISDIVKFNLAKEGYDVYTAYDGEEALEKV-AEVEPDLILLDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKTYDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118


>gi|156744350|ref|YP_001434479.1| two component transcriptional regulator [Roseiflexus castenholzii
           DSM 13941]
 gi|156235678|gb|ABU60461.1| two component transcriptional regulator, winged helix family
           [Roseiflexus castenholzii DSM 13941]
          Length = 229

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 28/121 (23%), Positives = 53/121 (43%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R + R      GF V EA S  +  +    +  P+ +++D  M  +  
Sbjct: 7   RRILIVDDEPGLRDLLRINLEHEGFSVIEAESGAQGLQMVRDQH-PDLMILDVMMPEMDG 65

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+    + + V  L      + ++ G  +GA+ +L KPFN + L   +R L +
Sbjct: 66  WEVCRRLRE---FSQMPVLMLTARTQSKDIVTGLESGADDYLTKPFNMDELTARIRALLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|87303913|ref|ZP_01086579.1| two component transcriptional regulator, winged helix family
           protein [Synechococcus sp. WH 5701]
 gi|87281609|gb|EAQ73617.1| two component transcriptional regulator, winged helix family
           protein [Synechococcus sp. WH 5701]
          Length = 248

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 55/125 (44%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++     +  G+ V  A    EA E      +P+ +V+D  M      
Sbjct: 10  TILVVDDEASIRRILETRLSMIGYNVVTACDGTEALELFP-NCMPDLVVLDVMMPKLDGY 68

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 69  GVCQELRKE---SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 125

Query: 121 QKSKD 125
            + + 
Sbjct: 126 VEKEA 130


>gi|167037240|ref|YP_001664818.1| two component transcriptional regulator [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|256751995|ref|ZP_05492864.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|320115659|ref|YP_004185818.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166856074|gb|ABY94482.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256749105|gb|EEU62140.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|319928750|gb|ADV79435.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 234

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 17/123 (13%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+++    + ++ R+     G+ V  + +  E  +    E  P+ +++D  +  V   
Sbjct: 4   TVLVIEDEIHILELLRYNLEAAGYKVITSENGKEGLDKAF-EGKPDLVILDLMLPDVDGL 62

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++     ++ +  L  + +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  EICKILKKNDETKNIPIIMLTAKSEEFDKVLGLELGADDYITKPFSVRELLARIKAVLRR 122

Query: 121 QKS 123
            + 
Sbjct: 123 TQQ 125


>gi|256786375|ref|ZP_05524806.1| two-component systen response regulator [Streptomyces lividans
           TK24]
 gi|289770266|ref|ZP_06529644.1| two-component system response regulator [Streptomyces lividans
           TK24]
 gi|289700465|gb|EFD67894.1| two-component system response regulator [Streptomyces lividans
           TK24]
          Length = 248

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A E       P+ +V+D  M  +  
Sbjct: 15  QRILIVDDEPAVREALQRSLAFEGYDTEVAVDGADALEKATA-YRPDLVVLDIQMPRMDG 73

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 74  LTAARRIRGAGDLTPIVMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 132


>gi|261406013|ref|YP_003242254.1| winged helix family two component transcriptional regulator
           [Paenibacillus sp. Y412MC10]
 gi|329929811|ref|ZP_08283487.1| transcriptional regulatory protein ResD [Paenibacillus sp. HGF5]
 gi|261282476|gb|ACX64447.1| two component transcriptional regulator, winged helix family
           [Paenibacillus sp. Y412MC10]
 gi|328935789|gb|EGG32250.1| transcriptional regulatory protein ResD [Paenibacillus sp. HGF5]
          Length = 238

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 20/126 (15%), Positives = 52/126 (41%), Gaps = 6/126 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +R++ +      G+ + EA     A      E     +++D  + G+  
Sbjct: 6   NRILVVDDEERIRRLLKMYLEKEGYEIEEAEDGETALRKASSEDY-GLVILDVMLPGMDG 64

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +RQ+       +  L  + +    + G   GA+ +++KPF+   + + ++ + +
Sbjct: 65  VEVCTRLRQV---KSTPILMLTAKGEEINRVQGFEVGADDYVVKPFSPREVIYRVKAILR 121

Query: 120 MQKSKD 125
              +  
Sbjct: 122 RSSATA 127


>gi|313904351|ref|ZP_07837729.1| two component transcriptional regulator, winged helix family
           [Eubacterium cellulosolvens 6]
 gi|313470901|gb|EFR66225.1| two component transcriptional regulator, winged helix family
           [Eubacterium cellulosolvens 6]
          Length = 236

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 20/121 (16%), Positives = 48/121 (39%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD  + + ++         F         EA         P+ +++D  + G+  
Sbjct: 5   QKILIVDDDNNIAELISLYLTKECFECTIVNDGEEALRAV-SSFSPDLILLDLMLPGMDG 63

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 VR     ++V +  L  + +    + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 64  YEVCREVR---HKSNVPIIMLSAKGEVFDKVLGLEMGADDYMIKPFDSKELVARVKAVLR 120

Query: 120 M 120
            
Sbjct: 121 R 121


>gi|114794859|pdb|2IYN|A Chain A, The Co-Factor-Induced Pre-Active Conformation In Phob
 gi|114794860|pdb|2IYN|B Chain B, The Co-Factor-Induced Pre-Active Conformation In Phob
 gi|114794861|pdb|2IYN|C Chain C, The Co-Factor-Induced Pre-Active Conformation In Phob
          Length = 124

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|297517635|ref|ZP_06936021.1| transcriptional regulator PhoB [Escherichia coli OP50]
 gi|6573458|pdb|1B00|A Chain A, Phob Receiver Domain From Escherichia Coli
 gi|6573459|pdb|1B00|B Chain B, Phob Receiver Domain From Escherichia Coli
          Length = 127

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RRILVVEDEAPIREMVCFVLEQNGFQPVEAEDYDSAVNQL-NEPWPDLILLDWMLPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             FI H+++  +  D+ V  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQFIKHLKRESMTRDIPVVMLTARGEEEDRVRGLETGADDYITKPFSPKELVARIKAVMR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|260904263|ref|ZP_05912585.1| two-component response regulator [Brevibacterium linens BL2]
          Length = 251

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 31/126 (24%), Positives = 57/126 (45%), Gaps = 1/126 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           +LL+VD    +R++        GF V  A +  EA    E+   P+ LV+D  +  +  F
Sbjct: 12  TLLVVDDEPNIRELLSTSLRFAGFDVVSAANGAEALRLAEQTN-PDLLVLDVMLPDMDGF 70

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R   +G +  V +L    D    I G   G + ++ KPF+ E +   +R + +  +
Sbjct: 71  TVTRRLRQIGMNAPVVFLTARDDTSDKITGLTVGGDDYVTKPFSLEEVVARIRAVLRRTR 130

Query: 123 SKDENQ 128
           S ++ +
Sbjct: 131 SLEDEE 136


>gi|288554258|ref|YP_003426193.1| winged helix family two component transcriptional regulator
           [Bacillus pseudofirmus OF4]
 gi|288545418|gb|ADC49301.1| two component transcriptional regulator, winged helix family
           [Bacillus pseudofirmus OF4]
          Length = 229

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 58/133 (43%), Gaps = 8/133 (6%)

Query: 1   MD--SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG 58
           M    +L+V+    +R++ +      G++V EA +  EA E  EK L  + +++D  M  
Sbjct: 1   MKEIRILIVEDEAPMRELLQLYLRKEGYVVDEAITGIEALEKVEKTLY-SVVLLDVMMPE 59

Query: 59  VLEF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +  F     +R++   + V V  L         + G + GA+ +L KPF +E L   +  
Sbjct: 60  MDGFEVCREIRKV---SQVPVIMLTARTQTLDKVKGLKIGADDYLTKPFEQEELLARVEA 116

Query: 117 LPQMQKSKDENQF 129
           + +     +    
Sbjct: 117 VLRRYGVSEPESR 129


>gi|325289049|ref|YP_004265230.1| two component transcriptional regulator, winged helix family
           [Syntrophobotulus glycolicus DSM 8271]
 gi|324964450|gb|ADY55229.1| two component transcriptional regulator, winged helix family
           [Syntrophobotulus glycolicus DSM 8271]
          Length = 227

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 56/129 (43%), Gaps = 5/129 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +++VD    +R++   L +  GF   EA    EA +       P+ ++ID  M  + 
Sbjct: 3   MSKIMIVDDDPNIRELVLALLHRSGFAACEAADGREALQKML-NDNPDLVIIDVMMPNMD 61

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F    H+R+     ++ V  L  + +    + G   GA+ +L KPF  + L   ++ L 
Sbjct: 62  GFELCRHLRR--YYENLPVIMLTAKGELASKVKGFGLGADDYLTKPFEGDELIARVQALL 119

Query: 119 QMQKSKDEN 127
           +  K +   
Sbjct: 120 RRYKIEASQ 128


>gi|158320425|ref|YP_001512932.1| two component transcriptional regulator [Alkaliphilus oremlandii
           OhILAs]
 gi|158140624|gb|ABW18936.1| two component transcriptional regulator, winged helix family
           [Alkaliphilus oremlandii OhILAs]
          Length = 237

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 55/130 (42%), Gaps = 3/130 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+VD    + ++ R      G+ V    +  E     +   + + +V+D  + G+  
Sbjct: 7   KTILVVDDEEHILELIRFNLEKEGYDVLLCENGDECIPMIQNNKV-DLVVLDLMLPGMDG 65

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 + +M    ++ +  L  + +    + G   GA+ ++ KPF+   L   +R + +
Sbjct: 66  IQICKKLNRMDEYENLPIIMLTAKSEETDRVLGLELGADDYITKPFSVRELIARIRAVLR 125

Query: 120 MQKSKDENQF 129
             +SK ++  
Sbjct: 126 RSESKQDSSR 135


>gi|147676383|ref|YP_001210598.1| response regulator [Pelotomaculum thermopropionicum SI]
 gi|146272480|dbj|BAF58229.1| response regulator [Pelotomaculum thermopropionicum SI]
          Length = 232

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 55/131 (41%), Gaps = 9/131 (6%)

Query: 1   MDS--LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG 58
           M    +L+VD    + ++ +      G++V  A     A E  E     + L++D  + G
Sbjct: 1   MKRKTILIVDDEPRLVRLVKVNLLASGYVVDTAADGKTAIEMLESSGY-DLLILDIMLPG 59

Query: 59  ---VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
                E    +R+    +D+ +  L      +  I G  AGA+ ++ KPF+ E L   ++
Sbjct: 60  PLNGFEVCKRIRE---FSDIPIIMLTGRAREQDRIRGFDAGADDYVTKPFSVEELLLRVK 116

Query: 116 ELPQMQKSKDE 126
            + +     +E
Sbjct: 117 AILRRSHPSEE 127


>gi|330961382|gb|EGH61642.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. maculicola str. ES4326]
          Length = 229

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|258514364|ref|YP_003190586.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
 gi|257778069|gb|ACV61963.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum acetoxidans DSM 771]
          Length = 235

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 49/124 (39%), Gaps = 3/124 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M S+L+VD    + ++ +      G+ V  A     A +    E  P+ +++D  +    
Sbjct: 1   MPSVLVVDDEQNIIEIIKFNLEREGYQVITARDGTTALQLARSEK-PDLIILDIMLPEQD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            L     ++Q      + +  +    D    I G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLAVCRLLQQEQKTRGIPIIMVSARGDELDKILGLEMGADDYVTKPFSPRELVARVKARL 119

Query: 119 QMQK 122
           +  +
Sbjct: 120 RRSE 123


>gi|148653918|ref|YP_001281011.1| osmolarity response regulator [Psychrobacter sp. PRwf-1]
 gi|148573002|gb|ABQ95061.1| two component transcriptional regulator, winged helix family
           [Psychrobacter sp. PRwf-1]
          Length = 248

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 1/122 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R + +    D GF+V  A    +  +   +  L + +V+D  + G    
Sbjct: 15  RILVVDDDARLRSLLQRFLEDDGFVVRTAHDGSQ-MDKLMQRELFSLVVLDLMLPGEDGI 73

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R     +D+ +  L  +      IAG  AGA+ +L KPFN + L   ++ + +   
Sbjct: 74  AICKRLREENSDIPIIMLTAKGSDSDRIAGLEAGADDYLPKPFNPKELLARIKAVLRRHS 133

Query: 123 SK 124
            +
Sbjct: 134 RE 135


>gi|66048256|ref|YP_238097.1| response regulator receiver:transcriptional regulatory protein,
           C-terminal [Pseudomonas syringae pv. syringae B728a]
 gi|71734112|ref|YP_277191.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|257485715|ref|ZP_05639756.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tabaci ATCC 11528]
 gi|289628101|ref|ZP_06461055.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aesculi str. NCPPB3681]
 gi|289651289|ref|ZP_06482632.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aesculi str. 2250]
 gi|289677407|ref|ZP_06498297.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. syringae FF5]
 gi|298489418|ref|ZP_07007429.1| Phosphate regulon transcriptional regulatory protein phoB
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|302187091|ref|ZP_07263764.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. syringae 642]
 gi|63258963|gb|AAY40059.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Pseudomonas syringae pv. syringae B728a]
 gi|71554665|gb|AAZ33876.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. phaseolicola 1448A]
 gi|298155992|gb|EFH97101.1| Phosphate regulon transcriptional regulatory protein phoB
           [Pseudomonas savastanoi pv. savastanoi NCPPB 3335]
 gi|320321732|gb|EFW77830.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. glycinea str. B076]
 gi|320331482|gb|EFW87422.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. glycinea str. race 4]
 gi|330870966|gb|EGH05675.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aesculi str. 0893_23]
 gi|330890623|gb|EGH23284.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. mori str. 301020]
 gi|330937451|gb|EGH41417.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330952444|gb|EGH52704.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae Cit 7]
 gi|330970220|gb|EGH70286.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aceris str. M302273PT]
 gi|330986909|gb|EGH85012.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. lachrymans str. M301315]
 gi|331011999|gb|EGH92055.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. tabaci ATCC 11528]
          Length = 229

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|121996908|ref|YP_001001695.1| two component transcriptional regulator [Halorhodospira halophila
           SL1]
 gi|121588313|gb|ABM60893.1| two component transcriptional regulator, winged helix family
           [Halorhodospira halophila SL1]
          Length = 229

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 55/132 (41%), Gaps = 3/132 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +L+V+    VR++        GF V  A    +  E   ++  P+ +++D  +     +
Sbjct: 4   RILVVEDDPAVREMLITSLERQGFEVIPAVDAMQGSEQL-RQRPPDLILLDWMLPQVSGV 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E+   +++      + +  L    + E  + G  +G + ++ KPF+   L   ++ + + 
Sbjct: 63  EWARELKEDDQTRQIPIILLTARGEEEDKVRGFDSGVDDYVTKPFSPRELAARVKAVLRR 122

Query: 121 QKSKDENQFLDA 132
                 +  L+A
Sbjct: 123 TAPSTADTPLEA 134


>gi|296128578|ref|YP_003635828.1| two component transcriptional regulator, winged helix family
           [Cellulomonas flavigena DSM 20109]
 gi|296020393|gb|ADG73629.1| two component transcriptional regulator, winged helix family
           [Cellulomonas flavigena DSM 20109]
          Length = 242

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 27/118 (22%), Positives = 48/118 (40%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    +R++        GF V  A     A     ++  P+ +V+D  +  +  F
Sbjct: 11  RLLVVDDEPNIRELLATSLRFAGFEVHAAADGTSAL-RLARDTHPDLVVLDVMLPDMDGF 69

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               R    G  V V +L    D    + G   G + ++ KPF+ E +   +R + + 
Sbjct: 70  SVTRRLREKGEHVPVLFLTARDDTADKVQGLTVGGDDYVTKPFSLEEVVARIRAILRR 127


>gi|171780121|ref|ZP_02921025.1| hypothetical protein STRINF_01909 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
 gi|171281469|gb|EDT46904.1| hypothetical protein STRINF_01909 [Streptococcus infantarius subsp.
           infantarius ATCC BAA-102]
          Length = 236

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+    A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYETVTAFDGREAITKFEEEN-PDLIILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEVRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TENIE 123


>gi|189423658|ref|YP_001950835.1| two component transcriptional regulator, winged helix family
           [Geobacter lovleyi SZ]
 gi|189419917|gb|ACD94315.1| two component transcriptional regulator, winged helix family
           [Geobacter lovleyi SZ]
          Length = 226

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 23/126 (18%), Positives = 53/126 (42%), Gaps = 3/126 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+    + ++  +     G+      +  E  E   +E LP+ +++D  + G++
Sbjct: 1   MKKVLIVEDERDLAELLAYNLEKEGYQALVTGTGVEGLETARRE-LPDLILLDLMLPGMM 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                + +R       + V  L    D    + G   GA+ +++KPF+   L   +R + 
Sbjct: 60  GTEVCSALRHSDKTRGIPVLMLTARGDEIDRVVGFEMGADDYIVKPFSMRELMLRIRAIL 119

Query: 119 QMQKSK 124
           +    +
Sbjct: 120 RRSSQE 125


>gi|229819337|ref|YP_002880863.1| two component transcriptional regulator [Beutenbergia cavernae DSM
           12333]
 gi|229565250|gb|ACQ79101.1| two component transcriptional regulator, winged helix family
           [Beutenbergia cavernae DSM 12333]
          Length = 241

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 52/125 (41%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            L++VD    +R +        GF V  A+   EA E    E  P+ +V+D  +  +  F
Sbjct: 13  RLVVVDDEPNIRDLLATSLRFAGFDVVTASDGTEALEAIV-EGEPDLVVLDVMLPDMDGF 71

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G    V +L    D    + G   G + ++ KPF+ E +   +R + +  +
Sbjct: 72  TVTRRLRERGVRTPVVFLTARDDVADAVTGLTVGGDDYVTKPFSLEEVVARIRAVLRRSQ 131

Query: 123 SKDEN 127
           + D +
Sbjct: 132 AHDAD 136


>gi|225174252|ref|ZP_03728251.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
 gi|225170037|gb|EEG78832.1| two component transcriptional regulator, winged helix family
           [Dethiobacter alkaliphilus AHT 1]
          Length = 230

 Score =  151 bits (382), Expect = 4e-35,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 57/125 (45%), Gaps = 5/125 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           MD +L+V+    + +V R      GF V EA+   +A E    +   + +++D  +  + 
Sbjct: 1   MDRILVVEDEEKISRVIRAYLEKEGFAVEEASDGLQALELV-SDFNFSLIILDLMLPHMS 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+   G ++ +  L  +   E+ I G   GA+ +++KPF+   L   +  + 
Sbjct: 60  GEDVCKQLRRQ--GNNIPIIMLTAKGAEEERIRGLGLGADDYIVKPFSPGELVARVHAVL 117

Query: 119 QMQKS 123
           +  +S
Sbjct: 118 RRYRS 122


>gi|329934250|ref|ZP_08284329.1| PAS/PAC sensor hybrid histidine kinase precursor [Streptomyces
           griseoaurantiacus M045]
 gi|329305846|gb|EGG49701.1| PAS/PAC sensor hybrid histidine kinase precursor [Streptomyces
           griseoaurantiacus M045]
          Length = 1389

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 35/125 (28%), Positives = 55/125 (44%), Gaps = 3/125 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+ D +  +R+    L    G+ V E T   EA     +   P+ +V D  M     L
Sbjct: 641 RVLVADDNADMREYLARLLTAAGYQVTEVTDGVEALAAARR-RTPDLVVSDVMMPRLDGL 699

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E ++ +R  P    V V  L      E  I G RAGA+ +L+KPF    L   +R   ++
Sbjct: 700 ELVSRLRADPRTASVPVVLLSARAGQEASIEGLRAGADDYLVKPFAAAELLARVRANVEL 759

Query: 121 QKSKD 125
            + +D
Sbjct: 760 ARLRD 764


>gi|255524035|ref|ZP_05390997.1| two component transcriptional regulator, winged helix family
           [Clostridium carboxidivorans P7]
 gi|296186892|ref|ZP_06855293.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
 gi|255512322|gb|EET88600.1| two component transcriptional regulator, winged helix family
           [Clostridium carboxidivorans P7]
 gi|296048606|gb|EFG88039.1| response regulator receiver domain protein [Clostridium
           carboxidivorans P7]
          Length = 228

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    + +V +    + G+         EA+E    E  P+ +++D  +     +
Sbjct: 7   KILIVDDDENICEVIKMYVENSGYNTQVCHDGREAQEVFL-EYKPDLVLLDIMLPHVDGI 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           + +  +R+        V  L  + +    + G   GA+ +++KPF  + L   ++ + + 
Sbjct: 66  DVLKWIRKEYE---TPVIMLTAKGETFDKVLGLELGADDYIVKPFEPKELLARVKAVLRR 122

Query: 121 QKSKDENQ 128
               +EN+
Sbjct: 123 YNVDNENK 130


>gi|229138085|ref|ZP_04266683.1| Two-component response regulator [Bacillus cereus BDRD-ST26]
 gi|228645430|gb|EEL01664.1| Two-component response regulator [Bacillus cereus BDRD-ST26]
          Length = 218

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 60/129 (46%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E     +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETNHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ +   
Sbjct: 118 KQEQQEEFQ 126


>gi|227545794|ref|ZP_03975843.1| response regulator [Bifidobacterium longum subsp. infantis ATCC
           55813]
 gi|227213910|gb|EEI81749.1| response regulator [Bifidobacterium longum subsp. infantis ATCC
           55813]
          Length = 256

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 23  MTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGID 81

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 82  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVM 138

Query: 119 QMQKSKDE 126
           +  ++  +
Sbjct: 139 RRNQATAQ 146


>gi|239828688|ref|YP_002951312.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. WCH70]
 gi|239808981|gb|ACS26046.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. WCH70]
          Length = 236

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 51/122 (41%), Gaps = 6/122 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V  A    EA +  E E++P+ +++D  +     
Sbjct: 4   KRILVVDDEKPIADILQFNLQKEGYEVICAYDGEEALQKVE-EVMPDLILLDIMLPQKDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   +R   +
Sbjct: 63  MEVCREVRKK---YDMPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVRANLR 119

Query: 120 MQ 121
             
Sbjct: 120 RH 121


>gi|119961724|ref|YP_947342.1| two-component system response regulator [Arthrobacter aurescens
           TC1]
 gi|119948583|gb|ABM07494.1| two-component system response regulator [Arthrobacter aurescens
           TC1]
          Length = 274

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 46/121 (38%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +LLV+    +  V R      GF V  A     A E       P+ +++D  + G+  
Sbjct: 32  RRILLVEDEQTIADVVRDYLLKAGFQVDMAGDGFTALELA-ASRQPDLVILDRMLPGLDG 90

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +RQ      V V  +      +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 91  VEVCRRLRQ---TMSVPVIMVTALGTEDDRILGLEMGADDYVTKPFSPRELVLRVKSVLR 147

Query: 120 M 120
            
Sbjct: 148 R 148


>gi|302382814|ref|YP_003818637.1| PhoB family transcriptional regulator [Brevundimonas subvibrioides
           ATCC 15264]
 gi|302193442|gb|ADL01014.1| two component transcriptional regulator PhoB, winged helix family
           [Brevundimonas subvibrioides ATCC 15264]
          Length = 229

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 22/121 (18%), Positives = 50/121 (41%), Gaps = 3/121 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLE 61
           +L+++    +  + ++     G+ V  A    E     + E  P+ +++D  +     +E
Sbjct: 5   ILVMEDEDALATLLQYNLEKEGYDVVVAADGEEGLVQID-ERQPDLVLLDWMLPKVSGIE 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R  P   ++ V  L    +    + G   GA+ +L KPF+   L   +R + +  
Sbjct: 64  VCRRLRGRPETRNLPVIMLTARGEESDRVRGLDTGADDYLTKPFSMTELIARIRAVLRRI 123

Query: 122 K 122
           +
Sbjct: 124 R 124


>gi|90023478|ref|YP_529305.1| response regulator receiver domain-containing protein
           [Saccharophagus degradans 2-40]
 gi|89953078|gb|ABD83093.1| Phosphate regulon transcriptional regulatory protein phoB
           [Saccharophagus degradans 2-40]
          Length = 234

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R + R       + V EA    +A      +  P+ +++D  + G   
Sbjct: 4   KTILVVDDEPPIRDMLRVALEMAEYAVLEAGDAQQAHSLIV-DKKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  + +++ +  L  + + +  + G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDEVTSEIPIIMLTAKGEEDNKVQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|20808919|ref|NP_624090.1| response regulator [Thermoanaerobacter tengcongensis MB4]
 gi|20517580|gb|AAM25694.1| Response regulators consisting of a CheY-like receiver domain and a
           HTH DNA-binding domain [Thermoanaerobacter tengcongensis
           MB4]
          Length = 226

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 54/129 (41%), Gaps = 6/129 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             + +VD    + ++        GF V +      A     +E  P  +++D  + G+  
Sbjct: 5   QKIYVVDDDKNICEIVSLYLEKEGFEVEQIYDGQTALRKI-QEKPPKLVILDIMLPGIDG 63

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 VR+    + V +  L  + D    + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 64  IALCKEVRK---FSKVPIIMLTAKGDTLDKVLGLEIGADDYIVKPFDGKELVARVKAVLR 120

Query: 120 MQKSKDENQ 128
             + + E++
Sbjct: 121 RYEGESEDK 129


>gi|58583289|ref|YP_202305.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84625120|ref|YP_452492.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188578384|ref|YP_001915313.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas oryzae pv. oryzae PXO99A]
 gi|58427883|gb|AAW76920.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae KACC10331]
 gi|84369060|dbj|BAE70218.1| two-component system regulatory protein [Xanthomonas oryzae pv.
           oryzae MAFF 311018]
 gi|188522836|gb|ACD60781.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas oryzae pv. oryzae PXO99A]
          Length = 229

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 54/128 (42%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R +         F    A    EA +    + +P+ +++D  + G   
Sbjct: 3   KRILIVDDEPAIRDMVAFALRKGEFEPIHAGDAREA-QTAIADRVPDLILLDWMLPGTSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+     R+  L  D+ +  L    +    + G  AG + +++KPF+   L   +R + +
Sbjct: 62  LDLARRWRKEQLTRDIPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMR 121

Query: 120 MQKSKDEN 127
             +  DE+
Sbjct: 122 RTREDDED 129


>gi|317132020|ref|YP_004091334.1| two component transcriptional regulator, winged helix family
           [Ethanoligenens harbinense YUAN-3]
 gi|315469999|gb|ADU26603.1| two component transcriptional regulator, winged helix family
           [Ethanoligenens harbinense YUAN-3]
          Length = 229

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 19/126 (15%), Positives = 51/126 (40%), Gaps = 6/126 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + ++ R      G+ V       +A +  E    P+ +++D  + G+  
Sbjct: 4   TKILVVDDDRNINELLRLYLEKEGYSVASTYDGVDAIKKFEDHK-PDLVLLDIMLPGMDG 62

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+        V  +  + +    + G   GA+ +++KPF+ + +   ++ + +
Sbjct: 63  WQVCREIRKKSEK---PVIMITAKGETFDKVLGLELGADDYIVKPFDAKEVVARIKAVLR 119

Query: 120 MQKSKD 125
                +
Sbjct: 120 RYSGAE 125


>gi|257865288|ref|ZP_05644941.1| transcriptional regulator [Enterococcus casseliflavus EC30]
 gi|257871616|ref|ZP_05651269.1| transcriptional regulator [Enterococcus casseliflavus EC10]
 gi|257874888|ref|ZP_05654541.1| transcriptional regulator [Enterococcus casseliflavus EC20]
 gi|325571477|ref|ZP_08146977.1| DNA-binding response regulator [Enterococcus casseliflavus ATCC
           12755]
 gi|257799222|gb|EEV28274.1| transcriptional regulator [Enterococcus casseliflavus EC30]
 gi|257805780|gb|EEV34602.1| transcriptional regulator [Enterococcus casseliflavus EC10]
 gi|257809054|gb|EEV37874.1| transcriptional regulator [Enterococcus casseliflavus EC20]
 gi|325155953|gb|EGC68149.1| DNA-binding response regulator [Enterococcus casseliflavus ATCC
           12755]
          Length = 237

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 21/119 (17%), Positives = 49/119 (41%), Gaps = 2/119 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +  + +      G+ V+ A    EA E    E+ P+ +++D  +  +  
Sbjct: 5   KKILVVDDEKPISDIVKFNLTKEGYEVYTAYDGEEALEKV-AEVDPDLILLDLMLPKMDG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 64  LEVA-REVRKTHDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 121


>gi|119476351|ref|ZP_01616702.1| two-component response regulator PhoB [marine gamma proteobacterium
           HTCC2143]
 gi|119450215|gb|EAW31450.1| two-component response regulator PhoB [marine gamma proteobacterium
           HTCC2143]
          Length = 236

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
            ++L+VD    +R++ R   +  GF   EA    EA      +  P+ +++D  + G   
Sbjct: 4   KTILIVDDEAPIREMIRMSLDMAGFNCREAADTREAY-RVIADSKPDLVLLDWMLPGGSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E +  +R+  L  D+ V  L  + D +  I G   GA+ ++ KPF    +   ++ L +
Sbjct: 63  IELLRRLRKEELTADLPVIMLTAKTDEDNKIQGLDVGADDYITKPFAPREMLSRIKALLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|312883993|ref|ZP_07743710.1| sensory box sensor histidine kinase/response regulator [Vibrio
           caribbenthicus ATCC BAA-2122]
 gi|309368451|gb|EFP95986.1| sensory box sensor histidine kinase/response regulator [Vibrio
           caribbenthicus ATCC BAA-2122]
          Length = 1127

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 29/133 (21%), Positives = 53/133 (39%), Gaps = 6/133 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   I  ++        G+ V        A E    E  P  +++D  +  +   +
Sbjct: 723 ILVVDDEPINLRILNSYLKTEGYRVLTVNDGLSALEAVRNET-PQLILLDIMIPDMSGYD 781

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+      + +  L      E  + G  +GAN FL KPFN++ L   +       
Sbjct: 782 VCVKLRKTYDHATLPIIMLTALNQTEDRLKGFASGANDFLSKPFNQKELLARITAHLAAS 841

Query: 122 KSKD---ENQFLD 131
           +++    ENQ L+
Sbjct: 842 QAEQRKMENQKLE 854


>gi|157363849|ref|YP_001470616.1| two component transcriptional regulator [Thermotoga lettingae TMO]
 gi|157314453|gb|ABV33552.1| two component transcriptional regulator, winged helix family
           [Thermotoga lettingae TMO]
          Length = 263

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 22/129 (17%), Positives = 55/129 (42%), Gaps = 3/129 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    + ++  +     G+ V +A    EA +    E + +  ++D  + G+  
Sbjct: 28  KKILVVDDDPSIIELVSYNLAREGYDVLKAYDAEEALKVVGNESV-DMFIVDIMLPGMDG 86

Query: 62  FI--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R M    +  V +L  + +    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 87  FELVRQLRSMEKYRNTPVVFLSAKGEEFDKVLGLELGADDYITKPFSIREMIARIKAVFR 146

Query: 120 MQKSKDENQ 128
             +   + +
Sbjct: 147 RIQLSAQER 155


>gi|229542343|ref|ZP_04431403.1| two component transcriptional regulator, winged helix family
           [Bacillus coagulans 36D1]
 gi|229326763|gb|EEN92438.1| two component transcriptional regulator, winged helix family
           [Bacillus coagulans 36D1]
          Length = 236

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 52/124 (41%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V+ A    EA E  E E+ P+ +V+D  +     
Sbjct: 3   KKILVVDDEKPIADILQFNLTKEGYTVYCAYDGEEALEKVE-EVQPDLIVLDIMLPKRDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     ++ +  +  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  MEVCREVRKK---YNMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|229010688|ref|ZP_04167886.1| Two-component response regulator [Bacillus mycoides DSM 2048]
 gi|229057028|ref|ZP_04196422.1| Two-component response regulator [Bacillus cereus AH603]
 gi|229132193|ref|ZP_04261050.1| Two-component response regulator [Bacillus cereus BDRD-ST196]
 gi|229166232|ref|ZP_04293991.1| Two-component response regulator [Bacillus cereus AH621]
 gi|228617177|gb|EEK74243.1| Two-component response regulator [Bacillus cereus AH621]
 gi|228651241|gb|EEL07219.1| Two-component response regulator [Bacillus cereus BDRD-ST196]
 gi|228720305|gb|EEL71881.1| Two-component response regulator [Bacillus cereus AH603]
 gi|228750582|gb|EEM00410.1| Two-component response regulator [Bacillus mycoides DSM 2048]
          Length = 218

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 61/129 (47%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA    E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALRKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|186683796|ref|YP_001866992.1| two component transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186466248|gb|ACC82049.1| two component transcriptional regulator, winged helix family
           [Nostoc punctiforme PCC 73102]
          Length = 247

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V +A    +  +    +L P+ +++D  +  V 
Sbjct: 1   MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKG-QALALQLQPDLIMLDLMLPRVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+    +++ V  L      +  + G  AGA+ +L KPF  E L   +R L 
Sbjct: 60  GFTVCQRLRRDDRTSEIPVLMLTALSQTQDKVEGFNAGADDYLTKPFEVEELLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|229043138|ref|ZP_04190863.1| Two-component response regulator [Bacillus cereus AH676]
 gi|229144003|ref|ZP_04272419.1| Two-component response regulator [Bacillus cereus BDRD-ST24]
 gi|228639400|gb|EEK95814.1| Two-component response regulator [Bacillus cereus BDRD-ST24]
 gi|228726197|gb|EEL77429.1| Two-component response regulator [Bacillus cereus AH676]
          Length = 218

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|262199700|ref|YP_003270909.1| response regulator receiver sensor signal transduction histidine
           kinase [Haliangium ochraceum DSM 14365]
 gi|262083047|gb|ACY19016.1| response regulator receiver sensor signal transduction histidine
           kinase [Haliangium ochraceum DSM 14365]
          Length = 397

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 30/135 (22%), Positives = 61/135 (45%), Gaps = 7/135 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +LLVD +     V     ++ G+ V  A    EA E   + + P+ +++D  M G+  F 
Sbjct: 22  VLLVDDNPANLAVLFEHLDEHGYRVLVAEDGSEAVELASR-IQPDIILLDVMMPGIDGFE 80

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE--LPQ 119
               ++     +D+ + ++    D    + G RAGA  ++ KPF    +   +R   + +
Sbjct: 81  TCRQLKSHSTLSDIPIIFMTALTDTRDKVEGFRAGAVDYVTKPFQHREVLARVRTHVVLR 140

Query: 120 M--QKSKDENQFLDA 132
               + +D+ + L+A
Sbjct: 141 RLDAELRDQKRVLEA 155


>gi|21388712|dbj|BAC00821.1| phosphate regulon transcriptional regulatory protein [Rhodobacter
           sphaeroides f. sp. denitrificans]
          Length = 230

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +LLV+     R+V  +     GF V +A +  EA     +E  P+ +V+D  +     +E
Sbjct: 9   VLLVEDEPAQREVLSYNLESEGFRVVQAGNGDEAL-MLVEEAGPDVIVLDWMLPSVSGIE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++  P    V +  L    +    + G   GA+ +++KP++   L   +R   +  
Sbjct: 68  VCRQLKSRPSTRSVPIIMLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRSQLRRA 127

Query: 122 K 122
           +
Sbjct: 128 R 128


>gi|219849342|ref|YP_002463775.1| response regulator receiver modulated serine phosphatase
           [Chloroflexus aggregans DSM 9485]
 gi|219543601|gb|ACL25339.1| response regulator receiver modulated serine phosphatase
           [Chloroflexus aggregans DSM 9485]
          Length = 385

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/134 (20%), Positives = 60/134 (44%), Gaps = 4/134 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L++D S   R +        G  +  A+   +  E+ ++E   + +++D  M  +  F
Sbjct: 8   RILIIDDSEHNRYLLTRQLERRGHSIATASHGRQGLEYAQREP-FDVILLDLMMPEMDGF 66

Query: 63  IA--HVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++ P    + V  +    + + ++    AGA  +L KPFN+  L   +    + 
Sbjct: 67  TVLDQLKRNPQTHHIPVIVISAINEIDDVVRCIEAGAEDYLTKPFNQTLLYAKINACLER 126

Query: 121 QKSKD-ENQFLDAI 133
           ++ +D E  +L+AI
Sbjct: 127 KRLRDSEQAYLNAI 140


>gi|21222554|ref|NP_628333.1| two-component systen response regulator [Streptomyces coelicolor
           A3(2)]
 gi|7636029|emb|CAB88489.1| putative two-component systen response regulator [Streptomyces
           coelicolor A3(2)]
          Length = 248

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 28/119 (23%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR+  +      G+    A    +A E       P+ +V+D  M  +  
Sbjct: 15  QRILIVDDEPAVREALQRSLAFEGYDTEVAVDGADALEKATA-YRPDLVVLDIQMPRMDG 73

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A  R    G    +  L         + G  AGA+ +L+KPF  + L   +R L + 
Sbjct: 74  LTAARRIRGAGDLTPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARIRALLRR 132


>gi|148556479|ref|YP_001264061.1| two component transcriptional regulator [Sphingomonas wittichii
           RW1]
 gi|148501669|gb|ABQ69923.1| two component transcriptional regulator, winged helix family
           [Sphingomonas wittichii RW1]
          Length = 232

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 53/131 (40%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +LLV+    + ++         F V       EA     +E  P+ +++D  +EG   +
Sbjct: 5   RVLLVEDDAALAELVSWHLEREDFEVERTADGEEAI-LLARETPPDLVLLDWMIEGVSGI 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R++    +V +  L    + E  + G   GA+ ++ KPF+   L   +  + + 
Sbjct: 64  EVCRRLRRLADTANVPIIMLTARGEEEDRVRGLETGADDYVTKPFSPRELVARVGAVLRR 123

Query: 121 QKSKDENQFLD 131
            +     + L 
Sbjct: 124 VRPALAGERLS 134


>gi|113474513|ref|YP_720574.1| adenylate/guanylate cyclase [Trichodesmium erythraeum IMS101]
 gi|110165561|gb|ABG50101.1| adenylate/guanylate cyclase [Trichodesmium erythraeum IMS101]
          Length = 1130

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 54/128 (42%), Gaps = 2/128 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD   I  +V  +      + V +A S  EA    E     + +++D  M  +   E
Sbjct: 721 ILVVDDEPINIQVLNNYLKANNYQVTQALSGKEALAALENNHNFDLILLDIMMPNMTGYE 780

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
             + +R+      + V  L  +     ++ G + GAN +L KPF ++ L   ++   ++ 
Sbjct: 781 VCSQIREKYPAQSLPVLMLTAKNQIADLVMGFQFGANDYLTKPFAKDELLTRIQTHIKLS 840

Query: 122 KSKDENQF 129
           K     + 
Sbjct: 841 KITKAYER 848


>gi|309390021|gb|ADO77901.1| two component transcriptional regulator, winged helix family
           [Halanaerobium praevalens DSM 2228]
          Length = 229

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 25/130 (19%), Positives = 55/130 (42%), Gaps = 4/130 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+V+    +R++ +    + G+ V  A +   A    E E   + +V+D  +    
Sbjct: 1   MAKILVVEDEKNIRELIKFNLENAGYEVLTAENGKIALNSLEAE--IDLVVLDLMLPEVD 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E    +R       + +  L  + +  + I G   GA+ ++ KPF+   L   ++ + 
Sbjct: 59  GMEVCRQMRANKKLRQIPIIMLTAKGEEIERILGLEMGADDYMTKPFSPRELVARIKAIF 118

Query: 119 QMQKSKDENQ 128
           +  K    +Q
Sbjct: 119 RRIKELKVDQ 128


>gi|156744257|ref|YP_001434386.1| two component transcriptional regulator [Roseiflexus castenholzii
           DSM 13941]
 gi|156235585|gb|ABU60368.1| two component transcriptional regulator, winged helix family
           [Roseiflexus castenholzii DSM 13941]
          Length = 239

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +    R      G  V  A++  EA E    E +P+ +++D  M  +  
Sbjct: 7   KLILVVDDEPRMVNFMRMNLELEGCRVVSASNGREALEKVRDE-MPDVVLLDIMMPVMDG 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F   +R++   + V V  L  + D E  I G   GA+ ++ KPF+   L   +R + +  
Sbjct: 66  F-ETLRRLRQASSVPVLVLTAKDDEEDRIKGLELGADDYIGKPFSHRELVSRIRAVLRRH 124


>gi|238789578|ref|ZP_04633362.1| Transcriptional regulator in 2-component system [Yersinia
           frederiksenii ATCC 33641]
 gi|238722331|gb|EEQ13987.1| Transcriptional regulator in 2-component system [Yersinia
           frederiksenii ATCC 33641]
          Length = 232

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 52/133 (39%), Gaps = 7/133 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +LLVD    +  + + L    GF V  A    +A      +   + L++D  M    
Sbjct: 1   MHKILLVDDDRELTSLLKELLEMEGFNVVVAHDGEQALNLL--DNSIDLLLLDIMMPRKN 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E +  +RQ        V  L         + G   GA+ +L KPFN   L   +R + 
Sbjct: 59  GIETLKELRQH---HQTPVIMLTARGSELDRVLGLELGADDYLAKPFNDRELVARIRAIL 115

Query: 119 QMQKSKDENQFLD 131
           +     ++ Q +D
Sbjct: 116 RRSNWSEQQQNID 128


>gi|163845708|ref|YP_001633752.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222523414|ref|YP_002567884.1| winged helix family two component transcriptional regulator
           [Chloroflexus sp. Y-400-fl]
 gi|163666997|gb|ABY33363.1| response regulator receiver [Chloroflexus aurantiacus J-10-fl]
 gi|222447293|gb|ACM51559.1| two component transcriptional regulator, winged helix family
           [Chloroflexus sp. Y-400-fl]
          Length = 228

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 58/122 (47%), Gaps = 2/122 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD    +R V +      G+ V  AT+  E  +   +E  P+ +V+D  + G+   
Sbjct: 4   TILVVDDEASIRNVAKAYLEHAGYRVLCATTGPEGLQMALEE-QPDLIVLDLMLPGMDGM 62

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R     +DV++  L    D    +AG R GA+ +L KPF+   L   +  + + Q+
Sbjct: 63  EITARLRER-SDVYILMLTARSDEMDRVAGLRVGADDYLTKPFSPRELVARVEAILRRQR 121

Query: 123 SK 124
           +K
Sbjct: 122 NK 123


>gi|288553693|ref|YP_003425628.1| two-component response regulator [Bacillus pseudofirmus OF4]
 gi|288544853|gb|ADC48736.1| two-component response regulator involved in phosphate regulation
           [Bacillus pseudofirmus OF4]
          Length = 241

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 47/127 (37%), Gaps = 5/127 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +  + +      GF V  A+   E     + E   + L++D  +  +  
Sbjct: 3   QRILVVDDEESIATLLQFNLEQSGFEVTVASDGEEGLALAKDEP-FDLLILDLMLPKIDG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +RQ        +  L  + D    + G   GA+ ++ KPF+   +   +R + +
Sbjct: 62  LDICKQLRQNK--KMTPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVRAILR 119

Query: 120 MQKSKDE 126
                 E
Sbjct: 120 RSAQLSE 126


>gi|228951779|ref|ZP_04113878.1| Two-component response regulator [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
 gi|229177806|ref|ZP_04305179.1| Two-component response regulator [Bacillus cereus 172560W]
 gi|228605597|gb|EEK63045.1| Two-component response regulator [Bacillus cereus 172560W]
 gi|228807901|gb|EEM54421.1| Two-component response regulator [Bacillus thuringiensis serovar
           kurstaki str. T03a001]
          Length = 218

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|170760425|ref|YP_001786436.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch
           Maree]
 gi|169407414|gb|ACA55825.1| DNA-binding response regulator [Clostridium botulinum A3 str. Loch
           Maree]
          Length = 233

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 55/125 (44%), Gaps = 9/125 (7%)

Query: 1   MD---SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
           M     +L+VD    +  V +      G+ V  A    EA +   KE+  + +++D  + 
Sbjct: 1   MKEFFKILVVDDEERILDVVKAYLEKEGYEVITAMDGEEAIKLF-KEISFHLVILDLMLP 59

Query: 58  GVLE--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +      + +R+    ++V +  L  +V+ E  + G   GA+ +L KPF+   L   ++
Sbjct: 60  KIFGEEVCSKIRE---FSNVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRELVARVK 116

Query: 116 ELPQM 120
            L + 
Sbjct: 117 ALIRR 121


>gi|170719341|ref|YP_001747029.1| two component transcriptional regulator [Pseudomonas putida W619]
 gi|169757344|gb|ACA70660.1| two component transcriptional regulator, winged helix family
           [Pseudomonas putida W619]
          Length = 229

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|104784360|ref|YP_610858.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas entomophila L48]
 gi|95113347|emb|CAK18075.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas entomophila L48]
          Length = 229

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RNILIVDDEAPIREMIAVALEMAGYDCLEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|222151385|ref|YP_002560541.1| response regulator protein [Macrococcus caseolyticus JCSC5402]
 gi|222120510|dbj|BAH17845.1| response regulator protein [Macrococcus caseolyticus JCSC5402]
          Length = 235

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 52/126 (41%), Gaps = 7/126 (5%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M   +L+VD    +RK+ +      G+   EA     A E    E   + +++D  + G+
Sbjct: 1   MKEKILIVDDEDRIRKLAKMYLEREGYETVEAEDGERALELALSEN-FHCILLDIMLPGM 59

Query: 60  LE--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
                   +R+        V  L  + +    + G   GA+ +++KPF+   +   ++ +
Sbjct: 60  DGIQVCKRLREE---KSTPVIMLTAKGEEHNRVEGFEIGADDYIVKPFSPREVVLRVKAI 116

Query: 118 PQMQKS 123
            +  +S
Sbjct: 117 LRRSQS 122


>gi|239916951|ref|YP_002956509.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Micrococcus luteus NCTC 2665]
 gi|281414591|ref|ZP_06246333.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Micrococcus luteus NCTC 2665]
 gi|239838158|gb|ACS29955.1| response regulator with CheY-like receiver domain and winged-helix
           DNA-binding domain [Micrococcus luteus NCTC 2665]
          Length = 236

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    +R++        GF V  A +  EA +  E E  P+  V+D  +  +  F
Sbjct: 9   RLLVVDDEPNIRELLSTSLRYAGFEVTAAANGREALDAAE-EFQPDLAVLDVMLPDMDGF 67

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G    V +L      E  I G   G + ++ KPF+ + +   +R + +   
Sbjct: 68  TVTRRLRSAGRHFPVVFLTARDGTEDKITGLTVGGDDYVTKPFSLDEVVARIRAVLRRTA 127

Query: 123 SKDEN 127
           S D++
Sbjct: 128 SLDDD 132


>gi|15901089|ref|NP_345693.1| DNA-binding response regulator [Streptococcus pneumoniae TIGR4]
 gi|111657843|ref|ZP_01408558.1| hypothetical protein SpneT_02000966 [Streptococcus pneumoniae
           TIGR4]
 gi|116515650|ref|YP_816556.1| DNA-binding response regulator [Streptococcus pneumoniae D39]
 gi|148985122|ref|ZP_01818361.1| DNA-binding response regulator [Streptococcus pneumoniae SP3-BS71]
 gi|148989249|ref|ZP_01820629.1| DNA-binding response regulator [Streptococcus pneumoniae SP6-BS73]
 gi|148993837|ref|ZP_01823239.1| DNA-binding response regulator [Streptococcus pneumoniae SP9-BS68]
 gi|148998657|ref|ZP_01826096.1| DNA-binding response regulator [Streptococcus pneumoniae SP11-BS70]
 gi|149002595|ref|ZP_01827527.1| DNA-binding response regulator [Streptococcus pneumoniae SP14-BS69]
 gi|149007115|ref|ZP_01830784.1| DNA-binding response regulator [Streptococcus pneumoniae SP18-BS74]
 gi|149012278|ref|ZP_01833347.1| DNA-binding response regulator [Streptococcus pneumoniae SP19-BS75]
 gi|149019219|ref|ZP_01834581.1| DNA-binding response regulator [Streptococcus pneumoniae SP23-BS72]
 gi|168484877|ref|ZP_02709822.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC1873-00]
 gi|168486549|ref|ZP_02711057.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC1087-00]
 gi|168489055|ref|ZP_02713254.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP195]
 gi|168491148|ref|ZP_02715291.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC0288-04]
 gi|168493149|ref|ZP_02717292.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC3059-06]
 gi|168577194|ref|ZP_02723003.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae MLV-016]
 gi|169832995|ref|YP_001694658.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus pneumoniae Hungary19A-6]
 gi|194397986|ref|YP_002037828.1| response regulator [Streptococcus pneumoniae G54]
 gi|221231922|ref|YP_002511074.1| response regulator protein [Streptococcus pneumoniae ATCC 700669]
 gi|225854693|ref|YP_002736205.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae JJA]
 gi|225856894|ref|YP_002738405.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae P1031]
 gi|225859008|ref|YP_002740518.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae 70585]
 gi|225860939|ref|YP_002742448.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae Taiwan19F-14]
 gi|237649929|ref|ZP_04524181.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CCRI 1974]
 gi|237822522|ref|ZP_04598367.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CCRI 1974M2]
 gi|298230882|ref|ZP_06964563.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae str. Canada
           MDR_19F]
 gi|298254363|ref|ZP_06977949.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae str. Canada
           MDR_19A]
 gi|298502777|ref|YP_003724717.1| DNA-binding response regulator [Streptococcus pneumoniae
           TCH8431/19A]
 gi|303254277|ref|ZP_07340386.1| response regulator protein [Streptococcus pneumoniae BS455]
 gi|303258862|ref|ZP_07344841.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP-BS293]
 gi|303261546|ref|ZP_07347493.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP14-BS292]
 gi|303264216|ref|ZP_07350136.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS397]
 gi|303266153|ref|ZP_07352046.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS457]
 gi|303268120|ref|ZP_07353920.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS458]
 gi|307067876|ref|YP_003876842.1| CheY-like receiver/winged-helix DNA-binding domain-containing
           response regulator [Streptococcus pneumoniae AP200]
 gi|307127185|ref|YP_003879216.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae 670-6B]
 gi|14193094|gb|AAK55817.1|AF219111_1 putative response regulator [Streptococcus pneumoniae]
 gi|5830523|emb|CAB54568.1| response regulator [Streptococcus pneumoniae]
 gi|14972708|gb|AAK75333.1| DNA-binding response regulator [Streptococcus pneumoniae TIGR4]
 gi|116076226|gb|ABJ53946.1| DNA-binding response regulator [Streptococcus pneumoniae D39]
 gi|147755494|gb|EDK62542.1| DNA-binding response regulator [Streptococcus pneumoniae SP11-BS70]
 gi|147759206|gb|EDK66199.1| DNA-binding response regulator [Streptococcus pneumoniae SP14-BS69]
 gi|147761419|gb|EDK68385.1| DNA-binding response regulator [Streptococcus pneumoniae SP18-BS74]
 gi|147763604|gb|EDK70539.1| DNA-binding response regulator [Streptococcus pneumoniae SP19-BS75]
 gi|147922567|gb|EDK73685.1| DNA-binding response regulator [Streptococcus pneumoniae SP3-BS71]
 gi|147925227|gb|EDK76306.1| DNA-binding response regulator [Streptococcus pneumoniae SP6-BS73]
 gi|147927662|gb|EDK78687.1| DNA-binding response regulator [Streptococcus pneumoniae SP9-BS68]
 gi|147931089|gb|EDK82068.1| DNA-binding response regulator [Streptococcus pneumoniae SP23-BS72]
 gi|168995497|gb|ACA36109.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae Hungary19A-6]
 gi|172041974|gb|EDT50020.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC1873-00]
 gi|183570421|gb|EDT90949.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC1087-00]
 gi|183572520|gb|EDT93048.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP195]
 gi|183574479|gb|EDT95007.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC0288-04]
 gi|183576730|gb|EDT97258.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae CDC3059-06]
 gi|183577211|gb|EDT97739.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae MLV-016]
 gi|194357653|gb|ACF56101.1| response regulator TCS02 [Streptococcus pneumoniae G54]
 gi|220674382|emb|CAR68932.1| response regulator protein [Streptococcus pneumoniae ATCC 700669]
 gi|225721755|gb|ACO17609.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae 70585]
 gi|225722501|gb|ACO18354.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae JJA]
 gi|225724998|gb|ACO20850.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae P1031]
 gi|225727250|gb|ACO23101.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae Taiwan19F-14]
 gi|298238372|gb|ADI69503.1| DNA-binding response regulator [Streptococcus pneumoniae
           TCH8431/19A]
 gi|301794310|emb|CBW36735.1| response regulator protein [Streptococcus pneumoniae INV104]
 gi|301800148|emb|CBW32753.1| response regulator protein [Streptococcus pneumoniae OXC141]
 gi|301801917|emb|CBW34641.1| response regulator protein [Streptococcus pneumoniae INV200]
 gi|302598771|gb|EFL65808.1| response regulator protein [Streptococcus pneumoniae BS455]
 gi|302637126|gb|EFL67614.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP14-BS292]
 gi|302639805|gb|EFL70261.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae SP-BS293]
 gi|302642337|gb|EFL72684.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS458]
 gi|302644323|gb|EFL74577.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS457]
 gi|302646028|gb|EFL76255.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae BS397]
 gi|306409413|gb|ADM84840.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Streptococcus
           pneumoniae AP200]
 gi|306484247|gb|ADM91116.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Streptococcus pneumoniae 670-6B]
 gi|332073565|gb|EGI84044.1| response regulator [Streptococcus pneumoniae GA17570]
 gi|332074837|gb|EGI85309.1| response regulator [Streptococcus pneumoniae GA41301]
 gi|332200675|gb|EGJ14747.1| response regulator [Streptococcus pneumoniae GA41317]
 gi|332201690|gb|EGJ15760.1| response regulator [Streptococcus pneumoniae GA47368]
 gi|332203075|gb|EGJ17143.1| response regulator [Streptococcus pneumoniae GA47901]
          Length = 234

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 52/122 (42%), Gaps = 2/122 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-QPDIIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KTIRKTSSVPILMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QK 122
            +
Sbjct: 119 SQ 120


>gi|297191203|ref|ZP_06908601.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
 gi|197718520|gb|EDY62428.1| two-component system response regulator [Streptomyces
           pristinaespiralis ATCC 25486]
          Length = 244

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 46/120 (38%), Gaps = 4/120 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M S+L+VD    V +V        GF V  A    +A         P+ +V+D  + G+ 
Sbjct: 12  MQSILVVDDDPTVAEVVTGYLERAGFAVDRAADGPQALRLA-AGRRPDLVVLDLMLPGMD 70

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R       V V  L    D +  I G   GA+ ++ KPF+   L   +  + 
Sbjct: 71  GLEVCRRLRAGEQ-ARVPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVL 129


>gi|306416863|gb|ADM87277.1| two-component system response regulator [Streptomyces subtropicus]
          Length = 267

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 28/116 (24%), Positives = 45/116 (38%), Gaps = 2/116 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V +V     +  G+ V +A     A         P+ +V+D  +  +  F
Sbjct: 19  RVLVVDDDPTVAEVVVGYLHRAGYAVEQADDGPAALGRFAAH-RPDLVVLDLMLPAMDGF 77

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
               R    G  V V  L    D E  I G   GA+ ++ KPF+   L   +  + 
Sbjct: 78  EVCRRMREHGP-VPVIMLTARGDEEDRILGLETGADDYVTKPFSPRELVLRVDSVL 132


>gi|152998395|ref|YP_001343230.1| two component transcriptional regulator [Marinomonas sp. MWYL1]
 gi|150839319|gb|ABR73295.1| two component transcriptional regulator, winged helix family
           [Marinomonas sp. MWYL1]
          Length = 236

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 23/132 (17%), Positives = 59/132 (44%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
             +L++D    +R++        G+   EA ++ +A E       P+ +++D  M G   
Sbjct: 9   KKVLIIDDESSIREMIAIALEMAGYEYLEAENIQQAHEIIVDH-RPDLILVDWMMPGGSG 67

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++     ++ V  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 68  IELTRRLKKDTTTAEIPVIMLTAKSEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 127

Query: 120 MQKSKDENQFLD 131
               +  ++ ++
Sbjct: 128 RATPQGVDEPIE 139


>gi|71907609|ref|YP_285196.1| osmolarity response regulator [Dechloromonas aromatica RCB]
 gi|71847230|gb|AAZ46726.1| Response regulator receiver:Transcriptional regulatory protein,
           C-terminal [Dechloromonas aromatica RCB]
          Length = 243

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 46/121 (38%), Gaps = 1/121 (0%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+VD    +R +      + GF V  A    +  +        + +V+D  M G     
Sbjct: 10  ILVVDDDARLRDLLVRYLGEQGFEVKAAADGQQ-MDKLRSREHYHLIVLDLMMPGEDGLT 68

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
              R    G    +  L  + D    I G   GA+ +L KPFN   L   +  + + Q S
Sbjct: 69  ICRRLRGQGDQTPIIMLTAKGDEVDRIVGLEMGADDYLPKPFNPRELLARIHAVLRRQGS 128

Query: 124 K 124
           K
Sbjct: 129 K 129


>gi|116493525|ref|YP_805260.1| DNA-binding response regulator [Pediococcus pentosaceus ATCC 25745]
 gi|116103675|gb|ABJ68818.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Pediococcus pentosaceus ATCC 25745]
          Length = 233

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 23/127 (18%), Positives = 53/127 (41%), Gaps = 2/127 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +   +  G+ V  A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MPKILVVDDEKPISDIVKFNLDKEGYDVVTAYDGEEALAQVEEEK-PDLILLDLMLPKID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 RQ+    ++ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-RQVRAKHNIPIIMVTAKDSELDKVVGLELGADDYVTKPFSNRELVARVKANLRR 118

Query: 121 QKSKDEN 127
           Q    ++
Sbjct: 119 QDQLQQD 125


>gi|319939370|ref|ZP_08013730.1| DNA-binding response regulator [Streptococcus anginosus 1_2_62CV]
 gi|319811356|gb|EFW07651.1| DNA-binding response regulator [Streptococcus anginosus 1_2_62CV]
          Length = 233

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 56/132 (42%), Gaps = 2/132 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E E  P+ L++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIIKFNMVKEGYEVVTAFDGREALEMFEAE-RPDILILDLMLPEMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R +   ++V +  L  +      + G   GA+ ++ KPF+   L+  ++ + + 
Sbjct: 60  GLEVA-RTIRKTSNVPIIVLSAKDSEFDKVIGLEIGADDYMTKPFSNRELQARVKAILRR 118

Query: 121 QKSKDENQFLDA 132
                ENQ  +A
Sbjct: 119 TDLTIENQEAEA 130


>gi|227358160|ref|ZP_03842501.1| phosphate regulon transcriptional regulator (two-component response
           regulator) [Proteus mirabilis ATCC 29906]
 gi|227161496|gb|EEI46533.1| phosphate regulon transcriptional regulator (two-component response
           regulator) [Proteus mirabilis ATCC 29906]
          Length = 229

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 54/121 (44%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A  F   +  P+ +++D  + G   
Sbjct: 3   RRILVVEDETAIREMICFVLEQNGFQPIEAEDYDTALSFLI-DPYPDLVLLDWMIPGGSG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              I  +++     D+ +  L  + + E  + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 62  IQVIKQMKREINTRDIPIIMLTAKGEEEDKVKGLETGADDYVIKPFSPKELVARVKAILR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|56965856|ref|YP_177590.1| two-component response regulator [Bacillus clausii KSM-K16]
 gi|56912102|dbj|BAD66630.1| two-component response regulator [Bacillus clausii KSM-K16]
          Length = 236

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      GF V  A    EA E   KE  P+ +++D  +     
Sbjct: 3   KHILVVDDEKSIADILKFNLEKEGFDVTCAYDGNEALERV-KERKPDLMLLDIMLPYKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ +++KPF+   L   ++   +
Sbjct: 62  MEVCREVRKQ---YDLPIIMLTAKDSEIDKVLGLELGADDYVIKPFSTRELLARVKANLR 118

Query: 120 MQKSKDEN 127
            Q+   ++
Sbjct: 119 RQQVAADD 126


>gi|226948317|ref|YP_002803408.1| DNA-binding response regulator [Clostridium botulinum A2 str.
           Kyoto]
 gi|226841453|gb|ACO84119.1| DNA-binding response regulator [Clostridium botulinum A2 str.
           Kyoto]
 gi|322805369|emb|CBZ02933.1| two-component response regulator [Clostridium botulinum H04402 065]
          Length = 233

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 55/125 (44%), Gaps = 9/125 (7%)

Query: 1   MD---SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME 57
           M     +L+VD    +  V +      G+ V  A    EA +   KE+  + +++D  + 
Sbjct: 1   MKEFFKILVVDDEERILDVVKAYLEKEGYEVITAMDGEEAIKLF-KEISFHLVILDLMLP 59

Query: 58  GVLE--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
            +      + +R+    ++V +  L  +V+ E  + G   GA+ +L KPF+   L   ++
Sbjct: 60  KISGEEVCSKIRE---FSNVPIIMLTAKVEEEDKLEGLSIGADDYLTKPFSVRELVARVK 116

Query: 116 ELPQM 120
            L + 
Sbjct: 117 ALIRR 121


>gi|197118248|ref|YP_002138675.1| winged-helix phosphate transcriptional response regulator
           [Geobacter bemidjiensis Bem]
 gi|197087608|gb|ACH38879.1| winged-helix phosphate transcriptional response regulator
           [Geobacter bemidjiensis Bem]
          Length = 226

 Score =  150 bits (381), Expect = 5e-35,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+++    + ++        G+    A    E  E  E+ + P+ +++D  + G+ 
Sbjct: 1   MQTVLIIEDEKDLAELLSFNLEREGYKTVIALDGAEGLEAVER-VQPDLILLDLMLPGMF 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  V++      + V  L  + +    + G   GA+ +++KPF+   L   ++ + 
Sbjct: 60  GTDVCKTVKKSEKSAHIPVVMLTAKGEEIDKVVGFEVGADDYVIKPFSTRELMLRVKAVL 119

Query: 119 QMQ 121
           + +
Sbjct: 120 RRK 122


>gi|167630424|ref|YP_001680923.1| response regulator receiver modulated serine phosphatase
           [Heliobacterium modesticaldum Ice1]
 gi|167593164|gb|ABZ84912.1| response regulator receiver modulated serine phosphatase
           [Heliobacterium modesticaldum Ice1]
          Length = 394

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 3/127 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+VD      ++ R      G+ V  A +  +A E  ++  LP+ +++D  M G+  F 
Sbjct: 12  ILVVDDVVTNVELMRLQLTRAGYQVLTAFNGEQALESIQR-TLPDLILLDVMMPGMNGFE 70

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
             A +++ P    + V  +    + E  I G  AGA+ F+ KPFNR  L   ++ L +++
Sbjct: 71  VCAKLKEDPHTQLIPVVLVTALHEVEDRIKGIEAGADDFISKPFNRVELLTRVKSLLRIR 130

Query: 122 KSKDENQ 128
           K   + +
Sbjct: 131 KLYRQLE 137


>gi|158317067|ref|YP_001509575.1| two component transcriptional regulator [Frankia sp. EAN1pec]
 gi|158112472|gb|ABW14669.1| two component transcriptional regulator, winged helix family
           [Frankia sp. EAN1pec]
          Length = 246

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 31/118 (26%), Positives = 48/118 (40%), Gaps = 1/118 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    VR+         G+ V  A     A E   ++  P+ +V+D  M  +   
Sbjct: 2   RVLVVDDDAAVRESLERSLRFEGYEVRTAPDGVAALEVVARD-QPDIVVLDVMMPRMDGL 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               R    G DV V  L         ++G   GA+ +L+KPF  E L   +R L + 
Sbjct: 61  ETCRRLRARGDDVPVLMLTARDGLADRVSGLDVGADDYLVKPFALEELFARLRALIRR 118


>gi|81300262|ref|YP_400470.1| two component transcriptional regulator [Synechococcus elongatus
           PCC 7942]
 gi|81169143|gb|ABB57483.1| two component transcriptional regulator, winged helix family
           [Synechococcus elongatus PCC 7942]
          Length = 244

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 28/127 (22%), Positives = 52/127 (40%), Gaps = 6/127 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++        G+ V  A    EA     +   P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLAMIGYEVVTAADGEEALITF-RNATPDLVVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRSVLRR 122

Query: 121 QKSKDEN 127
            +    N
Sbjct: 123 VEKSGAN 129


>gi|146297039|ref|YP_001180810.1| two component transcriptional regulator [Caldicellulosiruptor
           saccharolyticus DSM 8903]
 gi|145410615|gb|ABP67619.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor saccharolyticus DSM 8903]
          Length = 232

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 55/127 (43%), Gaps = 3/127 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M ++L+VD    + ++ +      G+  FEA +   A +   K    + +++D  M    
Sbjct: 1   MKNILIVDDEPHIVELIKFNLQKEGYNTFEAENGNTALDII-KNNKIDLVILDIMMSDKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E +  +R      ++ V  L  + +    I G   GA+ ++ KPF+ + L   ++ L 
Sbjct: 60  GYEVLKEIRFNKGTRNLPVILLSAKSEEIDRILGLELGADDYITKPFSVKELVARVKALF 119

Query: 119 QMQKSKD 125
           +  ++  
Sbjct: 120 RRIENLK 126


>gi|260775446|ref|ZP_05884343.1| chitin catabolic cascade sensor histidine kinase ChiS [Vibrio
           coralliilyticus ATCC BAA-450]
 gi|260608627|gb|EEX34792.1| chitin catabolic cascade sensor histidine kinase ChiS [Vibrio
           coralliilyticus ATCC BAA-450]
          Length = 1128

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 35/133 (26%), Positives = 55/133 (41%), Gaps = 6/133 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
           LL+VD   +  +V        G+ V  A +  EA E    E  P  +++D  M G+    
Sbjct: 724 LLVVDDEPVNLRVLDSFLRLEGYRVRTAKNGEEAVESVVHEK-PELMLLDIMMPGMSGYQ 782

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R+      + V  L      +  + G  AGAN +L KPFN++ L   +       
Sbjct: 783 VCEVLRKDYDHAQLPVIMLTALNQPDDRVRGFEAGANDYLSKPFNKQELAARITAHLTAS 842

Query: 122 KSKD---ENQFLD 131
           K++    ENQ L 
Sbjct: 843 KAEQRRIENQQLQ 855


>gi|219848942|ref|YP_002463375.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219543201|gb|ACL24939.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 247

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 57/123 (46%), Gaps = 2/123 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +    R      G  V  AT+  EA E   +E +P+ +++D  M  +  
Sbjct: 7   KLVLVVDDEPRMIAFMRMNLELEGMRVTTATNGREAVEKVREE-MPDIVLLDVMMPVMDG 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F   +R++   + V V  L  + + E  + G   GA+ ++ KPF++  L   +R + +  
Sbjct: 66  F-EALRRIRSFSQVPVIILTAKDEEEDRVRGLELGADDYVGKPFSQRELISRIRAVLRRH 124

Query: 122 KSK 124
            ++
Sbjct: 125 YTQ 127


>gi|332798939|ref|YP_004460438.1| winged helix family two component transcriptional regulator
           [Tepidanaerobacter sp. Re1]
 gi|332696674|gb|AEE91131.1| two component transcriptional regulator, winged helix family
           [Tepidanaerobacter sp. Re1]
          Length = 239

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 54/129 (41%), Gaps = 3/129 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
            ++L+VD    +R++ R      G+ V EA    EA      +  P  +++D  +     
Sbjct: 6   KAILVVDDEKNIRELVRFNLESRGYKVKEAMDGKEALSIARTDE-PLLIILDLMLPKIDG 64

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    ++  P    + +  L    D    I G   GA+ ++ KPF+   +   +R + +
Sbjct: 65  LEVCRILKGDPSTKKIPIIMLTALGDEIDKIVGLELGADDYITKPFSPREMVARVRAVIR 124

Query: 120 MQKSKDENQ 128
             + + + +
Sbjct: 125 RVEDRRKPE 133


>gi|320355079|ref|YP_004196418.1| response regulator receiver modulated diguanylate cyclase
           [Desulfobulbus propionicus DSM 2032]
 gi|320123581|gb|ADW19127.1| response regulator receiver modulated diguanylate cyclase
           [Desulfobulbus propionicus DSM 2032]
          Length = 326

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 33/142 (23%), Positives = 65/142 (45%), Gaps = 10/142 (7%)

Query: 1   MDS--------LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVI 52
           M          +L+VD + +V K+   +    G+ V +A S  +A      + LP+ +++
Sbjct: 4   MKKKEKTTDASILIVDDNPVVIKLLHAMLARAGYQVVQAASGQQALALLASDCLPDLILL 63

Query: 53  DESMEG--VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
           D  M G   LE    +++ P   D+ V ++    D E ++ G  AGA  +++KP  +E L
Sbjct: 64  DIDMPGVSGLEACRLIKENPRTADIPVIFVTASNDKEHIVNGFAAGAQDYIIKPSTQEEL 123

Query: 111 RFAMRELPQMQKSKDENQFLDA 132
              +R    + +++   +   A
Sbjct: 124 LARVRTHLALCRTQQALKASRA 145


>gi|291572094|dbj|BAI94366.1| two-component response regulator [Arthrospira platensis NIES-39]
          Length = 378

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 33/137 (24%), Positives = 59/137 (43%), Gaps = 7/137 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M  +L++D   I+R++ +      G+ V  A++  E  E   KEL P  ++ D  M    
Sbjct: 1   MFKILVIDDDTIIRELLKRTLKKQGYDVVVASNGEEGIEKA-KELRPALMICDWIMPRLT 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E    V+ MP  +    + L      +  + G  AGA+ FL KP     L   +R   
Sbjct: 60  GIEVCRQVKAMPELSTTQFFLLTSLTAVDDRVKGLDAGADDFLSKPIEMNELYARVRAGL 119

Query: 119 QMQK----SKDENQFLD 131
           ++ +     + + Q L+
Sbjct: 120 RLHQLSQDLQTQKQLLE 136


>gi|163731855|ref|ZP_02139302.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter litoralis Och 149]
 gi|161395309|gb|EDQ19631.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter litoralis Och 149]
          Length = 230

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 26/130 (20%), Positives = 53/130 (40%), Gaps = 3/130 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+V+     R+V  +     GF V  A +  EA      E  P+ +V+D  M     +E
Sbjct: 9   VLVVEDESAQREVLTYNLEAEGFAVSRAENGEEAM-MLVDETAPDLIVLDWMMPNLSGIE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++  P    + +  L    +    + G   GA+ +++KP++   L   +R   +  
Sbjct: 68  VCRRLKSKPETRAIPIIMLSARSEEVDRVRGLETGADDYVIKPYSVVELMARVRSQLRRV 127

Query: 122 KSKDENQFLD 131
           +     + L+
Sbjct: 128 RPAATGERLE 137


>gi|160942928|ref|ZP_02090167.1| hypothetical protein FAEPRAM212_00405 [Faecalibacterium prausnitzii
           M21/2]
 gi|158445829|gb|EDP22832.1| hypothetical protein FAEPRAM212_00405 [Faecalibacterium prausnitzii
           M21/2]
 gi|295103906|emb|CBL01450.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Faecalibacterium
           prausnitzii SL3/3]
          Length = 228

 Score =  150 bits (381), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 22/120 (18%), Positives = 45/120 (37%), Gaps = 1/120 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++        G++  EA     A          + +++D  M  + 
Sbjct: 1   MAKILIVDDEPRIRELIHEHLQYAGYICEEAGDGSAALAQL-SGGGFDLVILDLMMPFMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                        +  V  L    +    +AG  +GA+ +++KPF+   L   +R +   
Sbjct: 60  GMTCLREMRARHINTPVIILTARGEEYDKLAGLESGADDYVVKPFSPRELVARVRAVLNR 119


>gi|117617627|ref|YP_854723.1| transcriptional regulatory protein CpxR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
 gi|117559034|gb|ABK35982.1| transcriptional regulatory protein CpxR [Aeromonas hydrophila
           subsp. hydrophila ATCC 7966]
          Length = 231

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 31/128 (24%), Positives = 51/128 (39%), Gaps = 2/128 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +LLVD    + ++   +    GF V  A    E  +    E   N +++D  M  + 
Sbjct: 1   MHKILLVDDDLELTQLLTEILTLEGFQVTVAEDGEEGLQLL-AEQHFNLVLLDVMMPKLN 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F    R      D  V  L    D +  + G  AGA+ +L KPF+   L   +R + + 
Sbjct: 60  GFAMLARLR-KTHDTPVLMLTARGDSQDRVNGLEAGADDYLAKPFDDRELLARVRAILRR 118

Query: 121 QKSKDENQ 128
            +S    +
Sbjct: 119 TQSTQPQR 126


>gi|78484886|ref|YP_390811.1| two component transcriptional regulator [Thiomicrospira crunogena
           XCL-2]
 gi|78363172|gb|ABB41137.1| two component transcriptional regulator, winged helix family
           [Thiomicrospira crunogena XCL-2]
          Length = 230

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 22/124 (17%), Positives = 51/124 (41%), Gaps = 3/124 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+V+    +R +         + V EA +  +  +    E  P+ +++D  + G   + 
Sbjct: 6   ILVVEDEAAIRDMLSFTLTAANYKVIEAPNAEQGWKLLL-EHQPDCVLLDWMLPGVSGIS 64

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +RQ        +  L    +    + G  +GA+ +++KPF+   L   ++ L + Q
Sbjct: 65  LAQRIRQNDQTATTPIIMLTARGEENDQVQGFESGADDYVVKPFSPRALVARVKALLRRQ 124

Query: 122 KSKD 125
             + 
Sbjct: 125 SPEK 128


>gi|229160351|ref|ZP_04288349.1| Two-component response regulator [Bacillus cereus R309803]
 gi|228623075|gb|EEK79903.1| Two-component response regulator [Bacillus cereus R309803]
          Length = 218

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 61/129 (47%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA    E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALTKLESDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|326202264|ref|ZP_08192133.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
 gi|325987382|gb|EGD48209.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
          Length = 232

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 46/119 (38%), Gaps = 2/119 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +  + +      G+   EA    EA      +  P+ +++D  +  +  
Sbjct: 3   KKILIVDDEKNIVDILKFNLKKEGYDTIEAYDGEEAVNLALSQN-PDLILLDIMLPKMDG 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           F    R++       +  L  + +    + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 62  FTVC-RKLRQSISTPILMLTAKEEEVDKVLGLELGADDYITKPFSPRELMARVKANLRR 119


>gi|209523935|ref|ZP_03272487.1| response regulator receiver modulated serine phosphatase
           [Arthrospira maxima CS-328]
 gi|209495607|gb|EDZ95910.1| response regulator receiver modulated serine phosphatase
           [Arthrospira maxima CS-328]
          Length = 394

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 33/137 (24%), Positives = 59/137 (43%), Gaps = 7/137 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M  +L++D   I+R++ +      G+ V  A++  E  E   KEL P  ++ D  M    
Sbjct: 17  MFKILVIDDDTIIRELLKRTLKKQGYDVVVASNGEEGIEKA-KELRPALMICDWIMPRLT 75

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E    V+ MP  +    + L      +  + G  AGA+ FL KP     L   +R   
Sbjct: 76  GIEVCRQVKAMPELSTTQFFLLTSLTAVDDRVKGLDAGADDFLSKPIEMNELYARVRAGL 135

Query: 119 QMQK----SKDENQFLD 131
           ++ +     + + Q L+
Sbjct: 136 RLHQLSQDLQTQKQLLE 152


>gi|322376761|ref|ZP_08051254.1| DNA-binding response regulator VicR [Streptococcus sp. M334]
 gi|321282568|gb|EFX59575.1| DNA-binding response regulator VicR [Streptococcus sp. M334]
          Length = 234

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 51/122 (41%), Gaps = 2/122 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-QPDIIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KTIRKTSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QK 122
             
Sbjct: 119 SH 120


>gi|315221424|ref|ZP_07863345.1| response regulator receiver domain protein [Streptococcus anginosus
           F0211]
 gi|315189543|gb|EFU23237.1| response regulator receiver domain protein [Streptococcus anginosus
           F0211]
          Length = 233

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 56/132 (42%), Gaps = 2/132 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA E  E E  P+ L++D  +  + 
Sbjct: 1   MKKILVVDDEKPISDIIKFNMVKEGYEVVTAFDGREALEMFEAE-RPDILILDLMLPEMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R +   ++V +  L  +      + G   GA+ ++ KPF+   L+  ++ + + 
Sbjct: 60  GLEVA-RTIRKTSNVPIIVLSAKDSEFDKVIGLEIGADDYMTKPFSNRELQARVKAILRR 118

Query: 121 QKSKDENQFLDA 132
                ENQ  +A
Sbjct: 119 TDLTIENQEAEA 130


>gi|21230432|ref|NP_636349.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66769574|ref|YP_244336.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|188992783|ref|YP_001904793.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. B100]
 gi|21111993|gb|AAM40273.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. ATCC 33913]
 gi|66574906|gb|AAY50316.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris str. 8004]
 gi|167734543|emb|CAP52753.1| two-component system regulatory protein [Xanthomonas campestris pv.
           campestris]
          Length = 229

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 54/128 (42%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R +         F    A    EA +    + +P+ +++D  + G   
Sbjct: 3   KRILIVDDEPAIRDMVAFALRKGEFEPIHAGDAREA-QTAIADRVPDLILLDWMLPGTSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+     R+  L  ++ +  L    +    + G  AG + +++KPF+   L   +R + +
Sbjct: 62  LDLARRWRKESLTREIPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMR 121

Query: 120 MQKSKDEN 127
             +  DE+
Sbjct: 122 RTREDDED 129


>gi|326201972|ref|ZP_08191842.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
 gi|325987767|gb|EGD48593.1| two component transcriptional regulator, winged helix family
           [Clostridium papyrosolvens DSM 2782]
          Length = 228

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 55/125 (44%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + ++        G+ V  A +   A +  + +  P+ +V+D  + G+   
Sbjct: 6   KVLIVDDDRNICELIGLYLEKEGYEVLYAYNGLNAVDTFKIQT-PSLVVLDIMLPGIDGW 64

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R++     + +  L  + +    + G   GA+ +++KPF  + L   ++ + + 
Sbjct: 65  QVCREIRKVSS---IPIIMLTAKGETFDKVLGLELGADDYMVKPFEPKELVARVKAVLRR 121

Query: 121 QKSKD 125
            + K+
Sbjct: 122 YEHKE 126


>gi|284031362|ref|YP_003381293.1| winged helix family two component transcriptional regulator
           [Kribbella flavida DSM 17836]
 gi|283810655|gb|ADB32494.1| two component transcriptional regulator, winged helix family
           [Kribbella flavida DSM 17836]
          Length = 244

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 1/123 (0%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           LL+VD    + ++        G+ V  A    EA     +E+ P+ +V+D  M G+  F 
Sbjct: 16  LLVVDDEPNIVELLSASLRFAGYDVTTAAHGTEALRKA-REVEPDLVVLDVMMPGLDGFE 74

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQKS 123
              R       V V +L      E  + G + G + ++ KPF+ + L   +R L +    
Sbjct: 75  VVRRLRGEDRHVPVLFLTARDAVEDKVLGLQTGGDDYVTKPFSLDELVARVRALLRRSGH 134

Query: 124 KDE 126
           +++
Sbjct: 135 REQ 137


>gi|296111034|ref|YP_003621415.1| response regulator [Leuconostoc kimchii IMSNU 11154]
 gi|295832565|gb|ADG40446.1| response regulator [Leuconostoc kimchii IMSNU 11154]
          Length = 237

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 55/128 (42%), Gaps = 2/128 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A    EA     +E  P+ +++D+ +  + 
Sbjct: 1   MSKILVVDDEKPISDIIKFNLTKEGYEVITAADGQEALTIFNEEK-PDLVLLDQMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ+   ++  V  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GV-EVLRQIRSKSETPVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANLRS 118

Query: 121 QKSKDENQ 128
           +K+  + Q
Sbjct: 119 RKAVAQAQ 126


>gi|229032233|ref|ZP_04188206.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1271]
 gi|228729013|gb|EEL80016.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1271]
          Length = 239

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 50/129 (38%), Gaps = 5/129 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  +        GF V  A     A +    E  P+ +++D  +  +  
Sbjct: 3   NRILVVDDEEFILTLIEFNLQQAGFEVITAMDGEMALQKATTE-RPDLIILDLMLPKMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R   +     +  L  + D    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  MEVCKELRLQRVM--TPILMLTAKDDEFDKVLGLELGADDYMTKPFSPREVVARVKAILR 119

Query: 120 MQKSKDENQ 128
             K + E Q
Sbjct: 120 RTKLQQEEQ 128


>gi|187778876|ref|ZP_02995349.1| hypothetical protein CLOSPO_02471 [Clostridium sporogenes ATCC
           15579]
 gi|187772501|gb|EDU36303.1| hypothetical protein CLOSPO_02471 [Clostridium sporogenes ATCC
           15579]
          Length = 232

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 19/123 (15%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M+ +L+VD    + ++ +    + G+    A +  +A     KE  P+ +++D  + G+ 
Sbjct: 3   MEKILIVDDEEHICELIKFNLENNGYECICALNGIDALNIV-KEEKPDLVLLDLMLPGMD 61

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+        +  +  + +    + G   GA+ ++ KPF+   +   ++ + 
Sbjct: 62  GYDVCKEIRKDNNIATTSIIMITAKGEELDKVLGLELGADDYITKPFSVREMVARVKAVL 121

Query: 119 QMQ 121
           + +
Sbjct: 122 RRR 124


>gi|332982066|ref|YP_004463507.1| winged helix family two component transcriptional regulator
           [Mahella australiensis 50-1 BON]
 gi|332699744|gb|AEE96685.1| two component transcriptional regulator, winged helix family
           [Mahella australiensis 50-1 BON]
          Length = 228

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 23/123 (18%), Positives = 52/123 (42%), Gaps = 6/123 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L++D    + ++    F   GF V  A +  E          PN +++D  + G    
Sbjct: 6   KILIIDDDKNICQLLNLYFTKEGFEVDIANNGKEGMSHF-SNNPPNIVILDIMLPGKDGW 64

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+M   +D+ +  L  + +    + G   GA+ +++KPF+ + L   ++ + + 
Sbjct: 65  DICREIRRM---SDIPIIMLTAKSETFDKVLGLELGADDYVVKPFDPKELIARVKAVLRR 121

Query: 121 QKS 123
              
Sbjct: 122 YNQ 124


>gi|315127525|ref|YP_004069528.1| transcriptional regulator [Pseudoalteromonas sp. SM9913]
 gi|315016039|gb|ADT69377.1| transcriptional regulator [Pseudoalteromonas sp. SM9913]
          Length = 229

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 51/132 (38%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RKVLVVDDEAPIREMLVFVLEQNGFQAIEAEDYDSAIAAMV-EPYPDMVLLDWMLPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                  +Q      + +  L    + E  I G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQIAKKFKQNEHTRQIPIIMLTARGEEEDKIRGLEVGADDYVTKPFSPKELMARIKAVIR 121

Query: 120 MQKSKDENQFLD 131
                   + ++
Sbjct: 122 RVAPTSLEEAIE 133


>gi|229593403|ref|YP_002875522.1| phosphate regulon two-component system response regulator
           [Pseudomonas fluorescens SBW25]
 gi|312963904|ref|ZP_07778375.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas fluorescens WH6]
 gi|229365269|emb|CAY53596.1| phosphate regulon two-component system, response regulator
           [Pseudomonas fluorescens SBW25]
 gi|311281939|gb|EFQ60549.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas fluorescens WH6]
          Length = 229

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCLEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|225868178|ref|YP_002744126.1| response regulator protein [Streptococcus equi subsp.
           zooepidemicus]
 gi|225701454|emb|CAW98586.1| response regulator protein [Streptococcus equi subsp.
           zooepidemicus]
          Length = 236

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+    A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDTVTAFDGKEAVAVFEEEK-PDLIILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|119503823|ref|ZP_01625905.1| two-component response regulator PhoB [marine gamma proteobacterium
           HTCC2080]
 gi|119460331|gb|EAW41424.1| two-component response regulator PhoB [marine gamma proteobacterium
           HTCC2080]
          Length = 234

 Score =  150 bits (380), Expect = 6e-35,   Method: Composition-based stats.
 Identities = 30/132 (22%), Positives = 61/132 (46%), Gaps = 3/132 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
           M  +L+VD    +R + R      GF V EA    +A  +   +  P+ +++D  + G  
Sbjct: 1   MKKILVVDDEPDLRDMLRFALETEGFEVLEAADTQKAY-WLITDQDPDLVLLDWMLPGGS 59

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E ++ +++      + V  +  +   E +I G   GA+ ++ KPF+ + L   +R + 
Sbjct: 60  GIELLSRLKKEEATQSLPVIMVTAKAREEDIIQGLDMGAHDYITKPFSLKELLARIRTIF 119

Query: 119 QMQKSKDENQFL 130
           +  +  D N  L
Sbjct: 120 RHTEDDDVNHQL 131


>gi|159037489|ref|YP_001536742.1| response regulator receiver modulated diguanylate cyclase
           [Salinispora arenicola CNS-205]
 gi|157916324|gb|ABV97751.1| response regulator receiver modulated diguanylate cyclase
           [Salinispora arenicola CNS-205]
          Length = 326

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 30/125 (24%), Positives = 49/125 (39%), Gaps = 3/125 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLE 61
           +L+VD    + +         G+ V  A    EA E    +  P+  V+D  M     LE
Sbjct: 11  ILVVDDDEDIARFVEFNLRLHGYEVIHARDGQEALE-VIAQHRPDLAVVDLMMPRVDGLE 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R  P+   + V  L  +      + G  AGA+ +L+KPF+   L   +    +  
Sbjct: 70  LTRRLRADPMTAALPVIMLTAKGMTVDKVHGLSAGADDYLVKPFDTAELVARVSSTLRRN 129

Query: 122 KSKDE 126
           K   E
Sbjct: 130 KEFRE 134


>gi|322391842|ref|ZP_08065307.1| DNA-binding response regulator [Streptococcus peroris ATCC 700780]
 gi|321145322|gb|EFX40718.1| DNA-binding response regulator [Streptococcus peroris ATCC 700780]
          Length = 234

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 59/138 (42%), Gaps = 7/138 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAEK-PDIIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KTIRKTSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QKS-----KDENQFLDAI 133
            +      ++E+  L ++
Sbjct: 119 TELIAVDNQEEDSKLQSL 136


>gi|308188627|ref|YP_003932758.1| Transcriptional regulatory protein srrA [Pantoea vagans C9-1]
 gi|308059137|gb|ADO11309.1| Transcriptional regulatory protein srrA [Pantoea vagans C9-1]
          Length = 232

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 52/131 (39%), Gaps = 7/131 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M+ +LLVD    +  + + L    GF V  A+   +A      +   + L++D  M    
Sbjct: 1   MNKILLVDDDRELTSLLKELLEMEGFEVVVASDGEQALNLL--DNSIDLLLLDVMMPKKN 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++ +  +RQ        V  L         + G   GA+ +L KPFN   L   +R + 
Sbjct: 59  GIDTLKELRQQ---HQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAIL 115

Query: 119 QMQKSKDENQF 129
           +     ++ Q 
Sbjct: 116 RRSNWSEQQQQ 126


>gi|220929311|ref|YP_002506220.1| transcriptional regulator [Clostridium cellulolyticum H10]
 gi|219999639|gb|ACL76240.1| two component transcriptional regulator, winged helix family
           [Clostridium cellulolyticum H10]
          Length = 228

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 55/125 (44%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + ++        G+ V  A +   A +  + +  P+ +V+D  + G+   
Sbjct: 6   KVLIVDDDRNICELIGLYLEKEGYEVLYAYNGLNAVDTFKIQT-PSLVVLDIMLPGIDGW 64

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R++     + +  L  + +    + G   GA+ +++KPF  + L   ++ + + 
Sbjct: 65  QVCREIRKVSS---IPIIMLTAKGETFDKVLGLELGADDYMVKPFEPKELVARVKAVLRR 121

Query: 121 QKSKD 125
            + K+
Sbjct: 122 YEYKE 126


>gi|73541850|ref|YP_296370.1| phosphate regulon transcriptional regulatory protein phoB
           [Ralstonia eutropha JMP134]
 gi|72119263|gb|AAZ61526.1| Phosphate regulon transcriptional regulatory protein phoB
           [Ralstonia eutropha JMP134]
          Length = 235

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           S+L+V+    + ++        G     A +  +A      ++LP+ +++D  + G    
Sbjct: 4   SILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLM-SDVLPDLVLLDWMLPGKSGA 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F   +R       + +  L    + +  + G  AGA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  TFAKELRANDRTKQIPIIMLTARSEEQDKVMGLEAGADDYVTKPFSPKELLARIKAVLRR 122

Query: 121 QKSK 124
           +  +
Sbjct: 123 RAPQ 126


>gi|33239646|ref|NP_874588.1| two-component response regulator [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
 gi|33237171|gb|AAP99240.1| Two-component response regulator [Prochlorococcus marinus subsp.
           marinus str. CCMP1375]
          Length = 242

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LLVD    +R   +   ND GF V  A    +  +   K+ +P+ ++ D  M      
Sbjct: 16  RILLVDDEPGIRTAVQAYLNDEGFDVLTAIDGEDGLQKA-KQFMPDVVITDVMMPQCDGY 74

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E +  +R+        V +L  +        G +AG + ++ KPF+ + L   ++ + + 
Sbjct: 75  ELLRQLREDERLGGTPVIFLTAKGMTIDRTQGYQAGVDDYIPKPFDPDELVARVKNVVKR 134

Query: 121 QK 122
           Q+
Sbjct: 135 QE 136


>gi|116749733|ref|YP_846420.1| response regulator receiver protein [Syntrophobacter fumaroxidans
           MPOB]
 gi|116698797|gb|ABK17985.1| response regulator receiver protein [Syntrophobacter fumaroxidans
           MPOB]
          Length = 227

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 65/129 (50%), Gaps = 3/129 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD      +V  ++    G+ +  ATS  +A +    +   + +++D  M  +  F
Sbjct: 10  NILIVDDISKNIQVLGNILRRDGYSLSFATSGTQALDMVFADDY-DLILLDVMMPEMDGF 68

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R++P G  + + +L  + D E ++ G +AG   ++ KPFN E L   +    ++
Sbjct: 69  EVCRKIRELPDGQAIPIIFLTAKTDEEDIVKGFQAGGTDYVTKPFNSEELLARVHAHLEL 128

Query: 121 QKSKDENQF 129
           ++++DE Q 
Sbjct: 129 KRARDEIQL 137


>gi|325298032|ref|YP_004257949.1| histidine kinase [Bacteroides salanitronis DSM 18170]
 gi|324317585|gb|ADY35476.1| histidine kinase [Bacteroides salanitronis DSM 18170]
          Length = 1336

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 53/127 (41%), Gaps = 4/127 (3%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE-- 61
            LL+VD +   R   RH      + V  A++  EA     +EL P+ ++ D  M G+    
Sbjct: 1088 LLVVDDNEDFRLFMRHSLELQ-YRVEVASNGQEALSKI-QELQPDLVISDVMMPGMDGNE 1145

Query: 62   FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                ++       + V  L      E  + G   GA+ ++ KPFN   L   +R+L ++ 
Sbjct: 1146 LCRLIKGDKRTAHIPVILLTARQAVESKVKGLETGADDYVTKPFNMTVLVLRIRKLIELS 1205

Query: 122  KSKDENQ 128
            +     Q
Sbjct: 1206 RYHRSAQ 1212


>gi|311069407|ref|YP_003974330.1| two-component response regulator [Bacillus atrophaeus 1942]
 gi|310869924|gb|ADP33399.1| two-component response regulator [Bacillus atrophaeus 1942]
          Length = 240

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 53/126 (42%), Gaps = 5/126 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + ++     G+ V  A+   EA +  E E  P+ +V+D  +     
Sbjct: 3   KKILVVDDEESIVTLLQYNLERSGYEVVTASDGEEALKQAETEK-PDLIVLDLMLPKLDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +RQ  L     +  L  + +    + G   GA+ ++ KPF+   +   ++ + +
Sbjct: 62  IEVCKQLRQQKLMF--PILMLTAKDEEFDKVLGLELGADDYMTKPFSPREVNARVKAILR 119

Query: 120 MQKSKD 125
             +   
Sbjct: 120 RSEIAS 125


>gi|296453514|ref|YP_003660657.1| winged helix family two component transcriptional regulator
           [Bifidobacterium longum subsp. longum JDM301]
 gi|296182945|gb|ADG99826.1| two component transcriptional regulator, winged helix family
           [Bifidobacterium longum subsp. longum JDM301]
          Length = 256

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 23  MARILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGID 81

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 82  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVM 138

Query: 119 QMQKSKDE 126
           +  ++  +
Sbjct: 139 RRNQATAQ 146


>gi|21241807|ref|NP_641389.1| two-component system regulatory protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|78046628|ref|YP_362803.1| two-component system regulatory protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325926361|ref|ZP_08187691.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas perforans 91-118]
 gi|325927126|ref|ZP_08188393.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas perforans 91-118]
 gi|21107184|gb|AAM35925.1| two-component system regulatory protein [Xanthomonas axonopodis pv.
           citri str. 306]
 gi|78035058|emb|CAJ22703.1| two-component system regulatory protein [Xanthomonas campestris pv.
           vesicatoria str. 85-10]
 gi|325542509|gb|EGD13984.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas perforans 91-118]
 gi|325543254|gb|EGD14687.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas perforans 91-118]
          Length = 229

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 54/128 (42%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R +         F    A    EA +    + +P+ +++D  + G   
Sbjct: 3   KRILIVDDEPAIRDMVAFALRKGEFEPIHAGDAREA-QTAIADRVPDLILLDWMLPGTSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+     R+  L  ++ +  L    +    + G  AG + +++KPF+   L   +R + +
Sbjct: 62  LDLARRWRKEQLTREIPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMR 121

Query: 120 MQKSKDEN 127
             +  DE+
Sbjct: 122 RTREDDED 129


>gi|297564623|ref|YP_003683595.1| winged helix family two component transcriptional regulator
           [Meiothermus silvanus DSM 9946]
 gi|296849072|gb|ADH62087.1| two component transcriptional regulator, winged helix family
           [Meiothermus silvanus DSM 9946]
          Length = 221

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 51/127 (40%), Gaps = 3/127 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +LLVD    +R+V        G+ V EA    EA          + +V+D  +  + 
Sbjct: 1   MARVLLVDDDPAIREVLSAYLRQEGYEVVEAADGLEALGKI---PQASLVVLDLMLPRLS 57

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            +           ++ V  L  + + E+ I G   GA+ ++ KPF+   +   +R L + 
Sbjct: 58  GWEVARELRRDYPELPVLMLTAKGEEEERIRGLDLGADDYVTKPFSPREVVARVRALLRR 117

Query: 121 QKSKDEN 127
              K E 
Sbjct: 118 SGLKAEL 124


>gi|251781983|ref|YP_002996285.1| two-component response regulator [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
 gi|242390612|dbj|BAH81071.1| two-component response regulator [Streptococcus dysgalactiae subsp.
           equisimilis GGS_124]
          Length = 236

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ +  A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK-PDLIILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + V +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|260587419|ref|ZP_05853332.1| DNA-binding response regulator ResD [Blautia hansenii DSM 20583]
 gi|331083699|ref|ZP_08332810.1| hypothetical protein HMPREF0992_01734 [Lachnospiraceae bacterium
           6_1_63FAA]
 gi|260542286|gb|EEX22855.1| DNA-binding response regulator ResD [Blautia hansenii DSM 20583]
 gi|330403910|gb|EGG83462.1| hypothetical protein HMPREF0992_01734 [Lachnospiraceae bacterium
           6_1_63FAA]
          Length = 234

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 20/123 (16%), Positives = 49/123 (39%), Gaps = 6/123 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD  + + ++         F          A         PN +++D  + G+  
Sbjct: 5   QKILIVDDDNNIAELISLYLTKECFDTHIVNDGEAALNAF-SSFAPNLILLDLMLPGMDG 63

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +RQ    ++V +  L  + +    + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 64  YQVCREIRQK---SNVPIIMLSAKGEIFDKVLGLELGADDYIIKPFDSKELVARVKAVLR 120

Query: 120 MQK 122
             +
Sbjct: 121 RYQ 123


>gi|91774844|ref|YP_544600.1| two component transcriptional regulator [Methylobacillus
           flagellatus KT]
 gi|91708831|gb|ABE48759.1| two component transcriptional regulator, winged helix family
           [Methylobacillus flagellatus KT]
          Length = 228

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 60/131 (45%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           ++L+V+    ++++        G     A SV +A +   +E LP+ +++D  + G+  +
Sbjct: 4   NILVVEDEPAIQELLALNLTQAGHNPVRALSVEQA-QMLIREALPDLILLDWMLPGMSGI 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           EF   ++   L   + +  L    +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  EFARKLKSDELTKAIPIIMLTARGEEADKVRGLEVGADDYVTKPFSPRELNARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
           +  +  +  L+
Sbjct: 123 RAPQMTDDPLE 133


>gi|300854423|ref|YP_003779407.1| putative transcriptional regulator [Clostridium ljungdahlii DSM
           13528]
 gi|300434538|gb|ADK14305.1| predicted transcriptional regulator [Clostridium ljungdahlii DSM
           13528]
          Length = 231

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 52/124 (41%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + ++ +      G+    A +  +A +   KE +P  +++D  + G+   
Sbjct: 5   KILIVDDEEHICELIKFNLEKNGYKTIVAGNGIDALKIV-KEEMPQLILLDVMLPGMDGY 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    + + V  +    +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 64  DVCKEIRRDNAISFIPVIMITARGEEFDKVLGLELGADDYMTKPFSIRELVARVKAVLRR 123

Query: 121 QKSK 124
              K
Sbjct: 124 TALK 127


>gi|298482083|ref|ZP_07000271.1| two-component system sensor histidine kinase/response regulator,
            hybrid (one-component system) [Bacteroides sp. D22]
 gi|298271640|gb|EFI13213.1| two-component system sensor histidine kinase/response regulator,
            hybrid (one-component system) [Bacteroides sp. D22]
          Length = 1458

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 62/134 (46%), Gaps = 7/134 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+L+V+ +  ++   +++ +   + V  A++  E  +    + LP+ ++ D  M  +   
Sbjct: 1200 SILVVEDNEELKAFLKNILS-ENYTVITASNGEEGLQHAV-DDLPDLIISDVMMPVMDGL 1257

Query: 63   --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              I  +++      + +  L  +   +  IAG   G + ++ KPF+   L+  +  L + 
Sbjct: 1258 EMIRQIKENNNICHIPIIVLSAKASLDDRIAGLEQGIDDYITKPFSATYLKTRIASLLRQ 1317

Query: 121  QKSKDE---NQFLD 131
            +K+  E   N+ ++
Sbjct: 1318 RKALQEIYMNRLME 1331


>gi|213691278|ref|YP_002321864.1| two component transcriptional regulator, winged helix family
           [Bifidobacterium longum subsp. infantis ATCC 15697]
 gi|213522739|gb|ACJ51486.1| two component transcriptional regulator, winged helix family
           [Bifidobacterium longum subsp. infantis ATCC 15697]
 gi|320457342|dbj|BAJ67963.1| two-component response regulator [Bifidobacterium longum subsp.
           infantis ATCC 15697]
          Length = 256

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 23  MARILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGID 81

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 82  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVM 138

Query: 119 QMQKSKDE 126
           +  ++  +
Sbjct: 139 RRNQATAQ 146


>gi|187735605|ref|YP_001877717.1| two component transcriptional regulator, winged helix family
           [Akkermansia muciniphila ATCC BAA-835]
 gi|187425657|gb|ACD04936.1| two component transcriptional regulator, winged helix family
           [Akkermansia muciniphila ATCC BAA-835]
          Length = 234

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+ +  H +  +  +     G     A     A E   ++  P  +++D+ M G+ 
Sbjct: 1   MATILIAEDDHAISDLVAYNLERAGHTPLAAYDGLTALEVARRDK-PELILLDQMMPGMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
               +  +R+     ++ V +L  +   E  I G   GA+ ++ KPF+ + L   +  + 
Sbjct: 60  GHGVLRELRRDSRTQNIPVIFLTAKAQAEDRIQGLELGADDYVTKPFSPKELVLRVASVL 119

Query: 119 QM 120
           + 
Sbjct: 120 KR 121


>gi|153873132|ref|ZP_02001814.1| signal transduction histidine kinase [Beggiatoa sp. PS]
 gi|152070402|gb|EDN68186.1| signal transduction histidine kinase [Beggiatoa sp. PS]
          Length = 480

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 34/124 (27%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD     R+  + L     + +  A S  EA      EL+P+ +++D  M G+  F
Sbjct: 6   RLLIVDDEKRGREALKILLASENYQLILAASGEEALLKAP-ELVPDLILLDVMMPGMDGF 64

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               H+R  P   +V +  L    D +  + G  AGA+ F++KPF+R  L   +R + ++
Sbjct: 65  EVCQHIRAHPQLGEVPIIMLTAMSDRKTRLRGIEAGADDFIIKPFDRVELLARVRTIIRL 124

Query: 121 QKSK 124
            + +
Sbjct: 125 NRYR 128


>gi|257455895|ref|ZP_05621112.1| osmolarity response regulator [Enhydrobacter aerosaccus SK60]
 gi|257446641|gb|EEV21667.1| osmolarity response regulator [Enhydrobacter aerosaccus SK60]
          Length = 257

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 52/120 (43%), Gaps = 1/120 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R + +    D G++V  A    +  +   +  L + +V+D  +     
Sbjct: 23  QRILVVDDDARLRTLLQRFLEDDGYIVRTAHDGSQ-MDKLMQRELFSLIVLDLMLPNEDG 81

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R     +D+ +  L  +      IAG  AGA+ +L KPFN + L   ++ + + Q
Sbjct: 82  ISICHRLRAENSDIPIIMLTAKGSDADRIAGLEAGADDYLPKPFNPKELLARIKAVLRRQ 141


>gi|86606539|ref|YP_475302.1| DNA-binding response regulator RpaA [Synechococcus sp. JA-3-3Ab]
 gi|86555081|gb|ABD00039.1| DNA-binding response regulator RpaA [Synechococcus sp. JA-3-3Ab]
          Length = 251

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+++    +  + R      G+ V +AT      +    ++LP+ +++D  +  V 
Sbjct: 1   MARILIIEDDPSILDILRINLELAGYEVVKATDGVRG-QALALQVLPDLIILDLMLPQVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+    +++ +  L      +  I G  AGA+ +L KPF  + L   +R L 
Sbjct: 60  GLTVCQRLRREERTSEIPILMLTALGQTQDKIEGFNAGADDYLTKPFEVQELLVRVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|82703349|ref|YP_412915.1| two component transcriptional regulator [Nitrosospira multiformis
           ATCC 25196]
 gi|82411414|gb|ABB75523.1| two component transcriptional regulator, winged helix family
           [Nitrosospira multiformis ATCC 25196]
          Length = 234

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 21/131 (16%), Positives = 57/131 (43%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+V+    ++++  +        V    +  EA +      LP+ +++D  + G+   
Sbjct: 4   TILVVEDEPAIQELISYSLRQAKHTVSSTKNAEEAMKII-NHTLPDLVLLDWMLPGMSGA 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F   +R+     D+ +  L    D    + G  +GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DFARMLRRAARTKDIPIIMLTARADESDKVTGLESGADDYITKPFSPRELLARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
           +  +  +  ++
Sbjct: 123 RAPEAADDVVE 133


>gi|77463153|ref|YP_352657.1| phosphate regulon transcriptional regulator, PhoR [Rhodobacter
           sphaeroides 2.4.1]
 gi|126462025|ref|YP_001043139.1| two component transcriptional regulator [Rhodobacter sphaeroides
           ATCC 17029]
 gi|221639010|ref|YP_002525272.1| winged helix family two component transcriptional regulator
           [Rhodobacter sphaeroides KD131]
 gi|332558027|ref|ZP_08412349.1| Two component transcriptional regulator, winged helix family
           protein [Rhodobacter sphaeroides WS8N]
 gi|77387571|gb|ABA78756.1| Phosphate regulon transcriptional regulator, PhoR [Rhodobacter
           sphaeroides 2.4.1]
 gi|126103689|gb|ABN76367.1| two component transcriptional regulator, winged helix family
           [Rhodobacter sphaeroides ATCC 17029]
 gi|221159791|gb|ACM00771.1| Two component transcriptional regulator, winged helix family
           [Rhodobacter sphaeroides KD131]
 gi|332275739|gb|EGJ21054.1| Two component transcriptional regulator, winged helix family
           protein [Rhodobacter sphaeroides WS8N]
          Length = 230

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +LLV+     R+V  +     GF V +A +  EA     +E  P+ +V+D  +     +E
Sbjct: 9   VLLVEDEPAQREVLSYNLESEGFRVVQAGNGDEAL-MLVEEAGPDVIVLDWMLPSVSGIE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++  P    V +  L    +    + G   GA+ +++KP++   L   +R   +  
Sbjct: 68  VCRQLKSRPSTRSVPIIMLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRSQLRRA 127

Query: 122 K 122
           +
Sbjct: 128 R 128


>gi|22298696|ref|NP_681943.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22294876|dbj|BAC08705.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 391

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 34/135 (25%), Positives = 56/135 (41%), Gaps = 7/135 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLE 61
           +L++D     R + R    D G+ V  A+   E       E  P  ++ D  M     LE
Sbjct: 10  ILVIDDDPTTRLLLRKTLRDLGYSVSVASHGREGIAIATAEK-PALIICDWMMPELDGLE 68

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM- 120
              H++Q    +  F   L  + + +  I G  AGA+ FL KP +   LR  ++   ++ 
Sbjct: 69  VCRHIKQDEELSRSFFILLTAKGELQDRIQGLDAGADEFLSKPIDPNELRARIQAGLRLY 128

Query: 121 ---QKSKDENQFLDA 132
              Q    + Q L+A
Sbjct: 129 QLSQDLLKQKQLLEA 143


>gi|95930319|ref|ZP_01313056.1| multi-sensor hybrid histidine kinase [Desulfuromonas acetoxidans
           DSM 684]
 gi|95133571|gb|EAT15233.1| multi-sensor hybrid histidine kinase [Desulfuromonas acetoxidans
           DSM 684]
          Length = 1152

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 33/134 (24%), Positives = 62/134 (46%), Gaps = 6/134 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
           S+L+VD   +  +V  +  +   + V  A S  +A +  E+E  P+ +++D  M  +   
Sbjct: 718 SILVVDDEPVNLQVLVNQLHVARYRVRIANSGQQALDLVEEET-PDLILLDIMMPHMTGY 776

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+      + V  L        ++ G +AGAN ++ KPF+R+ L   +R   Q+
Sbjct: 777 EVCQRLRRTYNAAQLPVIMLTARSRVSDVVQGFQAGANDYVAKPFSRDILLARVRTQLQL 836

Query: 121 QKS---KDENQFLD 131
            ++     EN  L 
Sbjct: 837 GRAYQTLAENMRLK 850


>gi|326797358|ref|YP_004315178.1| PhoB family transcriptional regulator [Marinomonas mediterranea
           MMB-1]
 gi|326548122|gb|ADZ93342.1| two component transcriptional regulator PhoB, winged helix family
           [Marinomonas mediterranea MMB-1]
          Length = 231

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 22/132 (16%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
             +L++D    +R++        G+   EA +     E       P+ +++D  M G   
Sbjct: 4   KKVLIIDDEAPIREMIAVALEMAGYEYLEAENAQHGHEIIVDH-RPDLILVDWMMPGGSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++     ++ V  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELTRRLKKDSTTAEIPVIMLTAKSEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 MQKSKDENQFLD 131
               +  ++ ++
Sbjct: 123 RATPQGVDEPIE 134


>gi|194290067|ref|YP_002005974.1| DNA-binding response regulator in two-component regulatory system
           with phor [Cupriavidus taiwanensis LMG 19424]
 gi|193223902|emb|CAQ69911.1| DNA-binding response regulator in two-component regulatory system
           with PhoR [Cupriavidus taiwanensis LMG 19424]
          Length = 235

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           S+L+V+    + ++        G     A +  +A      ++LP+ +++D  + G    
Sbjct: 4   SILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLM-SDVLPDLVLLDWMLPGKSGA 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F   +R       + +  L    + +  + G  AGA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  NFAKELRANDRTRQIPIIMLTARGEEQDKVMGLEAGADDYVTKPFSPKELLARIKAVLRR 122

Query: 121 QKSK 124
           +  +
Sbjct: 123 RAPQ 126


>gi|158320115|ref|YP_001512622.1| two component, sigma54 specific, Fis family transcriptional
           regulator [Alkaliphilus oremlandii OhILAs]
 gi|158140314|gb|ABW18626.1| two component, sigma54 specific, transcriptional regulator, Fis
           family [Alkaliphilus oremlandii OhILAs]
          Length = 451

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 28/131 (21%), Positives = 58/131 (44%), Gaps = 1/131 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L++D    +R   +      G+ ++EA +  +  E  E E+ P+ +++D  M  +  
Sbjct: 3   KRILIIDDEKNMRWAIKKALEKEGYNIYEAENGQDGLEKLE-EIYPDLILLDLRMPVMDG 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
             A  R   +  D+ V  L      E  +   + GA  ++ KPF+ E L+  +++   + 
Sbjct: 62  MEALQRIKEINQDIPVIMLTAHGTMESAVEAMKLGALDYISKPFDIEELKVLIKKALNVG 121

Query: 122 KSKDENQFLDA 132
           + K E  +L  
Sbjct: 122 ELKSEVNYLRE 132


>gi|310288067|ref|YP_003939326.1| Two-component response regulator regX [Bifidobacterium bifidum S17]
 gi|309252004|gb|ADO53752.1| Two-component response regulator regX [Bifidobacterium bifidum S17]
          Length = 234

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 50/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A S  E  E   K    + +++D  + G+ 
Sbjct: 1   MTRILIVEDEESYREPLVYQLTREGYDVSAAASGEEGLELFTKGG-IDLVLLDLMLPGID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVL 116

Query: 119 QMQKSKDE 126
           +  +   E
Sbjct: 117 RRNQGAVE 124


>gi|326387442|ref|ZP_08209051.1| two component transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
 gi|326208098|gb|EGD58906.1| two component transcriptional regulator [Novosphingobium
           nitrogenifigens DSM 19370]
          Length = 229

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 50/122 (40%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            LLLV+    + ++  + F   G+ V       EA      E  P+ +++D  + G   +
Sbjct: 5   KLLLVEDDTALAELVEYRFRGEGYDVRTTADGDEAL-LLAAEDTPDLVLLDWMIGGTSGI 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+      V +  L    D +  + G   GA+ ++ KPF+   L   +  + + 
Sbjct: 64  EVCRRLRRQKATAHVPIIMLTARSDEDDRVRGLETGADDYVTKPFSPRELIARVGAVLRR 123

Query: 121 QK 122
            +
Sbjct: 124 VR 125


>gi|320161338|ref|YP_004174562.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
 gi|319995191|dbj|BAJ63962.1| OmpR family two-component response regulator [Anaerolinea
           thermophila UNI-1]
          Length = 239

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 28/134 (20%), Positives = 55/134 (41%), Gaps = 3/134 (2%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M   +L+VD    + +  +       F V  A +  EA +   +E  P+ +V+D  M G+
Sbjct: 1   MKPKVLIVDDDPTLLRFLQDFLRAEAFEVLAANNGHEALKLAYQEH-PDLVVLDVMMPGM 59

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             +    R     +D+ +  L  +   +  + G + G + +L KPF+   L   +R +  
Sbjct: 60  DGWEVCSRLHE-LSDIPIILLTAKTSEQDKLRGFQLGVDDYLTKPFSFAELAARIRAILA 118

Query: 120 MQKSKDENQFLDAI 133
             +     Q  + I
Sbjct: 119 RAQRSLPAQRKNQI 132


>gi|94311118|ref|YP_584328.1| two component transcriptional regulator [Cupriavidus metallidurans
           CH34]
 gi|93354970|gb|ABF09059.1| DNA-binding response regulator in two-component regulatory system
           with PhoR (or CreC) [Cupriavidus metallidurans CH34]
          Length = 235

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           S+L+V+    + ++        G     A +  +A      ++LP+ +++D  + G    
Sbjct: 4   SILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLM-SDVLPDLVLLDWMLPGKSGA 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F   +R       + +  L    + +  + G  AGA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  TFAKELRNNDRTKQIPIIMLTARSEEQDKVMGLEAGADDYVTKPFSPKELLARIKAVLRR 122

Query: 121 QKSK 124
           +  +
Sbjct: 123 RAPQ 126


>gi|228913968|ref|ZP_04077592.1| Two-component response regulator [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
 gi|228926429|ref|ZP_04089501.1| Two-component response regulator [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228932679|ref|ZP_04095553.1| Two-component response regulator [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228944997|ref|ZP_04107358.1| Two-component response regulator [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|229090352|ref|ZP_04221595.1| Two-component response regulator [Bacillus cereus Rock3-42]
 gi|229120938|ref|ZP_04250180.1| Two-component response regulator [Bacillus cereus 95/8201]
 gi|229172038|ref|ZP_04299603.1| Two-component response regulator [Bacillus cereus MM3]
 gi|229183591|ref|ZP_04310814.1| Two-component response regulator [Bacillus cereus BGSC 6E1]
 gi|228599834|gb|EEK57431.1| Two-component response regulator [Bacillus cereus BGSC 6E1]
 gi|228611381|gb|EEK68638.1| Two-component response regulator [Bacillus cereus MM3]
 gi|228662598|gb|EEL18196.1| Two-component response regulator [Bacillus cereus 95/8201]
 gi|228692935|gb|EEL46653.1| Two-component response regulator [Bacillus cereus Rock3-42]
 gi|228814666|gb|EEM60926.1| Two-component response regulator [Bacillus thuringiensis serovar
           monterrey BGSC 4AJ1]
 gi|228826997|gb|EEM72757.1| Two-component response regulator [Bacillus thuringiensis serovar
           andalousiensis BGSC 4AW1]
 gi|228833253|gb|EEM78818.1| Two-component response regulator [Bacillus thuringiensis serovar
           pondicheriensis BGSC 4BA1]
 gi|228845690|gb|EEM90717.1| Two-component response regulator [Bacillus thuringiensis serovar
           pulsiensis BGSC 4CC1]
          Length = 218

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|165870463|ref|ZP_02215118.1| DNA-binding response regulator [Bacillus anthracis str. A0488]
 gi|190568741|ref|ZP_03021645.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I]
 gi|164713958|gb|EDR19480.1| DNA-binding response regulator [Bacillus anthracis str. A0488]
 gi|190560157|gb|EDV14138.1| DNA-binding response regulator [Bacillus anthracis Tsiankovskii-I]
          Length = 218

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|148654376|ref|YP_001274581.1| two component transcriptional regulator [Roseiflexus sp. RS-1]
 gi|148566486|gb|ABQ88631.1| two component transcriptional regulator, winged helix family
           [Roseiflexus sp. RS-1]
          Length = 243

 Score =  150 bits (380), Expect = 7e-35,   Method: Composition-based stats.
 Identities = 30/120 (25%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +    R      G  V  A++  EA E    E +P+ +++D  M  +  
Sbjct: 7   KLILVVDDEPRMVNFMRMNLELEGCRVISASNGREALEKVRDE-MPDVVLLDIMMPVMDG 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F   +R++   + V V  L  + D E  I G   GA+ ++ KPF+   L   +R + +  
Sbjct: 66  F-ETLRRLRQASSVPVLVLTAKDDEEDRIKGLELGADDYIGKPFSHRELVSRIRAVLRRH 124


>gi|332968660|gb|EGK07713.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Psychrobacter sp. 1501(2011)]
          Length = 240

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 19/130 (14%), Positives = 49/130 (37%), Gaps = 5/130 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFC-EKELLPNYLVIDESMEGVL 60
             +L+++    + ++         + V  A +  E  +    KE   + +++D  +  + 
Sbjct: 3   KQILIIEDDPDLAELISDYLTMNYYEVHHAPTGQEGLDILDAKERAIDLIILDLMLPDMD 62

Query: 61  E--FIAHVR--QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
                  +R  +      V +  L  + D    + G   GA+ ++ KPF    L   +R 
Sbjct: 63  GMQVCQKIRGGKNTQTNKVPIVMLTAKGDTTDRVLGLEMGADDYIAKPFEPRELLARIRA 122

Query: 117 LPQMQKSKDE 126
           + +  +  ++
Sbjct: 123 VLRRHEQPNQ 132


>gi|325922699|ref|ZP_08184439.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas gardneri ATCC 19865]
 gi|325546816|gb|EGD17930.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas gardneri ATCC 19865]
          Length = 229

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 54/128 (42%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R +         F    A    EA +    + +P+ +++D  + G   
Sbjct: 3   KRILIVDDEPAIRDMVAFALRKGEFEPIHAGDAREA-QTAIADRVPDLILLDWMLPGTSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+     R+  L  ++ +  L    +    + G  AG + +++KPF+   L   +R + +
Sbjct: 62  LDLARRWRKESLTREIPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMR 121

Query: 120 MQKSKDEN 127
             +  DE+
Sbjct: 122 RTREDDED 129


>gi|218289692|ref|ZP_03493900.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius LAA1]
 gi|218240149|gb|EED07333.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius LAA1]
          Length = 239

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 56/128 (43%), Gaps = 1/128 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKE-LLPNYLVIDESMEGV 59
           M ++L+VD    +R +  + F+  GF V        A E  ++     + +V+D  + G+
Sbjct: 1   MPTVLVVDDEASIRTLVEYNFSRSGFDVETVDDGRVAYEKLKQGASKYDLVVLDLMLPGM 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                  R    G  + +  L    +   ++ G   GA+ ++ KPF+   L    R + +
Sbjct: 61  DGLEVCRRLRQEGVKIPIILLTARDEEVDLVLGLELGADDYVTKPFSPRELVARARAVLR 120

Query: 120 MQKSKDEN 127
             +S++++
Sbjct: 121 RTESREDD 128


>gi|153868898|ref|ZP_01998627.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
 gi|152074527|gb|EDN71372.1| two-component hybrid sensor and regulator [Beggiatoa sp. PS]
          Length = 378

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 48/131 (36%), Gaps = 5/131 (3%)

Query: 1   MD--SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG 58
           M   ++L+VD      +V   + +  G+ V  A +  +A         P+ +++D  M  
Sbjct: 1   MKPETILVVDDLADNLRVLIGILSQQGYKVRPARNGQQALLMARTSP-PDLILLDIMMPE 59

Query: 59  VLE--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
           +        ++       + + ++    +    I     GA  ++ KPF  E +   +  
Sbjct: 60  MDGYEVCQQLKADQKTHHIPIIFISALNEVLDKIKAFSLGAVDYITKPFQAEEVLARVET 119

Query: 117 LPQMQKSKDEN 127
             ++ +   E 
Sbjct: 120 HLKLHRLHHEL 130


>gi|126736258|ref|ZP_01752000.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. CCS2]
 gi|126714079|gb|EBA10948.1| phosphate regulon transcriptional regulatory protein PhoB
           [Roseobacter sp. CCS2]
          Length = 228

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 53/129 (41%), Gaps = 3/129 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+V+     R+V  +     GF V  A +  E    C +E  P+ +V+D  M     +E
Sbjct: 7   VLIVEDEAAQREVLAYNLEAEGFRVTRAENGDEGL-LCVEENAPDVIVLDWMMPNLSGIE 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++  P    + +  L    +    + G   GA+ +++KP++   L   +R   +  
Sbjct: 66  VCRRLKIKPETRSIPIIMLSARSEEVDKVRGLETGADDYVVKPYSVSELMARVRTQLRRV 125

Query: 122 KSKDENQFL 130
           +     Q L
Sbjct: 126 RPATVGQVL 134


>gi|125974309|ref|YP_001038219.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum ATCC 27405]
 gi|256003472|ref|ZP_05428462.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum DSM 2360]
 gi|281418364|ref|ZP_06249384.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum JW20]
 gi|125714534|gb|ABN53026.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum ATCC 27405]
 gi|255992496|gb|EEU02588.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum DSM 2360]
 gi|281409766|gb|EFB40024.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum JW20]
 gi|316941457|gb|ADU75491.1| response regulator receiver modulated diguanylate cyclase
           [Clostridium thermocellum DSM 1313]
          Length = 310

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 53/121 (43%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L++D +  + K+   +  + G+ V  A++  +  E    E  P+ +++D  M  +  
Sbjct: 4   KKILVIDDTEFMTKLISDVLMNEGYEVVTASNGRQGIEMVRIEK-PDLVLLDVVMPDMDG 62

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R+      + +  L  + + +  + G   GA+ ++ KPFN   L   +R   +
Sbjct: 63  FEVCRILREDEGNNLMPIIMLTAQDNEDDKLTGLELGADDYITKPFNTRELVSRVRNTLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|317968139|ref|ZP_07969529.1| two component LuxR family transcriptional regulator [Synechococcus
           sp. CB0205]
          Length = 243

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 29/122 (23%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            LLLVD    +R   +    D GF+V  A    +      +ELLP+ ++ D  M      
Sbjct: 18  RLLLVDDEPGLRTAVQAYLEDEGFVVTTAVDGEDGWAKA-QELLPDVVISDVMMPRLDGY 76

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+        V +L  +      I G +AG + ++ KPF+ + L   +  + + 
Sbjct: 77  GLLRKLREDERLGGTPVIFLTAKGMTADRIEGFQAGCDDYIPKPFDPDELVARVHNVVKR 136

Query: 121 QK 122
           Q+
Sbjct: 137 QE 138


>gi|317121455|ref|YP_004101458.1| transcriptional regulator [Thermaerobacter marianensis DSM 12885]
 gi|315591435|gb|ADU50731.1| two component transcriptional regulator, winged helix family
           [Thermaerobacter marianensis DSM 12885]
          Length = 326

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 28/120 (23%), Positives = 49/120 (40%), Gaps = 2/120 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +LLVD    + K  R      GF V  AT   +A E        + +++D  +  +   
Sbjct: 4   RILLVDDEAALVKGLRRSLEQAGFEVEVATDGRQALERFAAGG-IDLIILDLMLPEIDGL 62

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R++   + V +  L    +    I G   GA+ +++KPFN   L   +R + +  K
Sbjct: 63  TVC-REVRKTSQVPIIMLTARDEDVDRIVGLELGADDYVVKPFNPRELIARIRAVLRRVK 121


>gi|121595458|ref|YP_987354.1| osmolarity response regulator [Acidovorax sp. JS42]
 gi|222111672|ref|YP_002553936.1| osmolarity response regulator [Acidovorax ebreus TPSY]
 gi|120607538|gb|ABM43278.1| two component transcriptional regulator, winged helix family
           [Acidovorax sp. JS42]
 gi|221731116|gb|ACM33936.1| two component transcriptional regulator, winged helix family
           [Acidovorax ebreus TPSY]
          Length = 243

 Score =  150 bits (380), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 44/123 (35%), Gaps = 1/123 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R + R      GF V  A     A          + +V+D  M G    
Sbjct: 10  KVLVVDDDARIRDLLRRYLTQEGFEVMVAEDGK-ALNRILLRETVDLIVLDLMMPGEDGL 68

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R         +  L  + +    I G   GA+ +L KPFN   L   +  + + + 
Sbjct: 69  SICRRLRAANDRTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARIHAVLRRRP 128

Query: 123 SKD 125
            ++
Sbjct: 129 PQE 131


>gi|332968994|gb|EGK08036.1| phosphate regulon transcriptional regulatory protein PhoB
           [Psychrobacter sp. 1501(2011)]
          Length = 232

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 21/133 (15%), Positives = 58/133 (43%), Gaps = 4/133 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG---V 59
           ++L+V+    +R++        GF   +A  V +A         P  +++D  + G    
Sbjct: 5   TILVVEDEPAIREMIVTTLEMSGFECLQAEDVNDAHNQVVDH-RPAMILLDWMLPGNQSG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           ++    +++  + +++ +  L    + +  + G  AGA+ ++ KPF+   L   ++ + +
Sbjct: 64  IDLCRRLKKDEMLSEIPIIMLTARGEEDNKVQGLDAGADDYITKPFSTRELVSRIKAVLR 123

Query: 120 MQKSKDENQFLDA 132
                   + ++A
Sbjct: 124 RSSVLSGEKPIEA 136


>gi|315605707|ref|ZP_07880740.1| DNA-binding response regulator [Actinomyces sp. oral taxon 180 str.
           F0310]
 gi|315312662|gb|EFU60746.1| DNA-binding response regulator [Actinomyces sp. oral taxon 180 str.
           F0310]
          Length = 234

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 49/126 (38%), Gaps = 1/126 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD   ++  +        G+    A+   +A         P+ +++D  M  +   
Sbjct: 10  RVLVVDDEAMLADLLSQALRHEGWETATASDGLDALAKA-ASFHPDVVILDVQMPRMDGL 68

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R       + V +L         ++G RAGA+ ++ KPF+ + +   ++ L +   
Sbjct: 69  ETLERLRAHDPHMPVLFLTARDAVADRVSGLRAGADDYVTKPFDLDEVAARVQALLRRSG 128

Query: 123 SKDENQ 128
              + +
Sbjct: 129 RAQQTR 134


>gi|71064707|ref|YP_263434.1| osmolarity response regulator [Psychrobacter arcticus 273-4]
 gi|93004966|ref|YP_579403.1| osmolarity response regulator [Psychrobacter cryohalolentis K5]
 gi|71037692|gb|AAZ18000.1| transcriptional regulatory protein, OmpR [Psychrobacter arcticus
           273-4]
 gi|92392644|gb|ABE73919.1| two component transcriptional regulator, winged helix family
           [Psychrobacter cryohalolentis K5]
          Length = 254

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 53/123 (43%), Gaps = 1/123 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R + +    D GF+V  A    +  +   +  L + +V+D  + G   
Sbjct: 12  QRILVVDDDARLRSLLQRFLEDDGFVVRTAHDGSQ-MDKLLQRELFSLVVLDLMLPGEDG 70

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R      D+ +  L  +      IAG  AGA+ +L KPFN + L   ++ + + Q
Sbjct: 71  ISICKRLREDNGDIPIIMLTAKGGDADRIAGLEAGADDYLPKPFNPKELLARIKAVLRRQ 130

Query: 122 KSK 124
             +
Sbjct: 131 NRE 133


>gi|258404600|ref|YP_003197342.1| two component transcriptional regulator, winged helix family
           [Desulfohalobium retbaense DSM 5692]
 gi|257796827|gb|ACV67764.1| two component transcriptional regulator, winged helix family
           [Desulfohalobium retbaense DSM 5692]
          Length = 230

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 57/130 (43%), Gaps = 3/130 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++LLV+    +  + R  F + GF V  A +  +A +      + + +V+D  + G   L
Sbjct: 5   TVLLVEDEVDILNLLRINFENGGFRVLTAENGFQALDVLSSAPV-DLVVLDLMLPGKDGL 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R       + V  L  + D    I G   GA+ +++KPF+   L    + + + 
Sbjct: 64  EVCRELRSRESTKHLPVIMLTAKGDEVDRIVGLELGADDYVVKPFSPRELLLRAKAVMRR 123

Query: 121 QKSKDENQFL 130
            K + E + L
Sbjct: 124 GKPQPEEETL 133


>gi|195978501|ref|YP_002123745.1| TCS response regulator VicR [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225870885|ref|YP_002746832.1| response regulator protein [Streptococcus equi subsp. equi 4047]
 gi|195975206|gb|ACG62732.1| TCS response regulator VicR [Streptococcus equi subsp.
           zooepidemicus MGCS10565]
 gi|225700289|emb|CAW94550.1| response regulator protein [Streptococcus equi subsp. equi 4047]
          Length = 236

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+    A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDTVTAFDGKEAVAVFEEEK-PDLIILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|78044944|ref|YP_360245.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
 gi|77997059|gb|ABB15958.1| DNA-binding response regulator [Carboxydothermus hydrogenoformans
           Z-2901]
          Length = 228

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 56/128 (43%), Gaps = 2/128 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++LLVD    +R+V R      GF+V EA    EA +    E   + +++D  +  + 
Sbjct: 1   MKTILLVDDEEKIREVLRLYLEKEGFLVLEAQDGKEALKRF-SEHKIDLIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + V +  L    +    I G   GA+ +++KPF+   +   ++ + + 
Sbjct: 60  GM-EIAKEIRKTSLVPIIMLTARGEEIDKILGLEIGADDYVVKPFSPREVVARVKAVLRR 118

Query: 121 QKSKDENQ 128
                E +
Sbjct: 119 SSGIPEKE 126


>gi|78067197|ref|YP_369966.1| two component transcriptional regulator [Burkholderia sp. 383]
 gi|77967942|gb|ABB09322.1| two component transcriptional regulator, winged helix family
           [Burkholderia sp. 383]
          Length = 280

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 31/124 (25%), Positives = 51/124 (41%), Gaps = 2/124 (1%)

Query: 1   MDS-LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M + +L+VD    +R + R      G  V          E   +   P+ +V+D  M GV
Sbjct: 40  MTTQILIVDDDQELRDLLRDYLVRQGMEVSVLHDAAT-LEKRLERERPDLIVLDLMMPGV 98

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
               A  +    G D+ V  L    D    I G   GA+ +L KPFN   L   ++ + +
Sbjct: 99  DGLTALRQLRAAGDDIPVIMLTARADDVDRIVGLELGADDYLGKPFNPRELLARVQAVLR 158

Query: 120 MQKS 123
            +++
Sbjct: 159 RRRA 162


>gi|319892476|ref|YP_004149351.1| DNA-binding response regulator ResD [Staphylococcus
           pseudintermedius HKU10-03]
 gi|317162172|gb|ADV05715.1| DNA-binding response regulator ResD [Staphylococcus
           pseudintermedius HKU10-03]
 gi|323464421|gb|ADX76574.1| transcriptional regulatory protein SrrA [Staphylococcus
           pseudintermedius ED99]
          Length = 241

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 59/129 (45%), Gaps = 3/129 (2%)

Query: 1   MDS-LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M + +L+VD  H +RK+ +      G+++ EA+   EA +   K    + +++D  +  +
Sbjct: 2   MTNEILVVDDEHRIRKLLKLYLEREGYVIAEASDGREALDMATK-YDYSCILLDLMLPEM 60

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 V+      D  +  L  + +    + G  +GA+ +++KPF+   +   ++ L +
Sbjct: 61  DGLEVAVKLRE-LKDTPIIMLTAKGEENNRVEGFESGADDYIVKPFSPREVVLRVKALLR 119

Query: 120 MQKSKDENQ 128
             +S    Q
Sbjct: 120 RTESSKAEQ 128


>gi|288905747|ref|YP_003430969.1| essential two-component response regulator [Streptococcus
           gallolyticus UCN34]
 gi|306831845|ref|ZP_07465001.1| response regulator [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|325978780|ref|YP_004288496.1| two-component response regulator [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
 gi|288732473|emb|CBI14045.1| conserved essential two-component response regulator [Streptococcus
           gallolyticus UCN34]
 gi|304426043|gb|EFM29159.1| response regulator [Streptococcus gallolyticus subsp. gallolyticus
           TX20005]
 gi|325178708|emb|CBZ48752.1| two-component response regulator [Streptococcus gallolyticus subsp.
           gallolyticus ATCC BAA-2069]
          Length = 236

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+    A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYETVTAFDGREAITKFEEED-PDLIILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEVRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TENIE 123


>gi|163785470|ref|ZP_02180068.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Hydrogenivirga sp. 128-5-R1-1]
 gi|159879260|gb|EDP73166.1| Response regulator containing a CheY-like receiver domain and an
           HD-GYP domain [Hydrogenivirga sp. 128-5-R1-1]
          Length = 311

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 27/125 (21%), Positives = 55/125 (44%), Gaps = 3/125 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD     R + + +    G+   EA +  E  +   +E  P+ +++D  M  +  F
Sbjct: 8   KILIVDDDERNRLLFKVILKKEGYETTEAENGEEGIKKALEEK-PDVILMDVMMPVMDGF 66

Query: 63  I--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++       + V  L    + E+ + G  +GAN FL KP + + L   ++   Q+
Sbjct: 67  TATKKLKSDDRTKHIPVIILTALNEREEKLKGIESGANDFLTKPVDTKELLLRIKNHLQI 126

Query: 121 QKSKD 125
           +  +D
Sbjct: 127 KAYQD 131


>gi|86607748|ref|YP_476510.1| DNA-binding response regulator RpaA [Synechococcus sp.
           JA-2-3B'a(2-13)]
 gi|86556290|gb|ABD01247.1| DNA-binding response regulator RpaA [Synechococcus sp.
           JA-2-3B'a(2-13)]
          Length = 250

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+++    +  + R      G+ V +AT      +    ++LP+ +++D  +  V 
Sbjct: 1   MARILIIEDDPSILDILRINLELAGYEVVKATDGVRG-QALALQVLPDLIILDLMLPQVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+    +++ +  L      +  I G  AGA+ +L KPF  + L   +R L 
Sbjct: 60  GLTVCQRLRREERTSEIPILMLTALGQTQDKIEGFNAGADDYLTKPFEVQELLVRVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|129159|sp|P28835|YCF27_PORAE RecName: Full=Probable transcriptional regulator ycf27; AltName:
           Full=OmpR-like protein
 gi|14153|emb|CAA44464.1| regulatory protein [Porphyridium aerugineum]
          Length = 240

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 30/130 (23%), Positives = 55/130 (42%), Gaps = 6/130 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L++D    +R++     +  G+ V  A    EA    ++E  PN +V+D  M      
Sbjct: 5   KILVIDDEASIRRILETRLSIIGYDVISAADGEEALSIFKREH-PNLVVLDLMMPKLDGY 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 64  GVCQELRKE---SDVPIIMLTALSDVSDRITGLELGADDYIVKPFSPKELEARIRSVLRR 120

Query: 121 QKSKDENQFL 130
                 N  L
Sbjct: 121 VDKASSNNNL 130


>gi|228964356|ref|ZP_04125473.1| Two-component response regulator [Bacillus thuringiensis serovar
           sotto str. T04001]
 gi|228795340|gb|EEM42830.1| Two-component response regulator [Bacillus thuringiensis serovar
           sotto str. T04001]
          Length = 218

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|227514133|ref|ZP_03944182.1| DNA-binding response regulator [Lactobacillus fermentum ATCC 14931]
 gi|227087504|gb|EEI22816.1| DNA-binding response regulator [Lactobacillus fermentum ATCC 14931]
          Length = 245

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 48/122 (39%), Gaps = 2/122 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +  + +      G+ V  A    EA +  E E  P+ +V+D  +  +  
Sbjct: 13  KKVLVVDDEKPISDIIKFNLEKEGYEVVVAYDGEEALQKVESES-PDLIVLDLMLPKIDG 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                +Q+       +  +  +      + G   GA+ ++ KPF+   L   ++   + Q
Sbjct: 72  LEVA-KQVRAKRSTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRRQ 130

Query: 122 KS 123
            +
Sbjct: 131 DA 132


>gi|20808060|ref|NP_623231.1| response regulator [Thermoanaerobacter tengcongensis MB4]
 gi|254478788|ref|ZP_05092156.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
 gi|20516641|gb|AAM24835.1| Response regulators consisting of a CheY-like receiver domain and a
           HTH DNA-binding domain [Thermoanaerobacter tengcongensis
           MB4]
 gi|214035300|gb|EEB76006.1| response regulator receiver domain protein [Carboxydibrachium
           pacificum DSM 12653]
          Length = 240

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 18/123 (14%), Positives = 53/123 (43%), Gaps = 3/123 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+++    + ++ R+     G+ V  + +  E  E   +E  P+ L++D  +  +   
Sbjct: 4   TVLVIEDEIHILELLRYNLEAAGYKVMASENGKEGLEKALEEK-PDLLILDLMLPDMDGL 62

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++     ++ +  L    +    + G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  EICKVLKKNEDTKNIPIIMLTARSEEFDKVLGLELGADDYITKPFSVRELLARIKAVLRR 122

Query: 121 QKS 123
            + 
Sbjct: 123 TQQ 125


>gi|330718004|ref|ZP_08312604.1| DNA-binding response regulator [Leuconostoc fallax KCTC 3537]
          Length = 235

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 52/129 (40%), Gaps = 6/129 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  + +      G+ V  A    EA      E  P+ +++D+ +    
Sbjct: 1   MSKILVVDDEKPISDIIKFNLTKEGYDVITAADGKEALSLYSDES-PDLVLLDQMLPEVD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E +  +R      D  V  +  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GIEVLRQIRSND---DTPVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANL 116

Query: 119 QMQKSKDEN 127
           + QK   +N
Sbjct: 117 RRQKVTVQN 125


>gi|320352850|ref|YP_004194189.1| adenylate/guanylate cyclase [Desulfobulbus propionicus DSM 2032]
 gi|320121352|gb|ADW16898.1| adenylate/guanylate cyclase [Desulfobulbus propionicus DSM 2032]
          Length = 357

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 53/128 (41%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+L+V+ S I +++   L    G+ V  A    EA         P+ +++D  M  +   
Sbjct: 7   SILVVEDSPINQRLLCKLLGKEGYAVRTADHGQEALALLRT-FRPDLILLDILMPQMDGL 65

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++      D+ V ++    D    ++G  AG   ++ KPF+   +   +    ++
Sbjct: 66  ELCRLLKVGEATRDIPVIFISSLDDTSDKLSGFEAGGVDYITKPFHPAEVLARISTHLKL 125

Query: 121 QKSKDENQ 128
            + + + +
Sbjct: 126 CRLQRQLE 133


>gi|228957669|ref|ZP_04119416.1| Two-component response regulator [Bacillus thuringiensis serovar
           pakistani str. T13001]
 gi|229108854|ref|ZP_04238459.1| Two-component response regulator [Bacillus cereus Rock1-15]
 gi|229126714|ref|ZP_04255726.1| Two-component response regulator [Bacillus cereus BDRD-Cer4]
 gi|229149599|ref|ZP_04277831.1| Two-component response regulator [Bacillus cereus m1550]
 gi|228633945|gb|EEK90542.1| Two-component response regulator [Bacillus cereus m1550]
 gi|228656654|gb|EEL12480.1| Two-component response regulator [Bacillus cereus BDRD-Cer4]
 gi|228674623|gb|EEL29862.1| Two-component response regulator [Bacillus cereus Rock1-15]
 gi|228802011|gb|EEM48881.1| Two-component response regulator [Bacillus thuringiensis serovar
           pakistani str. T13001]
          Length = 218

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|229189480|ref|ZP_04316497.1| Two-component response regulator [Bacillus cereus ATCC 10876]
 gi|228594071|gb|EEK51873.1| Two-component response regulator [Bacillus cereus ATCC 10876]
          Length = 218

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|307152410|ref|YP_003887794.1| multi-sensor signal transduction histidine kinase [Cyanothece sp.
           PCC 7822]
 gi|306982638|gb|ADN14519.1| multi-sensor signal transduction histidine kinase [Cyanothece sp.
           PCC 7822]
          Length = 1382

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 29/136 (21%), Positives = 56/136 (41%), Gaps = 8/136 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            ++L D +  +R+  + L N   + V        A E   +   P+ ++ D  M      
Sbjct: 630 RIILADDNADMREYVKRLLNKL-YQVEAVGDGMAALEAIRRHP-PDLVLTDVMMPQLNGF 687

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ- 119
           E +  +R  PL  ++ +  L      E ++    AGA+ +L+KPF+   L   +    + 
Sbjct: 688 ELLQQLRSNPLTQELPIILLSARAGEEYLVEALEAGADDYLVKPFSARELLVRIEANLKM 747

Query: 120 ---MQKSKDENQFLDA 132
               Q++  + Q L A
Sbjct: 748 AQLRQQATQKEQKLRA 763


>gi|86605502|ref|YP_474265.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab]
 gi|86554044|gb|ABC99002.1| DNA-binding response regulator [Synechococcus sp. JA-3-3Ab]
          Length = 245

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 33/131 (25%), Positives = 61/131 (46%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +LLVD    +R+  +    D GF V  A +  +A +       P  ++ D  M G+   
Sbjct: 17  RILLVDDEPGLREAVQAYLEDSGFEVIPAANAQQALQLL-STTQPQLIISDIMMPGMDGY 75

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F+A VR++   + + V +L  +      I G RAG +++L KPF+ E L   +  L + 
Sbjct: 76  QFLAQVRKLDPYSHLPVVFLTAKGMTADRIQGYRAGVDAYLPKPFDPEELVAIVSNLIER 135

Query: 121 QKSKDENQFLD 131
            ++   ++ + 
Sbjct: 136 SRAASPSEVVA 146


>gi|271961733|ref|YP_003335929.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
 gi|270504908|gb|ACZ83186.1| response regulator receiver protein [Streptosporangium roseum DSM
           43021]
          Length = 231

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 44/120 (36%), Gaps = 2/120 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V +V        G +V       EA      +  P+ LV+D  +  +   
Sbjct: 4   RILVVDDDPTVAEVVARYLERDGHVVECVGDGAEALRRALSDP-PDLLVLDLMLPKMDGL 62

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               +       V V  L    +    + G   GA+ ++ KPF+   L   ++ + +  +
Sbjct: 63  QVCRKLRERWP-VPVIMLTALGEEIDRVVGLETGADDYVTKPFSPRELALRVQSVLRRAR 121


>gi|319938297|ref|ZP_08012694.1| two-component system response regulator [Coprobacillus sp. 29_1]
 gi|319806590|gb|EFW03248.1| two-component system response regulator [Coprobacillus sp. 29_1]
          Length = 224

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 55/128 (42%), Gaps = 3/128 (2%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M   +L+VD    +R++ R   +  GF V EA+   EA    E E   +  ++D  M  +
Sbjct: 1   MKSKILVVDDEEHIRELIRFYLDKEGFSVREASGGEEALGILENE-YIDLAIVDIMMPVM 59

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             F   V +M    D+ V  L  +      + G   G + ++ KPF+ + L   ++ + +
Sbjct: 60  DGF-QLVEEMKEFKDIPVIMLTAKSQSADKLRGFSLGIDDYVTKPFDPDELLARVKTILK 118

Query: 120 MQKSKDEN 127
                 +N
Sbjct: 119 RYSINSQN 126


>gi|289664195|ref|ZP_06485776.1| two-component system regulatory protein [Xanthomonas campestris pv.
           vasculorum NCPPB702]
 gi|289668785|ref|ZP_06489860.1| two-component system regulatory protein [Xanthomonas campestris pv.
           musacearum NCPPB4381]
 gi|325918854|ref|ZP_08180934.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas vesicatoria ATCC 35937]
 gi|325534945|gb|EGD06861.1| phosphate regulon transcriptional regulatory protein PhoB
           [Xanthomonas vesicatoria ATCC 35937]
          Length = 229

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 25/128 (19%), Positives = 54/128 (42%), Gaps = 3/128 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R +         F    A    EA +    + +P+ +++D  + G   
Sbjct: 3   KRILIVDDEPAIRDMVAFALRKGEFEPIHAGDAREA-QTAIADRVPDLILLDWMLPGTSG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+     R+  L  ++ +  L    +    + G  AG + +++KPF+   L   +R + +
Sbjct: 62  LDLARRWRKEQLTREIPIIMLTARGEENDRVGGLEAGVDDYVVKPFSARELLARIRAVMR 121

Query: 120 MQKSKDEN 127
             +  DE+
Sbjct: 122 RTREDDED 129


>gi|306829564|ref|ZP_07462754.1| DNA-binding response regulator [Streptococcus mitis ATCC 6249]
 gi|304428650|gb|EFM31740.1| DNA-binding response regulator [Streptococcus mitis ATCC 6249]
          Length = 252

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 51/120 (42%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 18  MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAE-QPDIIILDLMLPEID 76

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 77  GLEVA-KAIRKTSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 135


>gi|239980465|ref|ZP_04702989.1| two-component systen response regulator [Streptomyces albus J1074]
 gi|291452324|ref|ZP_06591714.1| two-component system response regulator [Streptomyces albus J1074]
 gi|291355273|gb|EFE82175.1| two-component system response regulator [Streptomyces albus J1074]
          Length = 246

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 30/126 (23%), Positives = 46/126 (36%), Gaps = 1/126 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    VR   R      G+    A    +A E       P+ +V+D  M  +  
Sbjct: 13  QRILIVDDEPAVRDALRRSLAFEGYGTEVAVDGLDALEKA-ASYRPDLIVLDIQMPRMDG 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
             A  R       V +  L         + G  AGA+ +L+KPF  + L   +R L +  
Sbjct: 72  LTAARRVRAAQDTVPILMLTARDTVGDRVTGLDAGADDYLVKPFELDELFARVRALLRRS 131

Query: 122 KSKDEN 127
               E 
Sbjct: 132 SYAVEQ 137


>gi|212639803|ref|YP_002316323.1| OmpR family transcriptional regulator (REC-wHTH) [Anoxybacillus
           flavithermus WK1]
 gi|212561283|gb|ACJ34338.1| Transcriptional regulator OmpR family (REC-wHTH) [Anoxybacillus
           flavithermus WK1]
          Length = 223

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 27/127 (21%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M ++L+VD    +R++ R      GF   EA           +    + +++D  M  + 
Sbjct: 1   MATILIVDDEKEMRELLRLYLEPEGFTCIEADDGEAGLAEFGR-KQIDLILLDIMMPKLD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
              F  HVR+    + V + +L    D    + G + GA+ +++KPF+   +   +  + 
Sbjct: 60  GYRFCMHVRER---SQVPIIFLTARSDEWDRVYGLQIGADDYIVKPFSPNEVVARVHAVL 116

Query: 119 QMQKSKD 125
           +  K  D
Sbjct: 117 RRTKGTD 123


>gi|37680917|ref|NP_935526.1| sensory box sensor histidine kinase/response regulator [Vibrio
           vulnificus YJ016]
 gi|320155417|ref|YP_004187796.1| chitin catabolic cascade sensor histidine kinase ChiS [Vibrio
           vulnificus MO6-24/O]
 gi|37199667|dbj|BAC95497.1| sensory box sensor histidine kinase/response regulator [Vibrio
           vulnificus YJ016]
 gi|319930729|gb|ADV85593.1| chitin catabolic cascade sensor histidine kinase ChiS [Vibrio
           vulnificus MO6-24/O]
          Length = 1129

 Score =  149 bits (379), Expect = 8e-35,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 58/135 (42%), Gaps = 7/135 (5%)

Query: 4   LLLV-DSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           LL+V D   +  +V        G+ V  A+   +  E  E E  P  L++D  M G+   
Sbjct: 724 LLIVADDEPVNLRVLESFLRIEGYRVQTASDGPDTLELIEHEK-PALLLLDIMMPGMSGY 782

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ     ++ +  L      E  + G  AGAN +L KPFN++ L   ++     
Sbjct: 783 QVCHQLRQQYDMAELPIIMLTALSQSEDRVRGFEAGANDYLTKPFNKQELAARIKAHLMA 842

Query: 121 QKSKD---ENQFLDA 132
            K++    EN  L+A
Sbjct: 843 SKAEARRLENNRLEA 857


>gi|293370405|ref|ZP_06616959.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein
            [Bacteroides ovatus SD CMC 3f]
 gi|292634553|gb|EFF53088.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein
            [Bacteroides ovatus SD CMC 3f]
          Length = 1417

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 61/134 (45%), Gaps = 7/134 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+L+V+ +  ++   + + +   + V  A++  E  +    + LP+ ++ D  M  +   
Sbjct: 1159 SILVVEDNEELKAFLKSILS-ENYTVITASNGEEGLQHAV-DDLPDLIISDVMMPVMDGL 1216

Query: 63   --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              I  +++      + +  L  +   +  IAG   G + ++ KPF+   L+  +  L + 
Sbjct: 1217 EMIRQIKENNNICHIPIIVLSAKASLDDRIAGLEQGIDDYITKPFSATYLKTRVASLLRQ 1276

Query: 121  QKSKDE---NQFLD 131
            +K+  E   N+ ++
Sbjct: 1277 RKALQELYMNRLME 1290


>gi|221636014|ref|YP_002523890.1| response regulator [Thermomicrobium roseum DSM 5159]
 gi|221157462|gb|ACM06580.1| response regulator [Thermomicrobium roseum DSM 5159]
          Length = 225

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 32/130 (24%), Positives = 54/130 (41%), Gaps = 1/130 (0%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    + ++ R   +  GF V  A S  EA      E  P+ +V+D  + G+ 
Sbjct: 1   MTHVLVVDDDTRLVEMLRRTLSYEGFTVSVAQSGDEALRLV-AERRPDLIVLDWLLPGMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R    G    +  L      E  + G  +GA+ +L+KPF    L   +R L + 
Sbjct: 60  GLAVVQRLRAAGDGTPILMLTARDAVEDRVLGLDSGADDYLVKPFAPAELLARIRALLRR 119

Query: 121 QKSKDENQFL 130
            +   + + L
Sbjct: 120 VEPASDEKPL 129


>gi|332968745|gb|EGK07795.1| response regulator [Psychrobacter sp. 1501(2011)]
          Length = 248

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 53/122 (43%), Gaps = 1/122 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R + +    D GF+V  A    +  +   +  L + +V+D  + G    
Sbjct: 15  RILVVDDDARLRSLLQRFLEDDGFVVRTAHDGSQ-MDKLMQRELFSLVVLDLMLPGEDGI 73

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R     +D+ +  L  +      IAG  AGA+ +L KPFN + L   ++ + +   
Sbjct: 74  SICKRLREDNSDIPIIMLTAKGSDSDRIAGLEAGADDYLPKPFNPKELLARIKAVLRRHS 133

Query: 123 SK 124
            +
Sbjct: 134 RE 135


>gi|171911993|ref|ZP_02927463.1| two component transcriptional regulator, winged helix family
           protein [Verrucomicrobium spinosum DSM 4136]
          Length = 235

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 26/119 (21%), Positives = 48/119 (40%), Gaps = 3/119 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +L+ D    VR++        G+   EA    +      +   P+ +V+D  M G     
Sbjct: 7   ILIADDEEDVRELVGMNLRRAGYDTVEAADGLQTLAQVRR-RKPDAIVLDVMMPGRDGFG 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
               +R+      + V  L  +   +  IAG   GA+ +L KPF+ + L   ++ L + 
Sbjct: 66  VCQELREDESTRHIPVIMLTAKGQTQDRIAGLERGADDYLSKPFSPKELVLRVQALLRR 124


>gi|251794820|ref|YP_003009551.1| two component transcriptional regulator, winged helix family
           [Paenibacillus sp. JDR-2]
 gi|247542446|gb|ACS99464.1| two component transcriptional regulator, winged helix family
           [Paenibacillus sp. JDR-2]
          Length = 224

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 28/129 (21%), Positives = 56/129 (43%), Gaps = 6/129 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++        G+ V EAT+  +A    E  + P+  VID  M  + 
Sbjct: 1   MPKILVVDDDPNIRELVSLFLRREGYEVIEATNGEDALNRLEA-VKPDLAVIDVMMPKMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                + +R+     D+ +  L  + +    + G   GA+ +++KPF+   L   ++ L 
Sbjct: 60  GWALCSALRESF---DMPLLMLTAKGETAHKVKGFELGADDYVVKPFDPPELIVRVKALL 116

Query: 119 QMQKSKDEN 127
           +  +     
Sbjct: 117 KRYRIASSQ 125


>gi|306825161|ref|ZP_07458503.1| DNA-binding response regulator [Streptococcus sp. oral taxon 071
           str. 73H25AP]
 gi|304432597|gb|EFM35571.1| DNA-binding response regulator [Streptococcus sp. oral taxon 071
           str. 73H25AP]
          Length = 235

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAE-QPDIIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KAIRKTSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QKSKD 125
                
Sbjct: 119 TDLAS 123


>gi|261368149|ref|ZP_05981032.1| DNA-binding response regulator RegX3 [Subdoligranulum variabile DSM
           15176]
 gi|282569913|gb|EFB75448.1| DNA-binding response regulator RegX3 [Subdoligranulum variabile DSM
           15176]
          Length = 228

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 21/128 (16%), Positives = 54/128 (42%), Gaps = 6/128 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + ++ R      G+ V        A    +K L P+ +++D  M  +   
Sbjct: 5   KILVVDDDKNICELLRLYLVKEGYNVTMVHDGNAALTEFDK-LHPDLVLLDVMMPVMDGW 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R      +  +  L  + +    + G   GA+ +++KPF+ + +   ++ + + 
Sbjct: 64  EVCRKIRAKD---NTPIIMLTAKGETYDKVLGLELGADDYIVKPFDAKEVTARIKAVLRR 120

Query: 121 QKSKDENQ 128
              +++N+
Sbjct: 121 STKEEDNK 128


>gi|160934780|ref|ZP_02082166.1| hypothetical protein CLOLEP_03655 [Clostridium leptum DSM 753]
 gi|156866233|gb|EDO59605.1| hypothetical protein CLOLEP_03655 [Clostridium leptum DSM 753]
          Length = 229

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 23/120 (19%), Positives = 52/120 (43%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +++VD    + ++ R      G+ V  A    EA E  EKE  P  +++D  +  +   
Sbjct: 5   KIMVVDDDKNICELLRLYLEKEGYQVVIANDGKEAVELNEKED-PELILLDIMLPQLDGW 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    + V +  L  + +    + G   GA+ +++KPF  + +   ++ + + 
Sbjct: 64  QVCREIRKK---SQVPIIMLTAKGEVFDKVLGLELGADDYIVKPFETKEVVARIKAVLRR 120


>gi|318040600|ref|ZP_07972556.1| two-component response regulator [Synechococcus sp. CB0101]
          Length = 253

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 28/122 (22%), Positives = 54/122 (44%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++     +  G+ V  A    EA E   +   P+ +V+D  M      
Sbjct: 15  TILVVDDEASIRRILETRLSMIGYQVVTACDGQEALEAFRRTD-PDLVVLDVMMPKLDGY 73

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 74  GVCQELRKE---SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 130

Query: 121 QK 122
            +
Sbjct: 131 VE 132


>gi|295398639|ref|ZP_06808664.1| response regulator [Aerococcus viridans ATCC 11563]
 gi|294973127|gb|EFG48929.1| response regulator [Aerococcus viridans ATCC 11563]
          Length = 238

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 49/128 (38%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  +      + G+ +  A    +A E       P+ +V+D  +    
Sbjct: 1   MKKILIVDDEKPISDIISFNLKNEGYEIDTAYDGQQALEKF-ASFQPDLVVLDLMLPKID 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    +R+    + V +  L  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCRQIRKD---SQVPIIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELMARVKANI 116

Query: 119 QMQKSKDE 126
           +      E
Sbjct: 117 RRTAVVAE 124


>gi|256786760|ref|ZP_05525191.1| response regulator [Streptomyces lividans TK24]
 gi|289770653|ref|ZP_06530031.1| response regulator [Streptomyces lividans TK24]
 gi|289700852|gb|EFD68281.1| response regulator [Streptomyces lividans TK24]
          Length = 280

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 27/116 (23%), Positives = 45/116 (38%), Gaps = 2/116 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V +V     +  G+ V  A    EA         P+ +V+D  + G+   
Sbjct: 54  RILVVDDDPTVAEVVAGYLDRAGYRVDRAGDGPEALARA-AGHRPDLVVLDLMLPGMDGL 112

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
               R    G  V V  L    D +  + G   GA+ ++ KPF+   L   +  + 
Sbjct: 113 EVCRRLRGQGP-VPVIMLTARGDEDDRVLGLEVGADDYVTKPFSPRELVLRVESVL 167


>gi|224283668|ref|ZP_03646990.1| Putative response regulator [Bifidobacterium bifidum NCIMB 41171]
 gi|313140824|ref|ZP_07803017.1| response regulator [Bifidobacterium bifidum NCIMB 41171]
 gi|313133334|gb|EFR50951.1| response regulator [Bifidobacterium bifidum NCIMB 41171]
          Length = 234

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 50/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A S  E  E   K    + +++D  + G+ 
Sbjct: 1   MTRILIVEDEESYREPLVYQLTREGYDVSAAASGEEGLELFTKGG-IDLVLLDLMLPGID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVL 116

Query: 119 QMQKSKDE 126
           +  +   E
Sbjct: 117 RRNQGAVE 124


>gi|269836402|ref|YP_003318630.1| two component transcriptional regulator, winged helix family
           [Sphaerobacter thermophilus DSM 20745]
 gi|269785665|gb|ACZ37808.1| two component transcriptional regulator, winged helix family
           [Sphaerobacter thermophilus DSM 20745]
          Length = 233

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 23/129 (17%), Positives = 50/129 (38%), Gaps = 6/129 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+    +R    +     G  V        A      +  P+ +++D  +  + 
Sbjct: 1   MARILVVEDEASIRTTIAYNLKKAGHDVRTVADGEAAIAQANADP-PDLVILDIMLPTID 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F    H+R     + V +  L    D    + G   GA+ ++ KPF+   L   ++ L 
Sbjct: 60  GFDVCRHIR---RSSSVPILMLTARDDEVDRVVGLEIGADDYVTKPFSMRELMARVKALL 116

Query: 119 QMQKSKDEN 127
           + ++  ++ 
Sbjct: 117 RRRELLEQE 125


>gi|289643472|ref|ZP_06475591.1| two component transcriptional regulator, winged helix family
           [Frankia symbiont of Datisca glomerata]
 gi|289506724|gb|EFD27704.1| two component transcriptional regulator, winged helix family
           [Frankia symbiont of Datisca glomerata]
          Length = 290

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 29/121 (23%), Positives = 50/121 (41%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    V +V      + GF V  A     A    E   +P+ +V+D  + G   
Sbjct: 53  TRVLVVDDDPTVAEVVDRYLRNAGFDVDRAADGLTALRMAET-TVPDLVVLDLMLPGIDG 111

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +R+      V V  L    +    +AG   GA+ ++ KPF+   L   +R + +
Sbjct: 112 IEVCRRLREQ---RPVPVIMLTARGEEADRVAGLETGADDYVTKPFSPRELTLRVRSVLR 168

Query: 120 M 120
            
Sbjct: 169 R 169


>gi|17227625|ref|NP_484173.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|75907720|ref|YP_322016.1| two component transcriptional regulator [Anabaena variabilis ATCC
           29413]
 gi|17135107|dbj|BAB77653.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|75701445|gb|ABA21121.1| two component transcriptional regulator, winged helix family
           [Anabaena variabilis ATCC 29413]
          Length = 247

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V +A    +  +    +L P+ +++D  +  V 
Sbjct: 1   MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKG-QALALQLQPDLIMLDLMLPRVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+     ++ V  L      +  + G  AGA+ +L KPF  E +   +R L 
Sbjct: 60  GFTVCQRLRRDERTAEIPVLMLTALSQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|332653701|ref|ZP_08419445.1| DNA-binding response regulator YycF [Ruminococcaceae bacterium D16]
 gi|332516787|gb|EGJ46392.1| DNA-binding response regulator YycF [Ruminococcaceae bacterium D16]
          Length = 237

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 20/119 (16%), Positives = 46/119 (38%), Gaps = 1/119 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+V+    +  +        G+   EA       +   ++  P+ +++D  + G+  
Sbjct: 3   KTVLIVEDEQNIVDILSFNLEREGYDTLEAYDGNTGLQLALEQN-PDLVLLDLMLPGMDG 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           F    R    G+ V +  L    +    + G   GA+ ++ KPF    L   ++   + 
Sbjct: 62  FEVCRRIRETGSAVPILMLTAREEEADKVLGLELGADDYITKPFGMRELLARVKANIRR 120


>gi|46190748|ref|ZP_00121040.2| COG0745: Response regulators consisting of a CheY-like receiver
           domain and a winged-helix DNA-binding domain
           [Bifidobacterium longum DJO10A]
 gi|189439936|ref|YP_001955017.1| putative response regulator [Bifidobacterium longum DJO10A]
 gi|189428371|gb|ACD98519.1| Putative response regulator [Bifidobacterium longum DJO10A]
          Length = 234

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 52/128 (40%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A++  E  E   K    + +++D  + G+ 
Sbjct: 1   MTRILIVEDEESYREPLVYQLTREGYDVSAASTGEEGLELFTKGG-IDLVLLDLMLPGID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVM 116

Query: 119 QMQKSKDE 126
           +  ++  +
Sbjct: 117 RRNQAAAQ 124


>gi|307704960|ref|ZP_07641848.1| response regulator [Streptococcus mitis SK597]
 gi|307709233|ref|ZP_07645692.1| response regulator [Streptococcus mitis SK564]
 gi|307620179|gb|EFN99296.1| response regulator [Streptococcus mitis SK564]
 gi|307621470|gb|EFO00519.1| response regulator [Streptococcus mitis SK597]
          Length = 235

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-QPDIIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KTIRKTSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QKSKD 125
                
Sbjct: 119 TDLAS 123


>gi|229099893|ref|ZP_04230816.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-29]
 gi|229106054|ref|ZP_04236673.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-28]
 gi|229118956|ref|ZP_04248301.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-3]
 gi|228664481|gb|EEL19977.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-3]
 gi|228677373|gb|EEL31631.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-28]
 gi|228683508|gb|EEL37463.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-29]
          Length = 234

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E   +E  P+ +++D  + G   
Sbjct: 3   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEE-QPDMVLLDIMLPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  LEVCREIRKNSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|229016644|ref|ZP_04173581.1| Two-component response regulator [Bacillus cereus AH1273]
 gi|229022859|ref|ZP_04179379.1| Two-component response regulator [Bacillus cereus AH1272]
 gi|228738394|gb|EEL88870.1| Two-component response regulator [Bacillus cereus AH1272]
 gi|228744634|gb|EEL94699.1| Two-component response regulator [Bacillus cereus AH1273]
          Length = 218

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 61/129 (47%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA    E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALRKLENDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|196247939|ref|ZP_03146641.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. G11MC16]
 gi|196212723|gb|EDY07480.1| two component transcriptional regulator, winged helix family
           [Geobacillus sp. G11MC16]
          Length = 224

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 56/124 (45%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++  H  +  G  + EA +  EA +  E   + + +++D  M  + 
Sbjct: 1   MARILVVDDDAHIRELVSHFLSLEGLTIHEAANGKEALDVLETTKV-DLVIMDIMMPEMD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R      DV +  L  + +  + + G   GA+ +L+KPF+   L   ++ L 
Sbjct: 60  GWELCRELR---DYDDVPILMLTAKGETREKVKGFSLGADDYLVKPFDPLELVARVKALL 116

Query: 119 QMQK 122
           +  +
Sbjct: 117 KRYR 120


>gi|119486576|ref|ZP_01620626.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
 gi|119456193|gb|EAW37325.1| Two component Transcriptional regulator, Winged helix family
           protein [Lyngbya sp. PCC 8106]
          Length = 253

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 29/132 (21%), Positives = 53/132 (40%), Gaps = 6/132 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+ D    +R++     +  G+ V  A    EA    E E  P+ +V+D  M      
Sbjct: 15  KILIADDESAIRRILTTRLSMVGYEVVAAADGREALSLFETEN-PDLVVLDVMMPKLNGY 73

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R       V +  L    D    I G   GA+ +L KPF+ + L   ++ + + 
Sbjct: 74  GVCQKIRTQSE---VPIIMLTALGDVADRITGLELGADDYLTKPFSPKELEARIQAILRR 130

Query: 121 QKSKDENQFLDA 132
            +  + N+ + A
Sbjct: 131 LRETNANRDVSA 142


>gi|219848093|ref|YP_002462526.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219542352|gb|ACL24090.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 234

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 32/122 (26%), Positives = 56/122 (45%), Gaps = 2/122 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD    +R V +      G+ V  AT+  E  +    E  P+ +V+D  + G+   
Sbjct: 4   TILVVDDEASIRNVAKAYLEHAGYRVLCATTGPEGLQMALDEE-PDLIVLDLMLPGMDGM 62

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R     +DVF+  L    D    +AG R GA+ +L KPF+   L   +  + + ++
Sbjct: 63  EITARLREK-SDVFILMLTARSDEIDRVAGLRVGADDYLTKPFSPRELVARVEAILRRRR 121

Query: 123 SK 124
            K
Sbjct: 122 GK 123


>gi|116750317|ref|YP_847004.1| two component transcriptional regulator [Syntrophobacter
           fumaroxidans MPOB]
 gi|116699381|gb|ABK18569.1| two component transcriptional regulator, winged helix family
           [Syntrophobacter fumaroxidans MPOB]
          Length = 227

 Score =  149 bits (379), Expect = 9e-35,   Method: Composition-based stats.
 Identities = 24/130 (18%), Positives = 53/130 (40%), Gaps = 3/130 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+    +  +  +     GF V +A     A E   +   P+ +V+D  + G+  F
Sbjct: 5   RILIVEDDSDILHLLAYNIEAAGFDVVKAMDGNTALEMVRRHP-PDLVVLDLMIPGIDGF 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +++      + V  L    +    I G   GA+ +++KPF+   L   +R + + 
Sbjct: 64  EVCKELKRGAETRGIPVIMLTARGEEVDRIVGLELGADDYVVKPFSPRELILRIRAILRR 123

Query: 121 QKSKDENQFL 130
             +    + +
Sbjct: 124 SATDATEERI 133


>gi|229095884|ref|ZP_04226862.1| Two-component response regulator [Bacillus cereus Rock3-29]
 gi|229101998|ref|ZP_04232711.1| Two-component response regulator [Bacillus cereus Rock3-28]
 gi|229114837|ref|ZP_04244250.1| Two-component response regulator [Bacillus cereus Rock1-3]
 gi|228668529|gb|EEL23958.1| Two-component response regulator [Bacillus cereus Rock1-3]
 gi|228681385|gb|EEL35549.1| Two-component response regulator [Bacillus cereus Rock3-28]
 gi|228687508|gb|EEL41408.1| Two-component response regulator [Bacillus cereus Rock3-29]
          Length = 218

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLESDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|160893753|ref|ZP_02074537.1| hypothetical protein CLOL250_01307 [Clostridium sp. L2-50]
 gi|156864738|gb|EDO58169.1| hypothetical protein CLOL250_01307 [Clostridium sp. L2-50]
          Length = 238

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 54/127 (42%), Gaps = 6/127 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + ++     N   +    A     A E    E  PN +++D  + G+   
Sbjct: 5   KILIVDDDENIAELISLYLNKECYETQIAADGTSALEAFV-EFAPNLILLDVMLPGMDGY 63

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    ++V +  L  + +    + G + GA+ +++KPF+   L   +  L + 
Sbjct: 64  QVCTEIRKQ---SNVPIIMLSAKGEVFDKVLGLKIGADDYIVKPFDSNELVARVGALLRR 120

Query: 121 QKSKDEN 127
             S+ +N
Sbjct: 121 CNSRTDN 127


>gi|138894462|ref|YP_001124915.1| two-component response regulator [Geobacillus thermodenitrificans
           NG80-2]
 gi|134265975|gb|ABO66170.1| Two-component response regulator [Geobacillus thermodenitrificans
           NG80-2]
          Length = 226

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/124 (21%), Positives = 56/124 (45%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++  H  +  G  + EA +  EA +  E   + + +++D  M  + 
Sbjct: 3   MARILVVDDDAHIRELVSHFLSLEGLTIHEAANGKEALDVLETTKV-DLVIMDIMMPEMD 61

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R      DV +  L  + +  + + G   GA+ +L+KPF+   L   ++ L 
Sbjct: 62  GWELCRELR---DYDDVPILMLTAKGETREKVKGFSLGADDYLVKPFDPLELVARVKALL 118

Query: 119 QMQK 122
           +  +
Sbjct: 119 KRYR 122


>gi|254413625|ref|ZP_05027395.1| Stage II sporulation protein E [Microcoleus chthonoplastes PCC
           7420]
 gi|196179732|gb|EDX74726.1| Stage II sporulation protein E [Microcoleus chthonoplastes PCC
           7420]
          Length = 379

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/135 (17%), Positives = 54/135 (40%), Gaps = 3/135 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    ++ + +   ++ G+ V  A++  E  E   ++L P  ++ D  M  + 
Sbjct: 1   MTQILIIDDDPAIQILLKRTLHNQGYDVTIASNGEEGLELV-QQLRPALVICDWIMPRMN 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  ++  P  +      L         + G  AGA+ F+ KP     L+  +R   
Sbjct: 60  GLEVCRQIKATPALSTTMFILLTSLGSVGDRVKGLDAGADDFICKPIEIAELQARVRSGL 119

Query: 119 QMQKSKDENQFLDAI 133
           ++ +   + Q    +
Sbjct: 120 RLHELSRDLQHQKQL 134


>gi|166364232|ref|YP_001656505.1| OmpR family two-component response regulator [Microcystis
           aeruginosa NIES-843]
 gi|166086605|dbj|BAG01313.1| two-component response regulator OmpR subfamily [Microcystis
           aeruginosa NIES-843]
          Length = 246

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V  A    +  +    +L P+ +++D  +  V 
Sbjct: 1   MPRILVIDDDPAIAELVSINLEMAGYDVNPAEDGIKG-QALAVQLQPDLIMLDLMLPKVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+    +D+ +  L      +  + G  AGA+ +L KPF  E +   +R L 
Sbjct: 60  GFTVCQRLRRDERTSDIPILMLTALGQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|27365036|ref|NP_760564.1| chitin catabolic cascade sensor histidine kinase chiS [Vibrio
           vulnificus CMCP6]
 gi|27361182|gb|AAO10091.1| Chitin catabolic cascade sensor histidine kinase ChiS [Vibrio
           vulnificus CMCP6]
          Length = 1129

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 36/135 (26%), Positives = 58/135 (42%), Gaps = 7/135 (5%)

Query: 4   LLLV-DSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           LL+V D   +  +V        G+ V  A+   +  E  E E  P  L++D  M G+   
Sbjct: 724 LLIVADDEPVNLRVLESFLRIEGYRVQTASDGPDTLELIEHEK-PALLLLDIMMPGMSGY 782

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ     ++ +  L      E  + G  AGAN +L KPFN++ L   ++     
Sbjct: 783 QVCHQLRQQYDMAELPIIMLTALSQSEDRVRGFEAGANDYLTKPFNKQELAARIKAHLMA 842

Query: 121 QKSKD---ENQFLDA 132
            K++    EN  L+A
Sbjct: 843 SKAEARRLENNRLEA 857


>gi|323706108|ref|ZP_08117677.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium xylanolyticum LX-11]
 gi|323534552|gb|EGB24334.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacterium xylanolyticum LX-11]
          Length = 235

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/127 (16%), Positives = 56/127 (44%), Gaps = 3/127 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+++    + ++ R+     G+ V    +     E C KE  P+ +++D  +  +   
Sbjct: 4   TILVIEDEAHILELLRYNLEAQGYNVVLTDNGKGGLEKC-KETNPDLVLLDLMLPDIDGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++      ++ +  L  + +    I G   GA+ ++ KPF+   L   ++ + + 
Sbjct: 63  DVCKKLKSDEHLKNIPIIMLTAKSEEVDKILGLELGADDYITKPFSIRELLARIKVVLRR 122

Query: 121 QKSKDEN 127
            K++ E+
Sbjct: 123 SKNESED 129


>gi|311064941|ref|YP_003971667.1| two-component response regulator [Bifidobacterium bifidum PRL2010]
 gi|310867261|gb|ADP36630.1| Two-component response regulator [Bifidobacterium bifidum PRL2010]
          Length = 228

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/124 (18%), Positives = 49/124 (39%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A S  E  E   K    + +++D  + G+ 
Sbjct: 1   MTRILIVEDEESYREPLVYQLTREGYDVSAAASGEEGLELFTKGG-IDLVLLDLMLPGID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVL 116

Query: 119 QMQK 122
           +  +
Sbjct: 117 RRNQ 120


>gi|302541878|ref|ZP_07294220.1| DNA-binding response regulator ResD [Streptomyces hygroscopicus
           ATCC 53653]
 gi|302459496|gb|EFL22589.1| DNA-binding response regulator ResD [Streptomyces himastatinicus
           ATCC 53653]
          Length = 262

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 47/122 (38%), Gaps = 6/122 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V +V        GF V  A     A    + +  P+ +V+D  + G+   
Sbjct: 9   RVLVVDDDPTVAEVVAGYLTRAGFAVDRAADGPGALARADAQW-PDLVVLDLMLPGMDGL 67

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R       V V  L    D +  I G   GA+ ++ KPF+   L   +  + + 
Sbjct: 68  DVCRALRGKGP---VPVIMLTARGDEDDRILGLEIGADDYVTKPFSPRELVLRVESVLRR 124

Query: 121 QK 122
            +
Sbjct: 125 GR 126


>gi|228905410|ref|ZP_04069365.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 4222]
 gi|228968616|ref|ZP_04129601.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228791108|gb|EEM38725.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar sotto str. T04001]
 gi|228854230|gb|EEM98933.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 4222]
          Length = 234

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E   +E  P+ +++D  + G   
Sbjct: 3   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEE-QPDMVLLDIMLPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  LEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|229029069|ref|ZP_04185168.1| Two-component response regulator [Bacillus cereus AH1271]
 gi|228732349|gb|EEL83232.1| Two-component response regulator [Bacillus cereus AH1271]
          Length = 218

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAGNGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELIARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|302557641|ref|ZP_07309983.1| DNA-binding response regulator ResD [Streptomyces griseoflavus
           Tu4000]
 gi|302475259|gb|EFL38352.1| DNA-binding response regulator ResD [Streptomyces griseoflavus
           Tu4000]
          Length = 242

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/120 (21%), Positives = 47/120 (39%), Gaps = 2/120 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    V ++     +  G++V  A     A         P+ +V+D  + G+   
Sbjct: 13  RVLVVDDDPTVAEIVTGYLDRAGYVVDRAGDGPGALARAAAHW-PDLVVLDLMLPGMDGL 71

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G  V V  L    D +  I G   GA+ ++ KPF+   L   +  + +  +
Sbjct: 72  EVCRRMRGRGP-VPVIMLTARGDEDDRILGLEVGADDYVTKPFSPRELVLRVESVLRRSR 130


>gi|16081093|ref|NP_391921.1| two-component response regulator YycG [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|586808|sp|P37478|YYCF_BACSU RecName: Full=Transcriptional regulatory protein yycF
 gi|467327|dbj|BAA05173.1| unknown [Bacillus subtilis]
 gi|1064814|dbj|BAA11300.1| yycF [Bacillus subtilis]
 gi|2636588|emb|CAB16078.1| two-component response regulator [YycG] [Bacillus subtilis subsp.
           subtilis str. 168]
          Length = 235

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 50/122 (40%), Gaps = 6/122 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  +        G+ V  A    EA E  E EL P+ +++D  +     
Sbjct: 3   KKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVE-ELQPDLILLDIMLPNKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  VEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQ 121
            Q
Sbjct: 119 RQ 120


>gi|304394459|ref|ZP_07376380.1| phosphate regulon transcriptional regulatory protein PhoB [Ahrensia
           sp. R2A130]
 gi|303293369|gb|EFL87748.1| phosphate regulon transcriptional regulatory protein PhoB [Ahrensia
           sp. R2A130]
          Length = 233

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/131 (15%), Positives = 50/131 (38%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +L+V+     +++  +     GF V       +     + E  P  +V+D  + G   +
Sbjct: 8   KILVVEDEPSQQELLVYNLEKAGFRVVATGDGEDGVAAAQDEN-PALIVLDWMLPGLSGI 66

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+      + +  L    +    +     GA+ +++KP++   L   +R   + 
Sbjct: 67  EVCRQLRRDADTRQIPIIMLTARGEEGDKVRALDTGADDYIVKPYSVAELLARVRAHIRR 126

Query: 121 QKSKDENQFLD 131
               +  + L+
Sbjct: 127 ANPAEVGEMLE 137


>gi|299148439|ref|ZP_07041501.1| two-component system sensor histidine kinase/response regulator,
            hybrid (one-component system) [Bacteroides sp. 3_1_23]
 gi|298513200|gb|EFI37087.1| two-component system sensor histidine kinase/response regulator,
            hybrid (one-component system) [Bacteroides sp. 3_1_23]
          Length = 1446

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 61/134 (45%), Gaps = 7/134 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+L+V+ +  ++   + + +   + V  A++  E  +    + LP+ ++ D  M  +   
Sbjct: 1188 SILVVEDNEELKAFLKSILS-ENYTVITASNGEEGLQHAV-DDLPDLIISDVMMPVMDGL 1245

Query: 63   --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              I  +++      + +  L  +   +  IAG   G + ++ KPF+   L+  +  L + 
Sbjct: 1246 EMIRQIKENNNICHIPIIVLSAKASLDDRIAGLEQGIDDYITKPFSATYLKTRVASLLRQ 1305

Query: 121  QKSKDE---NQFLD 131
            +K+  E   N+ ++
Sbjct: 1306 RKALQELYMNRLME 1319


>gi|289705441|ref|ZP_06501835.1| response regulator receiver domain protein [Micrococcus luteus
           SK58]
 gi|289557826|gb|EFD51123.1| response regulator receiver domain protein [Micrococcus luteus
           SK58]
          Length = 235

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 31/125 (24%), Positives = 53/125 (42%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    +R++        GF V  A +  EA +  E E  P+  V+D  +  +  F
Sbjct: 9   RLLVVDDEPNIRELLSTSLRYAGFEVTAAANGREALDAAE-EFQPDLAVLDVMLPDMDGF 67

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G    V +L      E  I G   G + ++ KPF+ + +   +R + +   
Sbjct: 68  TVTRRLRAAGRHFPVVFLTARDGTEDKITGLTVGGDDYVTKPFSLDEVVARIRAVLRRTA 127

Query: 123 SKDEN 127
           S D++
Sbjct: 128 SLDDD 132


>gi|33866776|ref|NP_898335.1| two-component response regulator [Synechococcus sp. WH 8102]
 gi|33639377|emb|CAE08761.1| two-component response regulator [Synechococcus sp. WH 8102]
          Length = 248

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 55/125 (44%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++     +  G+ V  A    EA E  E    P+ +V+D  M      
Sbjct: 10  TILVVDDEASIRRILETRLSMIGYNVVTACDGTEALELFE-NTAPDLVVLDVMMPKLDGY 68

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R + + 
Sbjct: 69  GVCQELRKE---SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCVLRR 125

Query: 121 QKSKD 125
            + + 
Sbjct: 126 VEKES 130


>gi|309792798|ref|ZP_07687241.1| two component transcriptional regulator [Oscillochloris trichoides
           DG6]
 gi|308225162|gb|EFO78947.1| two component transcriptional regulator [Oscillochloris trichoides
           DG6]
          Length = 238

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +    R      G  V  A +  EA +   ++ +P+ +++D  M  +  
Sbjct: 7   KLVLVVDDEPRMINFMRLNLELEGMRVATAANGREALDRA-RDDMPDVILLDVMMPVMDG 65

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F   +R++   + V +  L  + + E  + G   GA+ ++ KPF+   L   +R + +  
Sbjct: 66  F-EALRRLRQFSQVPILMLTAKDEEEDRVRGLELGADDYIGKPFSHRELISRIRAVLRRH 124


>gi|289168019|ref|YP_003446288.1| response regulator [Streptococcus mitis B6]
 gi|288907586|emb|CBJ22423.1| response regulator [Streptococcus mitis B6]
          Length = 235

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 51/120 (42%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-QPDIIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KTIRKTSSVPIIMLSAKDTEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118


>gi|113868407|ref|YP_726896.1| response regulator [Ralstonia eutropha H16]
 gi|113527183|emb|CAJ93528.1| response regulator, phosphate regulon transcriptional regulator
           PhoB, OmpR-family [Ralstonia eutropha H16]
          Length = 235

 Score =  149 bits (379), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/124 (16%), Positives = 53/124 (42%), Gaps = 3/124 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           S+L+V+    + ++        G     A +  +A      ++LP+ +++D  + G    
Sbjct: 4   SILVVEDEPAIAELIAVNLQHAGHYPIRAYNAEQALSLM-SDVLPDLVLLDWMLPGKSGA 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F   +R       + +  L    + +  + G  AGA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  NFAKELRANDRTRQIPIIMLTARGEEQDKVMGLEAGADDYVTKPFSPKELLARIKAVLRR 122

Query: 121 QKSK 124
           +  +
Sbjct: 123 RAPQ 126


>gi|289450472|ref|YP_003474684.1| putative alkaline phosphatase synthesis transcriptional regulatory
           protein PhoP [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
 gi|289185019|gb|ADC91444.1| putative alkaline phosphatase synthesis transcriptional regulatory
           protein PhoP [Clostridiales genomosp. BVAB3 str.
           UPII9-5]
          Length = 239

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 28/125 (22%), Positives = 54/125 (43%), Gaps = 6/125 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M  +L+VD    + ++ +  F   GF V        A E  +K   PN +++D  + G  
Sbjct: 1   MKKVLVVDDDRNICELVQLYFEKDGFQVKTVNDGEMALEEIDK-YNPNVVILDLMLPGKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +R+    ++V +  L    D    I G   GA+ ++ KPF+ + L    + + 
Sbjct: 60  GYEVCREIRK---TSNVPILMLTARGDTLDKIVGLELGADDYISKPFDPKELVVRAKTVL 116

Query: 119 QMQKS 123
           +  ++
Sbjct: 117 RRTEA 121


>gi|291522156|emb|CBK80449.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Coprococcus catus GD/7]
          Length = 226

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/132 (20%), Positives = 54/132 (40%), Gaps = 5/132 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    +RK+ R      GF V EA    EA +   +      +++D  M  +   
Sbjct: 5   KILVVDDESRMRKLVRDFLTKKGFTVIEAGDGEEAVDKFFEVKDIALIILDVMMPKMDGW 64

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +RQ    + V +  L  + D +  + G   G + ++ KPF+ + L   +  + + 
Sbjct: 65  QVCREIRQ---YSKVPIIMLTAKSDEKDELQGFDLGVDEYITKPFSPKILVARVEAILRR 121

Query: 121 QKSKDENQFLDA 132
                 +  ++A
Sbjct: 122 SNVLAADDTMEA 133


>gi|239622508|ref|ZP_04665539.1| response regulator [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|312133342|ref|YP_004000681.1| response regulator of two-component system [Bifidobacterium longum
           subsp. longum BBMN68]
 gi|322688478|ref|YP_004208212.1| two-component response regulator [Bifidobacterium longum subsp.
           infantis 157F]
 gi|322690488|ref|YP_004220058.1| two-component response regulator [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|239514505|gb|EEQ54372.1| response regulator [Bifidobacterium longum subsp. infantis CCUG
           52486]
 gi|291517414|emb|CBK71030.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Bifidobacterium longum
           subsp. longum F8]
 gi|311772562|gb|ADQ02050.1| Response Regulator of two-component system [Bifidobacterium longum
           subsp. longum BBMN68]
 gi|320455344|dbj|BAJ65966.1| two-component response regulator [Bifidobacterium longum subsp.
           longum JCM 1217]
 gi|320459814|dbj|BAJ70434.1| two-component response regulator [Bifidobacterium longum subsp.
           infantis 157F]
          Length = 234

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 1   MTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVM 116

Query: 119 QMQKSKDE 126
           +  ++  +
Sbjct: 117 RRNQATAQ 124


>gi|254448586|ref|ZP_05062045.1| phosphate regulon transcriptional regulatory protein PhoB [gamma
           proteobacterium HTCC5015]
 gi|198261775|gb|EDY86061.1| phosphate regulon transcriptional regulatory protein PhoB [gamma
           proteobacterium HTCC5015]
          Length = 236

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 37/132 (28%), Positives = 64/132 (48%), Gaps = 4/132 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+V+    +R++        G+   EA SV EA E    E +P+ +++D  + G   
Sbjct: 13  KRILVVEDEQAIREMIGFALRREGYHFIEAGSVAEA-EDAIAEQVPDLMLVDWMLPGTSG 71

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +EF+ H ++  L  DV V  L    + +  I G  AGA+ ++ KPF+   L   +R + +
Sbjct: 72  VEFVRHTKRDELTQDVPVIMLTARTEEDDKIVGLDAGADDYVSKPFSPRELIARIRAVLR 131

Query: 120 MQKSKDENQFLD 131
              S D  Q L+
Sbjct: 132 RIGSAD-GQLLE 142


>gi|15674628|ref|NP_268802.1| two-component response regulator [Streptococcus pyogenes M1 GAS]
 gi|19745650|ref|NP_606786.1| two-component response regulator [Streptococcus pyogenes MGAS8232]
 gi|21909908|ref|NP_664176.1| two-component response regulator [Streptococcus pyogenes MGAS315]
 gi|28896393|ref|NP_802743.1| two-component response regulator [Streptococcus pyogenes SSI-1]
 gi|50913815|ref|YP_059787.1| VicR [Streptococcus pyogenes MGAS10394]
 gi|56808928|ref|ZP_00366636.1| COG0745: Response regulators consisting of a CheY-like receiver
           domain and a winged-helix DNA-binding domain
           [Streptococcus pyogenes M49 591]
 gi|71903089|ref|YP_279892.1| two-component response regulator [Streptococcus pyogenes MGAS6180]
 gi|71910248|ref|YP_281798.1| two-component response regulator [Streptococcus pyogenes MGAS5005]
 gi|94988065|ref|YP_596166.1| two-component response regulator [Streptococcus pyogenes MGAS9429]
 gi|94989945|ref|YP_598045.1| two-component response regulator VicR [Streptococcus pyogenes
           MGAS10270]
 gi|94991951|ref|YP_600050.1| two-component response regulator VicR [Streptococcus pyogenes
           MGAS2096]
 gi|94993851|ref|YP_601949.1| two-component response regulator VicR [Streptococcus pyogenes
           MGAS10750]
 gi|139474240|ref|YP_001128956.1| response regulator protein [Streptococcus pyogenes str. Manfredo]
 gi|209558999|ref|YP_002285471.1| Two-component response regulator [Streptococcus pyogenes NZ131]
 gi|306827822|ref|ZP_07461092.1| response regulator [Streptococcus pyogenes ATCC 10782]
 gi|13621741|gb|AAK33523.1| two-component response regulator [Streptococcus pyogenes M1 GAS]
 gi|19747781|gb|AAL97285.1| two-component response regulator [Streptococcus pyogenes MGAS8232]
 gi|21904096|gb|AAM78979.1| two-component response regulator [Streptococcus pyogenes MGAS315]
 gi|28811644|dbj|BAC64576.1| putative two-component response regulator [Streptococcus pyogenes
           SSI-1]
 gi|50902889|gb|AAT86604.1| VicR [Streptococcus pyogenes MGAS10394]
 gi|71802184|gb|AAX71537.1| two-component response regulator [Streptococcus pyogenes MGAS6180]
 gi|71853030|gb|AAZ51053.1| two-component response regulator [Streptococcus pyogenes MGAS5005]
 gi|94541573|gb|ABF31622.1| two-component response regulator [Streptococcus pyogenes MGAS9429]
 gi|94543453|gb|ABF33501.1| Two-component response regulator VicR [Streptococcus pyogenes
           MGAS10270]
 gi|94545459|gb|ABF35506.1| Two-component response regulator VicR [Streptococcus pyogenes
           MGAS2096]
 gi|94547359|gb|ABF37405.1| Two-component response regulator VicR [Streptococcus pyogenes
           MGAS10750]
 gi|134272487|emb|CAM30750.1| response regulator protein [Streptococcus pyogenes str. Manfredo]
 gi|209540200|gb|ACI60776.1| Two-component response regulator [Streptococcus pyogenes NZ131]
 gi|304429992|gb|EFM33031.1| response regulator [Streptococcus pyogenes ATCC 10782]
          Length = 236

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ +  A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK-PDLIILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + V +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|154496344|ref|ZP_02035040.1| hypothetical protein BACCAP_00632 [Bacteroides capillosus ATCC
           29799]
 gi|150274427|gb|EDN01504.1| hypothetical protein BACCAP_00632 [Bacteroides capillosus ATCC
           29799]
          Length = 230

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 51/127 (40%), Gaps = 6/127 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    + ++        G+    A    +  E   +   P+ +++D  +  +  
Sbjct: 3   QKVLIVEDEANIAELLHLYLEKEGYETAVAPDGGKGVELF-RSFHPDLVLLDIMLPVMDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              +  +R+        V  L  + + E  + G   GA+ +++KPF  + +   +  + +
Sbjct: 62  WSVLKKIRESDK---TPVIMLTAKGETEDKVHGLEGGADDYIVKPFEMKEVLARIHAVLR 118

Query: 120 MQKSKDE 126
              +++E
Sbjct: 119 RFGAEEE 125


>gi|87200295|ref|YP_497552.1| two component transcriptional regulator [Novosphingobium
           aromaticivorans DSM 12444]
 gi|87135976|gb|ABD26718.1| two component transcriptional regulator, winged helix family
           [Novosphingobium aromaticivorans DSM 12444]
          Length = 229

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 50/122 (40%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            LLLV+    + ++  + F   G+ V       EA      E  P+ +++D  + G   +
Sbjct: 5   KLLLVEDDTALAELVEYRFRGEGYDVRTTDDGDEAL-LLAAEDTPDLVLLDWMIGGTSGI 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+      V +  L    D +  I G   GA+ ++ KPF+   L   +  + + 
Sbjct: 64  EVCRRLRRNKETAHVPIIMLTARSDEDDRIRGLEIGADDYVTKPFSPRELIARVGAVLRR 123

Query: 121 QK 122
            +
Sbjct: 124 VR 125


>gi|298491554|ref|YP_003721731.1| winged helix family two component transcriptional regulator
           ['Nostoc azollae' 0708]
 gi|298233472|gb|ADI64608.1| two component transcriptional regulator, winged helix family
           ['Nostoc azollae' 0708]
          Length = 250

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 50/129 (38%), Gaps = 10/129 (7%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEK------ELLPNYLVIDESM 56
            +L+V+   ++R++        G+ +  A     A EF +       E   + +V+D  +
Sbjct: 20  RILVVEDEELIREMLVLALEGEGYEIITAADGRAAVEFLKSCESNSGESPFDLVVLDLML 79

Query: 57  EGVLEF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAM 114
             +        +R    G  V +  L  +      + G   GA+ +L KPF+   L    
Sbjct: 80  PQINGLDICRLLRHQ--GNAVPILMLSAKGSETDRVLGLEVGADDYLTKPFSMRELVARC 137

Query: 115 RELPQMQKS 123
           R L + Q+ 
Sbjct: 138 RALLRRQRL 146


>gi|148653957|ref|YP_001281050.1| two component transcriptional regulator [Psychrobacter sp. PRwf-1]
 gi|148573041|gb|ABQ95100.1| two component transcriptional regulator, winged helix family
           [Psychrobacter sp. PRwf-1]
          Length = 240

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 49/130 (37%), Gaps = 5/130 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFC-EKELLPNYLVIDESMEGVL 60
             +LL++    + ++         + V  A +  E  +    KE   + +++D  +  + 
Sbjct: 3   KQILLIEDDPDLAELISDYLAMNYYEVHHAPTGQEGLDILDAKERAIDLIILDLMLPDMD 62

Query: 61  E--FIAHVR--QMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRE 116
                  +R  +      V +  L  + D    + G   GA+ ++ KPF    L   +R 
Sbjct: 63  GMQVCQKIRGGKNSQTNKVPIVMLTAKGDTTDRVLGLEMGADDYISKPFEPRELLARIRA 122

Query: 117 LPQMQKSKDE 126
           + +  +  ++
Sbjct: 123 VLRRHEQPNQ 132


>gi|296268488|ref|YP_003651120.1| winged helix family two component transcriptional regulator
           [Thermobispora bispora DSM 43833]
 gi|296091275|gb|ADG87227.1| two component transcriptional regulator, winged helix family
           [Thermobispora bispora DSM 43833]
          Length = 229

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 53/128 (41%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M  +L+V+          ++    GF V  A S  EA E  ++E   + +++D  + G  
Sbjct: 1   MTRVLVVEDEESFSDALSYMLRKEGFEVAVAASGPEALEVFDREGA-DLVLLDLMLPGLP 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E    +RQ      V V  L  +      I G   GA+ ++ KPF+   L   +R + 
Sbjct: 60  GTEVCRSLRQRSK---VPVIMLTAKDSEIDKIVGLELGADDYVTKPFSSRELVARIRAVL 116

Query: 119 QMQKSKDE 126
           + +   +E
Sbjct: 117 RRRGDAEE 124


>gi|269975939|ref|ZP_06182943.1| response regulator MprA [Mobiluncus mulieris 28-1]
 gi|307700377|ref|ZP_07637416.1| putative response regulator MprA [Mobiluncus mulieris FB024-16]
 gi|269935767|gb|EEZ92297.1| response regulator MprA [Mobiluncus mulieris 28-1]
 gi|307614362|gb|EFN93592.1| putative response regulator MprA [Mobiluncus mulieris FB024-16]
          Length = 255

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/128 (22%), Positives = 53/128 (41%), Gaps = 1/128 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            LL+VD    +R +        G+ VF A    EA      E  P+ +++D  +  +  F
Sbjct: 25  RLLVVDDEPNIRDLLASSLRFAGYEVFSAGDGTEALRLATTEK-PDLVILDVMLPDMDGF 83

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               +    G D+ + +L  + D    + G +AG + ++ KPF  E +   +  + +  K
Sbjct: 84  TVTRKLRAAGIDMPILFLTAKDDMRDKVEGLQAGGDDYVTKPFGLEEVVARINAILRRTK 143

Query: 123 SKDENQFL 130
                Q L
Sbjct: 144 HGSSEQPL 151


>gi|229009103|ref|ZP_04166437.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock1-4]
 gi|228752157|gb|EEM01850.1| Two component transcriptional regulator, winged helix [Bacillus
           mycoides Rock1-4]
          Length = 237

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 51/121 (42%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             + +++    +R++ +      G+ V+ A +  E      ++  P+ +V+D  M     
Sbjct: 3   TRIAIIEDEDNIREICKRYLESEGYEVYTAENGEEGWNLF-QQYQPDLIVLDLMMPKKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +RQ    ++V +  L    +    I G   GA+ ++ KPF+   L   ++ L +
Sbjct: 62  WELCEEIRQH---SNVPIIILTARAEERDRILGLTIGADDYVTKPFSPRELVLRVQILLR 118

Query: 120 M 120
            
Sbjct: 119 R 119


>gi|115375378|ref|ZP_01462640.1| multi-sensor Hybrid Histidine Kinase [Stigmatella aurantiaca
           DW4/3-1]
 gi|115367580|gb|EAU66553.1| multi-sensor Hybrid Histidine Kinase [Stigmatella aurantiaca
           DW4/3-1]
          Length = 1358

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/136 (19%), Positives = 51/136 (37%), Gaps = 7/136 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +LL D +  +R     L    G+ V        A    +    P+ ++ D  M      
Sbjct: 688 RILLADDNADIRGYVTQLLTAQGWTVETVPDGEAALARAQAHP-PHLVLTDVMMPRLDGF 746

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  ++       V V  L      E  + G + GA+ +L+KPF+ + L   +    ++
Sbjct: 747 GLLRALKAHEKTQHVPVILLSARAGEEATVEGMQQGADDYLVKPFSAKELVSRVAARLEI 806

Query: 121 QKSKDE----NQFLDA 132
            +++ E     + L A
Sbjct: 807 ARARSEAALAQERLHA 822



 Score =  114 bits (287), Expect = 4e-24,   Method: Composition-based stats.
 Identities = 30/111 (27%), Positives = 42/111 (37%), Gaps = 3/111 (2%)

Query: 2    DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
              +LLV+ S  +R        + G  V  A    E  E     L P+  +ID  + G   
Sbjct: 1211 QRILLVEDSADIRDSLSDFLEELGHEVAAARDGVEGVEQLLA-LRPDVALIDVGLPGIDG 1269

Query: 60   LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETL 110
             E    VR  P G  +++  L      E      RAG +  L KP N + L
Sbjct: 1270 YEVARRVRAAPGGEQLYLVALTGYGGPEARAKAKRAGFDLHLTKPINIDEL 1320


>gi|77359551|ref|YP_339126.1| transcriptional regulator [Pseudoalteromonas haloplanktis TAC125]
 gi|76874462|emb|CAI85683.1| phosphate regulon transcriptional regulatory protein phoB
           [Pseudoalteromonas haloplanktis TAC125]
          Length = 229

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/132 (18%), Positives = 51/132 (38%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++   +    GF   EA     A      E  P+ +++D  + G   
Sbjct: 3   RKVLVVDDEAPIREMLVFVLEQNGFQAIEAEDYDSAIAAMV-EPYPDMVLLDWMLPGGSG 61

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                  +Q      + +  L    + E  + G   GA+ ++ KPF+ + L   ++ + +
Sbjct: 62  IQIAKKFKQNEYTRAIPIIMLTARGEEEDKVRGLEVGADDYVTKPFSPKELMARIKAVIR 121

Query: 120 MQKSKDENQFLD 131
                   + +D
Sbjct: 122 RVSPTSLEEAID 133


>gi|238794386|ref|ZP_04637997.1| Transcriptional regulator in 2-component system [Yersinia
           intermedia ATCC 29909]
 gi|238726287|gb|EEQ17830.1| Transcriptional regulator in 2-component system [Yersinia
           intermedia ATCC 29909]
          Length = 232

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 31/133 (23%), Positives = 52/133 (39%), Gaps = 7/133 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +LLVD    +  + + L    GF V  A    +A      +   + L++D  M    
Sbjct: 1   MHKILLVDDDRELTSLLKELLEMEGFNVVVAYDGEQALNLL--DNSIDLLLLDIMMPRKN 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E +  +RQ        V  L         + G   GA+ +L KPFN   L   +R + 
Sbjct: 59  GIETLKELRQH---HQTPVIMLTARGSELDRVLGLELGADDYLAKPFNDRELVARIRAIL 115

Query: 119 QMQKSKDENQFLD 131
           +     ++ Q +D
Sbjct: 116 RRSNWSEQQQNVD 128


>gi|121535090|ref|ZP_01666907.1| two component transcriptional regulator, winged helix family
           [Thermosinus carboxydivorans Nor1]
 gi|121306340|gb|EAX47265.1| two component transcriptional regulator, winged helix family
           [Thermosinus carboxydivorans Nor1]
          Length = 230

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+V+    +R++ R      G++V EA     A     +E  P+ +V+D  + G+   
Sbjct: 4   KILIVEDEANIRELVRFNLAKEGYVVLEAEDGNAALALARRE-RPDLIVLDLMLPGMDGL 62

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++       + +  L  + +    I G   GA+ +++KPF+   L   ++ + + 
Sbjct: 63  DVCRILKGSSETAGMAIIMLTAKAEEVDKIIGLELGADDYMVKPFSPRELLARIKAVLRR 122

Query: 121 QK 122
            K
Sbjct: 123 SK 124


>gi|108805802|ref|YP_645739.1| two component transcriptional regulator [Rubrobacter xylanophilus
           DSM 9941]
 gi|108767045|gb|ABG05927.1| two component transcriptional regulator, winged helix family
           [Rubrobacter xylanophilus DSM 9941]
          Length = 225

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 49/127 (38%), Gaps = 1/127 (0%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    + ++ +      G+ V  A    E     E+ L P+ +V+D  + G+  
Sbjct: 5   TRILVVEDDPSIARLLQLELEHRGYEVCCAADGEEGLAAFER-LRPDVVVLDIMLPGMDG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R    G    V  L         +     GA+ +L KPF  E L   MR + +  
Sbjct: 64  VGVLRRLREAGHRTPVIMLTARDATGDKVHSLDRGADDYLTKPFEVEELLARMRAVLRRV 123

Query: 122 KSKDENQ 128
           + ++  +
Sbjct: 124 EGEEVLR 130


>gi|326804031|ref|YP_004321849.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Aerococcus urinae ACS-120-V-Col10a]
 gi|326650605|gb|AEA00788.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Aerococcus urinae ACS-120-V-Col10a]
          Length = 235

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 48/124 (38%), Gaps = 6/124 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  +        G+    A    EA E       P+ +V+D  +    
Sbjct: 1   MKKILVVDDEKPISDIITFNLQKEGYDTLAAFDGEEALESF-ASYQPDLIVLDLMLPKKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            LE    +R+    + V +  L  + +    + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GLEVCREIRK---TSSVPIIMLTAKGEEIDKVLGLEMGADDYVTKPFSNRELSARIKANL 116

Query: 119 QMQK 122
           +  +
Sbjct: 117 RRSQ 120


>gi|228911305|ref|ZP_04075109.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 200]
 gi|228848323|gb|EEM93173.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis IBL 200]
          Length = 234

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E   +E  P+ +++D  + G   
Sbjct: 3   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEE-QPDMVLLDIMLPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  LEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|219850153|ref|YP_002464586.1| winged helix family two component transcriptional regulator
           [Chloroflexus aggregans DSM 9485]
 gi|219544412|gb|ACL26150.1| two component transcriptional regulator, winged helix family
           [Chloroflexus aggregans DSM 9485]
          Length = 231

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/125 (20%), Positives = 51/125 (40%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+VD    +R++ R      GF V +A     A E       P+ +++D  +  +   
Sbjct: 5   TILIVDDEARLRELVRRYLEQAGFRVVQAADGVTALEQARA-WTPDVVILDIMLPVLDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R     +D ++  L    +    + G   GA+ +L KPF    L   +R L + 
Sbjct: 64  AVCRRLR---TFSDAYILMLTARAEESDRVTGLETGADDYLTKPFAPRELVARVRALLRR 120

Query: 121 QKSKD 125
            +  +
Sbjct: 121 PRHTE 125


>gi|78213892|ref|YP_382671.1| two component transcriptional regulator [Synechococcus sp. CC9605]
 gi|78198351|gb|ABB36116.1| two component transcriptional regulator, winged helix family
           [Synechococcus sp. CC9605]
          Length = 259

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/125 (23%), Positives = 54/125 (43%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++     +  G+ V  A    EA E       P+ +V+D  M      
Sbjct: 21  TILVVDDEASIRRILETRLSMIGYNVVTACDGTEALELFPT-CTPDLVVLDVMMPKLDGY 79

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    D    I G   GA+ +++KPF+ + L   +R L + 
Sbjct: 80  GVCQELRKE---SDVPIVMLTALGDVADRITGLELGADDYVVKPFSPKELEARIRCLLRR 136

Query: 121 QKSKD 125
            + + 
Sbjct: 137 VEKEQ 141


>gi|284006387|emb|CBA71623.1| two-component system, OmpR family, phosphate regulon response
           regulator [Arsenophonus nasoniae]
          Length = 234

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/132 (19%), Positives = 56/132 (42%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +R++   +    GF   EA     A      E  P  +++D  + G   
Sbjct: 8   RRILVVEDETAIREMVCFVLEQNGFQTVEADDYDSAIAQLI-EPYPALILLDWMIPGGSG 66

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
              IAH+++  L  ++ +  L    + E  + G   GA+ +L KPF+ + L   +  + +
Sbjct: 67  IQLIAHMKRDQLTRNIPIMMLTARGEEEDRVRGLEIGADDYLTKPFSPKELIARVNAILR 126

Query: 120 MQKSKDENQFLD 131
              +   +  ++
Sbjct: 127 RVSAMASDNVIE 138


>gi|111220170|ref|YP_710964.1| putative two-component system response regulator [Frankia alni
           ACN14a]
 gi|111147702|emb|CAJ59359.1| Putative two-component system response regulator (partial match)
           [Frankia alni ACN14a]
          Length = 358

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/124 (23%), Positives = 49/124 (39%), Gaps = 1/124 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++        G+ V  A     A     +E  P+ +V+D  +  +   
Sbjct: 20  RVLVVDDETTLAELLSMALRYEGWEVRSAGDGRGALRLA-REFRPDAVVLDIMLPDMDGL 78

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R      DV V +L      E  +AG  AG + ++ KPF+ E L   +R L +   
Sbjct: 79  EVLRRLRAESPDVPVLFLTARDAVEDRVAGLTAGGDDYVTKPFSLEELVARLRGLMRRAA 138

Query: 123 SKDE 126
              E
Sbjct: 139 RTTE 142


>gi|77461827|ref|YP_351334.1| two component transcriptional regulator [Pseudomonas fluorescens
           Pf0-1]
 gi|77385830|gb|ABA77343.1| phosphate regulon two-component system, response regulator
           [Pseudomonas fluorescens Pf0-1]
          Length = 229

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCLEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|89096800|ref|ZP_01169692.1| DNA-binding response regulator [Bacillus sp. NRRL B-14911]
 gi|89088815|gb|EAR67924.1| DNA-binding response regulator [Bacillus sp. NRRL B-14911]
          Length = 236

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V  A    EA E  E E+ P+ +++D  +     
Sbjct: 3   KKILVVDDEKPIADILQFNLKKEGYEVHCAYDGNEALEKVE-EVKPDLILLDIMLPQRDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  MEVCREVRKKYE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSNRELIARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|84684965|ref|ZP_01012865.1| Phosphate regulon transcriptional regulator, PhoR [Maritimibacter
           alkaliphilus HTCC2654]
 gi|84667300|gb|EAQ13770.1| Phosphate regulon transcriptional regulator, PhoR [Rhodobacterales
           bacterium HTCC2654]
          Length = 229

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 58/130 (44%), Gaps = 3/130 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +LLV+     R++ R+     G+ V  A +  +A    E E+ P+ +++D  + G   +E
Sbjct: 8   VLLVEDEPAQREILRYNLASEGYDVSIAENGDDAMVLVE-EIGPDLILLDWMLPGVSGIE 66

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               V+     TD+ V  L    D    + G   GA+ +++KPF+ + L   +R   +  
Sbjct: 67  ICRRVKSRRETTDIPVIMLSARSDEMDRVRGLETGADDYMVKPFSVQELMARIRTQLRRT 126

Query: 122 KSKDENQFLD 131
           +     Q L 
Sbjct: 127 RPASVGQQLA 136


>gi|311070584|ref|YP_003975507.1| YycF protein [Bacillus atrophaeus 1942]
 gi|310871101|gb|ADP34576.1| YycF [Bacillus atrophaeus 1942]
          Length = 236

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 50/122 (40%), Gaps = 6/122 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  +        G+ V  A    EA E  E E+ P+ +++D  +     
Sbjct: 4   KKILVVDDEKPIADILEFNLRKEGYEVHCAYDGNEAVEMVE-EIQPDLILLDIMLPNKDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 63  VEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLELGADDYVTKPFSTRELLARVKANLR 119

Query: 120 MQ 121
            Q
Sbjct: 120 RQ 121


>gi|306833967|ref|ZP_07467091.1| response regulator [Streptococcus bovis ATCC 700338]
 gi|304423968|gb|EFM27110.1| response regulator [Streptococcus bovis ATCC 700338]
          Length = 236

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+    A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLAKEGYETVTAFDGREAITKFEEEN-PDLIILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEVRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TENIE 123


>gi|300868611|ref|ZP_07113225.1| two component transcriptional regulator [Oscillatoria sp. PCC 6506]
 gi|300333370|emb|CBN58417.1| two component transcriptional regulator [Oscillatoria sp. PCC 6506]
          Length = 245

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V +A    +  +    ++LP+ +++D  +  V 
Sbjct: 2   MPRILVIDDDPTIAELVAVNLEMAGYEVTQAEDGIKG-QALAIQMLPDLIMLDLMLPRVD 60

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+     D+ V  L      +  + G  +GA+ +L KPF  E +   +R L 
Sbjct: 61  GFTVCQRLRRDDRTADIPVLMLTALGQTQDKVEGFNSGADDYLTKPFELEEMLARVRALL 120

Query: 119 QM 120
           + 
Sbjct: 121 RR 122


>gi|227431461|ref|ZP_03913510.1| response regulator [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
 gi|227352827|gb|EEJ43004.1| response regulator [Leuconostoc mesenteroides subsp. cremoris ATCC
           19254]
          Length = 235

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  + +      G+ V  A    EA +    E  P+ +++D+ +    
Sbjct: 1   MSKVLVVDDEKPISDIIKFNLTKEGYDVVTAADGQEALDMYNDEN-PDLVLLDQMLPEVD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E +  +R     +DV V  +  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GIEVLRQIRSK---SDVPVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANL 116

Query: 119 QMQKSKDE 126
           + +KS  +
Sbjct: 117 RSRKSVSQ 124


>gi|70733391|ref|YP_263166.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas fluorescens Pf-5]
 gi|330806802|ref|YP_004351264.1| phosphate regulon response regulator [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
 gi|68347690|gb|AAY95296.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas fluorescens Pf-5]
 gi|327374910|gb|AEA66260.1| Phosphate regulon response regulator [Pseudomonas brassicacearum
           subsp. brassicacearum NFM421]
          Length = 229

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCMEAENSQQA-HAIIVDRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|322387744|ref|ZP_08061353.1| DNA-binding response regulator [Streptococcus infantis ATCC 700779]
 gi|321141611|gb|EFX37107.1| DNA-binding response regulator [Streptococcus infantis ATCC 700779]
          Length = 234

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/138 (18%), Positives = 59/138 (42%), Gaps = 7/138 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREAIELFEAEK-PDIIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KTIRKTSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118

Query: 121 QKS-----KDENQFLDAI 133
            +      ++E+  L ++
Sbjct: 119 TELVAVDNQEEDTKLQSL 136


>gi|304398989|ref|ZP_07380858.1| two component transcriptional regulator, winged helix family
           [Pantoea sp. aB]
 gi|304353449|gb|EFM17827.1| two component transcriptional regulator, winged helix family
           [Pantoea sp. aB]
          Length = 231

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/130 (22%), Positives = 52/130 (40%), Gaps = 7/130 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M+ +LLVD    +  + + L    GF V  A+   +A      +   + L++D  M    
Sbjct: 1   MNKILLVDDDRELTSLLKELLEMEGFEVVVASDGEQALNLI--DNSIDLLLLDVMMPKKN 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++ +  +RQ        V  L         + G   GA+ +L KPFN   L   +R + 
Sbjct: 59  GIDTLKELRQQ---HQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAIL 115

Query: 119 QMQKSKDENQ 128
           +     ++ Q
Sbjct: 116 RRSNWSEQQQ 125


>gi|94266053|ref|ZP_01289772.1| Response regulator receiver [delta proteobacterium MLMS-1]
 gi|93453375|gb|EAT03803.1| Response regulator receiver [delta proteobacterium MLMS-1]
          Length = 240

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/122 (18%), Positives = 56/122 (45%), Gaps = 3/122 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++L+V+    ++++  +     GF V  A    +A     +E  P+ +++D  + G+   
Sbjct: 12  TILVVEDDENIQQLVGYNLVKAGFQVVYADHGEQALALVFREN-PDLVLLDLMLPGLDGG 70

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+ P    + +  L    D +++ AG   GA+ ++ KPF+ + L   ++   + 
Sbjct: 71  EVCKALRRDPRSRHLPIVMLTARGDEDEISAGLDLGADDYITKPFSPKILVARVKAALRR 130

Query: 121 QK 122
            +
Sbjct: 131 GR 132


>gi|90020314|ref|YP_526141.1| response regulator receiver domain-containing protein [Saccharophagus
            degradans 2-40]
 gi|89949914|gb|ABD79929.1| GGDEF domain [Saccharophagus degradans 2-40]
          Length = 1526

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/120 (22%), Positives = 51/120 (42%), Gaps = 2/120 (1%)

Query: 4    LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
            +L+VD   + RKV  +  +   + V E  S  EA  +       + +++D  M  +   E
Sbjct: 1146 ILIVDDEPVNRKVLANYLSLKYYTVHEVRSGMEAITYVRNGPKVDLILLDIMMPKMSGYE 1205

Query: 62   FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                +RQ     ++ +  L        ++ G  +GAN F+ KP  +E L   +    Q++
Sbjct: 1206 ACKQLRQQYSANELPIILLTARSQVSDLVTGFNSGANDFITKPIAKEELLARVHTHLQLR 1265


>gi|300865288|ref|ZP_07110102.1| Response regulator receiver domain protein [Oscillatoria sp. PCC
           6506]
 gi|300336761|emb|CBN55252.1| Response regulator receiver domain protein [Oscillatoria sp. PCC
           6506]
          Length = 403

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 30/136 (22%), Positives = 61/136 (44%), Gaps = 7/136 (5%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+VD +     V      +  F V  A     A E  E  + P+ +++D  M G+  F 
Sbjct: 11  ILIVDDNQTNLDVLFDFLRNCNFKVLVALDGESAIEQLEY-VRPDLILLDVMMPGIDGFE 69

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ-- 119
             + ++ +P   D+ V ++    D    + G ++GA  ++ KPF  E +   ++      
Sbjct: 70  TCSRLKAIPATKDIPVIFMTALSDTVNKVRGFQSGAVDYITKPFQHEEVLSRIQTHLTIC 129

Query: 120 --MQKSKDENQFLDAI 133
              +K +++N+ L A+
Sbjct: 130 KLQKKLQEKNEQLAAL 145


>gi|300790130|ref|YP_003770421.1| two-component system response regulator [Amycolatopsis mediterranei
           U32]
 gi|299799644|gb|ADJ50019.1| two-component system response regulator [Amycolatopsis mediterranei
           U32]
          Length = 233

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 33/123 (26%), Positives = 54/123 (43%), Gaps = 6/123 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +L+VD    VR V R      GF V  A +  E          P+ +V+D  M G   L
Sbjct: 7   RVLVVDDDETVRDVVRRYLEVAGFTVDVAGNGAEGLAKFGAHE-PDLVVLDVMMPGINGL 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +RQ+   + V +  L    + E  IAG + GA+ ++ KPF+ + L   +  + + 
Sbjct: 66  EVCKRLRQV---SQVPIVMLTALGEEENRIAGLQLGADDYVTKPFSPKELALRVASVLRR 122

Query: 121 QKS 123
            + 
Sbjct: 123 ARM 125


>gi|317484883|ref|ZP_07943773.1| response regulator receiver domain-containing protein [Bilophila
           wadsworthia 3_1_6]
 gi|316923865|gb|EFV45061.1| response regulator receiver domain-containing protein [Bilophila
           wadsworthia 3_1_6]
          Length = 228

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 50/121 (41%), Gaps = 3/121 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+    +R++  +     G+   +A    E  E   +   P+ +++D  +  +   
Sbjct: 7   TILIVEDEQDIRELLAYNLEKEGYATVQAADGKEGLELA-RSRKPDLILLDLMLPKMDGL 65

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                + +      + +  L    +    I G   GA+ +++KPFN   L   +R + + 
Sbjct: 66  AVCRELERDSGTVRIPIIMLTARGEDVDRILGFELGADDYVVKPFNIRELLLRIRAILRR 125

Query: 121 Q 121
           Q
Sbjct: 126 Q 126


>gi|307708758|ref|ZP_07645220.1| DNA-binding response regulator [Streptococcus mitis NCTC 12261]
 gi|307615124|gb|EFN94335.1| DNA-binding response regulator [Streptococcus mitis NCTC 12261]
          Length = 235

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 51/120 (42%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ V  A +  EA E  E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNMTKEGYEVVTAFNGREALEQFEAE-QPDIIILDLMLPEID 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 + +   + V +  L  +      + G   GA+ ++ KPF+   L+  ++ L + 
Sbjct: 60  GLEVA-KTIRKTSSVPIIMLSAKDSEFDKVIGLELGADDYVTKPFSNRELQARVKALLRR 118


>gi|295102835|emb|CBL00380.1| Response regulators consisting of a CheY-like receiver domain and a
           winged-helix DNA-binding domain [Faecalibacterium
           prausnitzii L2-6]
          Length = 228

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 50/128 (39%), Gaps = 5/128 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +R++ R      G+   EA     A          + +++D  M  + 
Sbjct: 1   MAKILIVDDEPRIRELIRENLQYSGYTCEEAGDGSAALSLLTGGGY-DLVILDLMMPFMD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
               +  +R   +  +  V  L    +    +AG   GA+ +++KPF+   L   ++ + 
Sbjct: 60  GMSCLREMRTRRI--NTPVIILTARGEEYDKLAGLEGGADDYVVKPFSPRELVARVKAVL 117

Query: 119 QMQKSKDE 126
                + E
Sbjct: 118 NRTMPRTE 125


>gi|186686341|ref|YP_001869537.1| two component transcriptional regulator [Nostoc punctiforme PCC
           73102]
 gi|186468793|gb|ACC84594.1| two component transcriptional regulator, winged helix family
           [Nostoc punctiforme PCC 73102]
          Length = 241

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/120 (20%), Positives = 49/120 (40%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
            +L+VD    +R++     +  G+ V  A+   EA         P+ +V+D  M      
Sbjct: 7   KILVVDDEASIRRILETRLSMIGYDVVTASDGEEALSTFRVST-PDLIVLDVMMPKLDGY 65

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +DV +  L    +    I G   GA+ ++ KPF+ + L   +  + + 
Sbjct: 66  GVCQELRKE---SDVPIIMLTALGNVADRITGLELGADDYMTKPFSPKELEARIACILRR 122


>gi|228907029|ref|ZP_04070894.1| Two-component response regulator [Bacillus thuringiensis IBL 200]
 gi|228852620|gb|EEM97409.1| Two-component response regulator [Bacillus thuringiensis IBL 200]
          Length = 218

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 61/129 (47%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA    EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAEDGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|311897734|dbj|BAJ30142.1| putative two-component system response regulator [Kitasatospora
           setae KM-6054]
          Length = 256

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 30/116 (25%), Positives = 46/116 (39%), Gaps = 1/116 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R          G+ V  AT   EA    E++  P+ +++D  M  +   
Sbjct: 18  RVLVVDDEPALRDALESSLAFEGYQVATATDGYEALAAVERD-RPDLVLLDIMMPRMDGL 76

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            A  R    G  V V  L         + G   GA+ +L KPF  + L   +R L 
Sbjct: 77  TAVRRMRSRGDTVPVLMLTARDAVGDRVTGLDVGADDYLAKPFELDELLARVRALL 132


>gi|47565258|ref|ZP_00236300.1| DNA-binding response regulator VicR [Bacillus cereus G9241]
 gi|208742147|ref|YP_002267599.1| two component transcriptional regulator [Bacillus cereus]
 gi|47557612|gb|EAL15938.1| DNA-binding response regulator VicR [Bacillus cereus G9241]
          Length = 237

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 51/121 (42%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+++    +R+V +       + V+ A +  E  E       P+ +++D  M     
Sbjct: 3   KRILIIEDEENIREVCKQYLEREEYEVYTAVNGKEGWELFLTH-QPDLIILDLMMPQKNG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +RQ    ++V +  L  + +    I G   GA+ +L KPF+   L   ++ + +
Sbjct: 62  WELCEEIRQK---SNVPIIMLTAKGEERNRILGLTIGADDYLTKPFSPHELVLRIQIIFR 118

Query: 120 M 120
            
Sbjct: 119 R 119


>gi|329956866|ref|ZP_08297434.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein
            [Bacteroides clarus YIT 12056]
 gi|328523623|gb|EGF50715.1| ATPase/histidine kinase/DNA gyrase B/HSP90 domain protein
            [Bacteroides clarus YIT 12056]
          Length = 1474

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/127 (18%), Positives = 56/127 (44%), Gaps = 4/127 (3%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+L+V+ +  +R   ++  ++  + V  A +  E  +    + LP+ ++ D  M  +   
Sbjct: 1218 SILVVEDNKELRTFLKNSLSEH-YTVITAANGKEGLQHAI-DDLPDLIISDVMMPVMDGL 1275

Query: 63   I--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++      + +  L  +   +  IAG   G + ++ KPF+   L+  +  L + 
Sbjct: 1276 EMVKQIKENSAICHIPIIILSAKASLDDRIAGLEQGIDDYITKPFSATYLKTRIITLLRQ 1335

Query: 121  QKSKDEN 127
            +KS  E 
Sbjct: 1336 RKSLQEM 1342


>gi|300864253|ref|ZP_07109133.1| putative adenylate/guanylate cyclase [Oscillatoria sp. PCC 6506]
 gi|300337718|emb|CBN54279.1| putative adenylate/guanylate cyclase [Oscillatoria sp. PCC 6506]
          Length = 1140

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 57/122 (46%), Gaps = 2/122 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   +  +V  +  +   + V +AT+  EA E  E    P+ +++D  M  +   
Sbjct: 730 KILIVDDEPVNIQVLINNLSVLKYEVTQATNGFEALEIIENGFRPDLILLDVMMPRMSGY 789

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +R+     ++ +  L  +     ++ G  +GAN +L KPF++  L   ++   ++
Sbjct: 790 EVCQILREKFPAIELPIVMLTAKNQVTDLVEGFNSGANDYLSKPFSKNELLARIKTHIRL 849

Query: 121 QK 122
            K
Sbjct: 850 AK 851


>gi|229065125|ref|ZP_04200418.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH603]
 gi|228716154|gb|EEL67873.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH603]
          Length = 234

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E   +E  P+ +++D  + G   
Sbjct: 3   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEE-QPDMVLLDIMLPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  LEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|160886917|ref|ZP_02067920.1| hypothetical protein BACOVA_04931 [Bacteroides ovatus ATCC 8483]
 gi|156107328|gb|EDO09073.1| hypothetical protein BACOVA_04931 [Bacteroides ovatus ATCC 8483]
          Length = 1446

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 61/134 (45%), Gaps = 7/134 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+L+V+ +  ++   + + +   + V  A++  E  +    + LP+ ++ D  M  +   
Sbjct: 1188 SILVVEDNEELKAFLKSILS-ENYTVITASNGEEGLQHAV-DDLPDLIISDVMMPVMDGL 1245

Query: 63   --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              I  +++      + +  L  +   +  IAG   G + ++ KPF+   L+  +  L + 
Sbjct: 1246 EMIRQIKENNNICHIPIIVLSAKASLDDRIAGLEQGIDDYITKPFSATYLKTRVASLLRQ 1305

Query: 121  QKSKDE---NQFLD 131
            +K+  E   N+ ++
Sbjct: 1306 RKALQELYMNRLME 1319


>gi|154486694|ref|ZP_02028101.1| hypothetical protein BIFADO_00515 [Bifidobacterium adolescentis
           L2-32]
 gi|154084557|gb|EDN83602.1| hypothetical protein BIFADO_00515 [Bifidobacterium adolescentis
           L2-32]
          Length = 234

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 50/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 1   MTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGLD 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYITKPYSFRELLARIRAVL 116

Query: 119 QMQKSKDE 126
           +  +   E
Sbjct: 117 RRNQMVAE 124


>gi|312127464|ref|YP_003992338.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor hydrothermalis 108]
 gi|311777483|gb|ADQ06969.1| two component transcriptional regulator, winged helix family
           [Caldicellulosiruptor hydrothermalis 108]
          Length = 232

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/127 (22%), Positives = 56/127 (44%), Gaps = 3/127 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M S+L+VD    + ++ +      G+  FEA S  +A E   K    + +++D  M    
Sbjct: 1   MKSILIVDDEQHILELLKFNLRKEGYNTFEADSGLQALEIL-KHNKVDLVILDIMMSDKD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             E +  +R      ++ V  L  + +    I G   GA+ ++ KPF+ + L   ++ L 
Sbjct: 60  GYEVLKEIRFNKDTKNLPVILLSAKSEEIDKILGLELGADDYITKPFSVKELVVRVKALL 119

Query: 119 QMQKSKD 125
           +  +S  
Sbjct: 120 RRVESLK 126


>gi|225574100|ref|ZP_03782711.1| hypothetical protein RUMHYD_02165 [Blautia hydrogenotrophica DSM
           10507]
 gi|225038700|gb|EEG48946.1| hypothetical protein RUMHYD_02165 [Blautia hydrogenotrophica DSM
           10507]
          Length = 242

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 19/121 (15%), Positives = 49/121 (40%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD  + + ++         +         +A    E    P+ +++D  + G+  
Sbjct: 15  QKILIVDDDNNIAELIALYLTKECYDTCIVNDGEQALREFE-HFRPDLILLDLMLPGMDG 73

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R     +DV +  L  + +    + G   GA+ +++KPF+ + L   ++ + +
Sbjct: 74  YQVCREIR---HTSDVPIIMLSAKGETFDKVLGLELGADDYIIKPFDSKELVARVKAVLR 130

Query: 120 M 120
            
Sbjct: 131 R 131


>gi|256848492|ref|ZP_05553934.1| phosphate regulon transcriptional regulatory protein PhoB
           [Lactobacillus coleohominis 101-4-CHN]
 gi|256714759|gb|EEU29738.1| phosphate regulon transcriptional regulatory protein PhoB
           [Lactobacillus coleohominis 101-4-CHN]
          Length = 235

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/124 (16%), Positives = 48/124 (38%), Gaps = 2/124 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +  + +      G+ V  A    E  E  E +  P+ +++D  +  +  
Sbjct: 3   NKVLVVDDEKPISDIIKFNLEKEGYEVVTAFDGEEGLEKVESD-QPDLIILDLMLPKIDG 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R      +  +  +  +      + G   GA+ ++ KPF+   L   ++   + Q
Sbjct: 62  LEVAKRVRAKH-NTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRRQ 120

Query: 122 KSKD 125
            + +
Sbjct: 121 DAAN 124


>gi|237721203|ref|ZP_04551684.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 2_2_4]
 gi|229448999|gb|EEO54790.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. 2_2_4]
          Length = 1446

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 61/134 (45%), Gaps = 7/134 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+L+V+ +  ++   + + +   + V  A++  E  +    + LP+ ++ D  M  +   
Sbjct: 1188 SILVVEDNEELKAFLKSILS-ENYTVITASNGEEGLQHAV-DDLPDLIISDVMMPVMDGL 1245

Query: 63   --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              I  +++      + +  L  +   +  IAG   G + ++ KPF+   L+  +  L + 
Sbjct: 1246 EMIRQIKENNNICHIPIIVLSAKASLDDRIAGLEQGIDDYITKPFSATYLKTRVASLLRQ 1305

Query: 121  QKSKDE---NQFLD 131
            +K+  E   N+ ++
Sbjct: 1306 RKALQELYMNRLME 1319


>gi|310642600|ref|YP_003947358.1| two component transcriptional regulator, winged helix family
           [Paenibacillus polymyxa SC2]
 gi|309247550|gb|ADO57117.1| Two component transcriptional regulator, winged helix family
           [Paenibacillus polymyxa SC2]
          Length = 238

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/121 (17%), Positives = 51/121 (42%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
           + +L+VD    +R++ R      G+ + EA     A +        + +++D  + G+  
Sbjct: 6   NRILIVDDEERIRRLLRMYLEKEGYEIEEAEDGEIALQKATASDY-SIILLDVMLPGMDG 64

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +RQ        V  L  + +    + G   GA+ +++KPF+   + + ++ + +
Sbjct: 65  IEVCTRLRQ---TKSTPVIMLTAKGEEVNRVQGFEVGADDYVVKPFSPREVIYRVKAILR 121

Query: 120 M 120
            
Sbjct: 122 R 122


>gi|302391634|ref|YP_003827454.1| two component transcriptional regulator, winged helix family
           [Acetohalobium arabaticum DSM 5501]
 gi|302203711|gb|ADL12389.1| two component transcriptional regulator, winged helix family
           [Acetohalobium arabaticum DSM 5501]
          Length = 235

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/127 (19%), Positives = 53/127 (41%), Gaps = 3/127 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    + ++ +      G+ VF       A +  ++E   + LV+D  +   G 
Sbjct: 4   KKILVVDDEENIVELVKFNLEKEGYQVFVTYDGQAALDKLQEED-IDLLVLDLMLPEIGG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           L+    +R     +D+ +  L  +      I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  LDICRQIRNDDELSDLPIIMLTAKEKEVDRILGLELGADDYVTKPFSPRELVARVKAILR 122

Query: 120 MQKSKDE 126
              S  +
Sbjct: 123 RTGSSGQ 129


>gi|297545525|ref|YP_003677827.1| winged helix family two component transcriptional regulator
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
 gi|296843300|gb|ADH61816.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter mathranii subsp. mathranii str. A3]
          Length = 227

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 52/129 (40%), Gaps = 6/129 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            + +VD    + ++        GF V +      A +  +    P  +++D  + G+   
Sbjct: 6   KIYVVDDDKNICEIVSLYLEKEGFEVEQIYDGQTALKKIQTNP-PRLVILDIMLPGIDGI 64

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                VR+    + V +  L  + D    +     GA+ +++KPF+ + L   ++ + + 
Sbjct: 65  ALCREVRK---FSKVPIIMLTAKGDTLDKVLALEIGADDYIVKPFDGKELIARVKAVLRR 121

Query: 121 QKSKDENQF 129
            + + + + 
Sbjct: 122 YEPESDERR 130


>gi|163854786|ref|YP_001629084.1| response regulator [Bordetella petrii DSM 12804]
 gi|163258514|emb|CAP40813.1| response regulator [Bordetella petrii]
          Length = 232

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/131 (19%), Positives = 57/131 (43%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
           ++L+V+    ++++     +  G  V  A    +A      E LP+ +++D  + G   L
Sbjct: 4   TILVVEDEPAIQELIAVNLSFAGHKVLRAFDAEQAHTLIRAE-LPDLILLDWMLPGTSGL 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R       V V  L  +   +  + G  AGA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  TLARKLRDDERTRAVPVIMLTAKGAEQDKVEGLEAGADDYITKPFSPKELMARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
           +  +  +  +D
Sbjct: 123 RAPQLTDDIID 133


>gi|6689352|emb|CAB65451.1| VicR protein [Streptococcus pyogenes]
          Length = 239

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 52/125 (41%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ +  A    EA    E+E  P+ +++D  +  + 
Sbjct: 4   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTIFEEEK-PDLIILDLMLPELD 62

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + V +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 63  GLEVA-KEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 121

Query: 121 QKSKD 125
            ++ +
Sbjct: 122 TETIE 126


>gi|319762025|ref|YP_004125962.1| response regulator receiver [Alicycliphilus denitrificans BC]
 gi|330826156|ref|YP_004389459.1| winged helix family two component transcriptional regulator
           [Alicycliphilus denitrificans K601]
 gi|317116586|gb|ADU99074.1| response regulator receiver [Alicycliphilus denitrificans BC]
 gi|329311528|gb|AEB85943.1| two component transcriptional regulator, winged helix family
           [Alicycliphilus denitrificans K601]
          Length = 243

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/123 (21%), Positives = 44/123 (35%), Gaps = 1/123 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R + R      GF V  A     A          + +V+D  M G    
Sbjct: 10  KVLVVDDDARIRDLLRRYLTQEGFEVMVAEDGK-ALNRILLRETVDLIVLDLMMPGEDGL 68

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R         +  L  + +    I G   GA+ +L KPFN   L   +  + + + 
Sbjct: 69  SICRRLRAASDRTPIIMLTAKGEDVDRIVGLEVGADDYLGKPFNPRELLARIHAVLRRRP 128

Query: 123 SKD 125
            ++
Sbjct: 129 PQE 131


>gi|296112289|ref|YP_003626227.1| two-component system response regulator [Moraxella catarrhalis RH4]
 gi|295919983|gb|ADG60334.1| two-component system response regulator [Moraxella catarrhalis RH4]
 gi|326561799|gb|EGE12134.1| osmolarity response regulator [Moraxella catarrhalis 7169]
 gi|326562259|gb|EGE12585.1| osmolarity response regulator [Moraxella catarrhalis 103P14B1]
 gi|326563236|gb|EGE13503.1| osmolarity response regulator [Moraxella catarrhalis 46P47B1]
 gi|326564762|gb|EGE14975.1| osmolarity response regulator [Moraxella catarrhalis 12P80B1]
 gi|326568975|gb|EGE19044.1| osmolarity response regulator [Moraxella catarrhalis BC1]
 gi|326569275|gb|EGE19336.1| osmolarity response regulator [Moraxella catarrhalis BC7]
 gi|326571952|gb|EGE21957.1| osmolarity response regulator [Moraxella catarrhalis BC8]
 gi|326575462|gb|EGE25387.1| osmolarity response regulator [Moraxella catarrhalis 101P30B1]
 gi|326576449|gb|EGE26357.1| osmolarity response regulator [Moraxella catarrhalis CO72]
 gi|326577920|gb|EGE27784.1| osmolarity response regulator [Moraxella catarrhalis O35E]
          Length = 244

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 51/122 (41%), Gaps = 1/122 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R + +    D G++V  A    +  +      + + +V+D  +      
Sbjct: 11  RILVVDDDARLRTLLQRFLEDDGYVVRVAHDGKQ-MDKLIAREMFSLIVLDLMLPDEDGI 69

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R     + + +  L  +      IAG  AGA+ +L KPFN + L   ++ + + Q 
Sbjct: 70  AICKRLRAENSSIPIIMLTAKGSDADRIAGLEAGADDYLPKPFNPKELLARIKAVLRRQN 129

Query: 123 SK 124
            +
Sbjct: 130 RE 131


>gi|291457143|ref|ZP_06596533.1| DNA-binding response regulator RegX3 [Bifidobacterium breve DSM
           20213]
 gi|291380978|gb|EFE88496.1| DNA-binding response regulator RegX3 [Bifidobacterium breve DSM
           20213]
          Length = 234

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 22/128 (17%), Positives = 51/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 1   MTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGID 59

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 60  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYVTKPYSFRELLARIRAVM 116

Query: 119 QMQKSKDE 126
           +  ++  +
Sbjct: 117 RRNQATAQ 124


>gi|332654461|ref|ZP_08420204.1| DNA-binding response regulator SrrA [Ruminococcaceae bacterium D16]
 gi|332516425|gb|EGJ46031.1| DNA-binding response regulator SrrA [Ruminococcaceae bacterium D16]
          Length = 233

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 18/127 (14%), Positives = 54/127 (42%), Gaps = 2/127 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    + ++        GF    A    +  E+  +   P  +++D  +  +  
Sbjct: 3   QKVLIVEDDSNIAELLHLYLEKEGFETKVAKDGGKGVEYF-RSFQPALVLLDIMLPVMDG 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           +   ++++   +   V  L  + + E  + G  +GA+ +++KPF  + +   +  + +  
Sbjct: 62  WTV-LKKIREESATPVIMLTAKGETEDKVTGLESGADDYIVKPFEMKEVLARIHAVMRRT 120

Query: 122 KSKDENQ 128
             ++E +
Sbjct: 121 GQEEEQE 127


>gi|218900607|ref|YP_002449018.1| DNA-binding response regulator YycF [Bacillus cereus G9842]
 gi|218545115|gb|ACK97509.1| DNA-binding response regulator YycF [Bacillus cereus G9842]
          Length = 235

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E   +E  P+ +++D  + G   
Sbjct: 4   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEE-QPDMVLLDIMLPGKDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 63  LEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 119

Query: 120 MQKS 123
             + 
Sbjct: 120 RHQQ 123


>gi|322411348|gb|EFY02256.1| Two-component response regulator [Streptococcus dysgalactiae subsp.
           dysgalactiae ATCC 27957]
          Length = 236

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+ +  A    EA    E E  P+ +++D  +  + 
Sbjct: 1   MKKILIVDDEKPISDIIKFNLTKEGYDIVTAFDGREAVTVFEDEK-PDLIILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + V +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHVPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|260171744|ref|ZP_05758156.1| two-component system sensor histidine kinase/response regulator,
            hybrid ('one-component system') [Bacteroides sp. D2]
 gi|315920056|ref|ZP_07916296.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. D2]
 gi|313693931|gb|EFS30766.1| two-component system sensor histidine kinase/response regulator
            [Bacteroides sp. D2]
          Length = 1446

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/134 (17%), Positives = 61/134 (45%), Gaps = 7/134 (5%)

Query: 3    SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            S+L+V+ +  ++   + + +   + V  A++  E  +    + LP+ ++ D  M  +   
Sbjct: 1188 SILVVEDNEELKAFLKSILS-ENYTVITASNGEEGLQHAV-DDLPDLIISDVMMPVMDGL 1245

Query: 63   --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              I  +++      + +  L  +   +  IAG   G + ++ KPF+   L+  +  L + 
Sbjct: 1246 EMIRQIKENNNICHIPIIVLSAKASLDDRIAGLEQGIDDYITKPFSATYLKTRVASLLRQ 1305

Query: 121  QKSKDE---NQFLD 131
            +K+  E   N+ ++
Sbjct: 1306 RKALQELYMNRLME 1319


>gi|157694431|ref|YP_001488893.1| response regulator [Bacillus pumilus SAFR-032]
 gi|194016445|ref|ZP_03055059.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Bacillus pumilus ATCC 7061]
 gi|157683189|gb|ABV64333.1| response regulator [Bacillus pumilus SAFR-032]
 gi|194011918|gb|EDW21486.1| alkaline phosphatase synthesis transcriptional regulatory
           proteinphoP [Bacillus pumilus ATCC 7061]
          Length = 235

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 50/122 (40%), Gaps = 6/122 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  +        G+ V  A    EA E  E E+ P+ +++D  +     
Sbjct: 3   KKILVVDDEKPIADILEFNLRKEGYEVHCAYDGNEALEMVE-EIKPDIILLDIMLPNKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  VEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQ 121
            Q
Sbjct: 119 RQ 120


>gi|331005887|ref|ZP_08329239.1| Phosphate regulon transcriptional regulatory protein PhoB [gamma
           proteobacterium IMCC1989]
 gi|330420331|gb|EGG94645.1| Phosphate regulon transcriptional regulatory protein PhoB [gamma
           proteobacterium IMCC1989]
          Length = 233

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/132 (15%), Positives = 55/132 (41%), Gaps = 3/132 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R + R       +   EA     A      +  P+ +++D  + G   
Sbjct: 5   KTILIVDDESAIRDMLRVALEMADYHCLEAADTQSAHALIIDQK-PSLILLDWMLPGTSG 63

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           ++    +++     D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 64  IDLARRLKKDEFTADIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 123

Query: 120 MQKSKDENQFLD 131
             +     + ++
Sbjct: 124 RTEGISAAELIE 135


>gi|167036595|ref|YP_001664173.1| two component transcriptional regulator [Thermoanaerobacter
           pseudethanolicus ATCC 33223]
 gi|167039247|ref|YP_001662232.1| two component transcriptional regulator [Thermoanaerobacter sp.
           X514]
 gi|256751653|ref|ZP_05492528.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300913887|ref|ZP_07131204.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X561]
 gi|307725428|ref|YP_003905179.1| winged helix family two component transcriptional regulator
           [Thermoanaerobacter sp. X513]
 gi|320115022|ref|YP_004185181.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
 gi|166853487|gb|ABY91896.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X514]
 gi|166855429|gb|ABY93837.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter pseudethanolicus ATCC 33223]
 gi|256749462|gb|EEU62491.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter ethanolicus CCSD1]
 gi|300890572|gb|EFK85717.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X561]
 gi|307582489|gb|ADN55888.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter sp. X513]
 gi|319928113|gb|ADV78798.1| response regulator receiver [Thermoanaerobacter brockii subsp.
           finnii Ako-1]
          Length = 227

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 53/130 (40%), Gaps = 6/130 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             + +VD    + ++        GF V +      A +   +E  P  +++D  + G+  
Sbjct: 5   RKIYVVDDDKNICEIVSLYLEKEGFDVEQIYDGQTALKKI-QEKPPKLVILDIMLPGIDG 63

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 VR+    + V +  L  + D    +     GA+ +++KPF+ + L   ++ + +
Sbjct: 64  IALCREVRK---FSKVPIIMLTAKGDTLDKVLALEIGADDYIVKPFDGKELVARVKAVLR 120

Query: 120 MQKSKDENQF 129
             + + E + 
Sbjct: 121 RYEPESEEKQ 130


>gi|6862582|gb|AAD30120.2| DNA binding response regulator RpaA [Tolypothrix sp. PCC 7601]
          Length = 247

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V +A    +  +    +L P+ +++D  +  V 
Sbjct: 1   MPRILVIDDDPAISELVAVNLEMAGYDVSQAEDGIKG-QALALQLQPDLIMLDLMLPRVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+     ++ V  L      +  + G  AGA+ +L KPF  E +   +R L 
Sbjct: 60  GFTVCQRLRRDERTAEIPVLMLTALSQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|304320850|ref|YP_003854493.1| phosphate regulon response regulator PhoB [Parvularcula bermudensis
           HTCC2503]
 gi|303299752|gb|ADM09351.1| phosphate regulon response regulator PhoB [Parvularcula bermudensis
           HTCC2503]
          Length = 230

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 50/123 (40%), Gaps = 3/123 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+V+    +  +  +  +  G+    A    EA    E E  P+ +V+D  +     
Sbjct: 4   TRILIVEDEETIAGLLEYNLSREGYETLIAEDGEEALIQIE-ESKPDLIVLDWMLPKVSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +R  P    + +  L    +    + G   GA+ +++KPF+   L   ++ + +
Sbjct: 63  IEVCRRLRMKPETEGIPIILLTARAEEGDRVRGLDTGADDYVVKPFSVSELSSRIKAVLR 122

Query: 120 MQK 122
             +
Sbjct: 123 RAR 125


>gi|313673530|ref|YP_004051641.1| two component transcriptional regulator, winged helix family
           [Calditerrivibrio nitroreducens DSM 19672]
 gi|312940286|gb|ADR19478.1| two component transcriptional regulator, winged helix family
           [Calditerrivibrio nitroreducens DSM 19672]
          Length = 222

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/129 (20%), Positives = 64/129 (49%), Gaps = 3/129 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M+ +L+V+    +R++        G+ V E+ +  +A     +E+ P+ +++D  M G  
Sbjct: 1   MNKILIVEDEDALRELIAFNLTKAGYDVIESENANDAL-IFIEEITPDLIILDIMMPGLK 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
             + +  +++ P  +++ V  +        ++ G   GA+ ++ KPF+ + L   ++ L 
Sbjct: 60  GTQLLQLLKRSPKFSNIPVIIISARSSESDIVEGLELGADDYITKPFSMKVLIAKIKILL 119

Query: 119 QMQKSKDEN 127
           + ++ K EN
Sbjct: 120 RKKQEKTEN 128


>gi|226315498|ref|YP_002775394.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
 gi|226098448|dbj|BAH46890.1| two-component response regulator [Brevibacillus brevis NBRC 100599]
          Length = 236

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 31/130 (23%), Positives = 56/130 (43%), Gaps = 6/130 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M  LL+VD    +  + +  F   G+ V  A    EA     K+  P+ +++D  + G  
Sbjct: 1   MAKLLVVDDEKPIADILKFTFEKEGYQVVCAYDGDEAL-VVVKDERPDLILLDVMLPGRD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++    VRQ     DV +  L  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GMDVCRTVRQ---TYDVPIIMLTAKDSELDKVLGLELGADDYVTKPFSTRELVARVKAHL 116

Query: 119 QMQKSKDENQ 128
           +  +SK E +
Sbjct: 117 RRNRSKVEEK 126


>gi|7144547|gb|AAA62132.2| orf246; ompR homolog [Rhodella violacea]
          Length = 247

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/120 (24%), Positives = 55/120 (45%), Gaps = 6/120 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVL 60
           ++L+VD    +R++  +  +  G+ V  A+   EA     KE  PN +V+D  M      
Sbjct: 12  TILIVDDEASMRRLLEYRLSIIGYNVISASDGEEALNIFRKEH-PNLIVLDIMMPKLDGF 70

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+    +D+ +  L    D    I G   GA+ +L+KPF+ + L   ++ + + 
Sbjct: 71  GVCQEIRKE---SDIPIIMLTGLGDIVDRITGLELGADDYLVKPFSPKELEARIKSVLRR 127


>gi|310640985|ref|YP_003945743.1| two component transcriptional regulator, winged helix family
           [Paenibacillus polymyxa SC2]
 gi|309245935|gb|ADO55502.1| Two component transcriptional regulator, winged helix family
           [Paenibacillus polymyxa SC2]
          Length = 229

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 1/125 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L++D    +  + R      G+ V  AT+  E          P+ +V+D  M  V  F
Sbjct: 4   TILIIDDDEKIVSMLRRGLAFEGYEVLTATNGAEGLNKMLTAE-PDLVVLDVMMPQVDGF 62

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               R    G+ V V  L  + + E  + G   GA+ +L+KPF  E L   +R L + + 
Sbjct: 63  EVCRRMREGGSTVPVLMLTAKDEVENRVKGLDLGADDYLVKPFALEELLARVRALLRRKT 122

Query: 123 SKDEN 127
            + +N
Sbjct: 123 EQQDN 127


>gi|167756876|ref|ZP_02429003.1| hypothetical protein CLORAM_02425 [Clostridium ramosum DSM 1402]
 gi|237734586|ref|ZP_04565067.1| two-component system response regulator [Mollicutes bacterium D7]
 gi|167703051|gb|EDS17630.1| hypothetical protein CLORAM_02425 [Clostridium ramosum DSM 1402]
 gi|229382406|gb|EEO32497.1| two-component system response regulator [Coprobacillus sp. D7]
          Length = 223

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 33/121 (27%), Positives = 56/121 (46%), Gaps = 3/121 (2%)

Query: 1   MD-SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV 59
           M   +L+VD    +R++     N  GF V EA++  EA E  E E   +  +ID  M  +
Sbjct: 1   MKAKVLVVDDEKDIRELINFYLNKEGFEVLEASNGEEALEIFENE-YIDLGIIDVMMPVM 59

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
             F   V  +    DV V  L  + + +  + G   GA+ +++KPF+   L   +R + +
Sbjct: 60  DGF-ELVENLKEFKDVPVIMLTAKGESKDKLRGFSVGADDYVVKPFDPTELMARVRAVLK 118

Query: 120 M 120
            
Sbjct: 119 R 119


>gi|16330477|ref|NP_441205.1| hybrid sensory kinase [Synechocystis sp. PCC 6803]
 gi|1652968|dbj|BAA17885.1| hybrid sensory kinase [Synechocystis sp. PCC 6803]
          Length = 1014

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/124 (20%), Positives = 55/124 (44%), Gaps = 3/124 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+VD       V   L    G+     TS  EA +    +  P+ +++D  M G+    
Sbjct: 20  ILVVDDVKENIYVISELLEGEGYSTTFVTSGPEALQRV-TQAQPDLILLDLMMPGMDGLE 78

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++Q P   D+ V +L    + + ++     GA  ++ KPF+   L   ++   +++
Sbjct: 79  VCDRLKQDPQTRDIPVIFLTASNEKQDLLQAFAKGAVDYVTKPFSPPELLARVKTHLELK 138

Query: 122 KSKD 125
           +++D
Sbjct: 139 QTRD 142



 Score =  124 bits (314), Expect = 3e-27,   Method: Composition-based stats.
 Identities = 22/130 (16%), Positives = 52/130 (40%), Gaps = 4/130 (3%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++LL + + I ++V + L    G+ V    +  EA     K    + +++D  M  +   
Sbjct: 741 TILLAEDNLINQQVAKLLLKKLGYPVDVVNNGQEALSALAKGDY-DVVLMDVEMPEMDGL 799

Query: 63  I--AHVRQMPLGTDVF-VYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
               H+R+    ++   +  +              +G N ++ KP   E L+ A++    
Sbjct: 800 TATEHIRRSQGRSERPWIIAVTAYSMEGDRERCLASGMNDYVSKPIRLEALQQALQVAAT 859

Query: 120 MQKSKDENQF 129
             +S  +++ 
Sbjct: 860 ALQSTSQDRM 869


>gi|218289584|ref|ZP_03493804.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius LAA1]
 gi|218240234|gb|EED07417.1| two component transcriptional regulator, winged helix family
           [Alicyclobacillus acidocaldarius LAA1]
          Length = 233

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/121 (22%), Positives = 52/121 (42%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +R++ R      GF V EA    EA      +     +++D  + G+  
Sbjct: 4   TRILVVDDEERIRRLVRMYLERNGFEVDEAADGKEALNKALNQAY-ALIILDLMLPGMDG 62

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
               A +RQ    ++V +  L    D    + G   GA+ +++KPF+   L   ++ + +
Sbjct: 63  RDVCAQIRQH---SNVPIMMLTAAGDEANRVHGFELGADDYVVKPFSPRELVLRVKAMLK 119

Query: 120 M 120
            
Sbjct: 120 R 120


>gi|56963600|ref|YP_175331.1| two-component response regulator [Bacillus clausii KSM-K16]
 gi|56909843|dbj|BAD64370.1| two-component response regulator [Bacillus clausii KSM-K16]
          Length = 238

 Score =  149 bits (378), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/125 (19%), Positives = 54/125 (43%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           +LL+VD    +R++ R       + + EA++  EA E    +   + +++D  M G+   
Sbjct: 6   TLLVVDDEERIRRLLRMYLEREEYQIEEASNGEEALELALAKEY-DLILLDVMMPGMDGV 64

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R+        V  L  + +    + G   GA+ +++KPF+   +   ++ L + 
Sbjct: 65  EMCQELRKK---KATPVMMLTAKGEEANRVQGFEVGADDYIVKPFSPREVVLRVKALLRR 121

Query: 121 QKSKD 125
             +  
Sbjct: 122 ASATK 126


>gi|323704002|ref|ZP_08115625.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
 gi|323531031|gb|EGB20947.1| two component transcriptional regulator, winged helix family
           [Desulfotomaculum nigrificans DSM 574]
          Length = 230

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/122 (20%), Positives = 52/122 (42%), Gaps = 6/122 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    +R + +      GF V E +   EA    + E   + +++D  + GV 
Sbjct: 1   MPKILIIDDEAKIRDLVKVYLVKEGFEVQELSDGNEAVNLIKAEHY-DLVLLDLMLPGVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+    + V V  L    D    + G   GA+ +++KPF+   +   ++ + 
Sbjct: 60  GLTICKEIRK---FSQVPVIILTARGDEIDRVIGLEVGADDYIVKPFSPREMVARVKAVL 116

Query: 119 QM 120
           + 
Sbjct: 117 RR 118


>gi|221312018|ref|ZP_03593865.1| hypothetical protein Bsubs1_21806 [Bacillus subtilis subsp.
           subtilis str. 168]
 gi|221316343|ref|ZP_03598148.1| hypothetical protein BsubsN3_21712 [Bacillus subtilis subsp.
           subtilis str. NCIB 3610]
 gi|221321256|ref|ZP_03602550.1| hypothetical protein BsubsJ_21665 [Bacillus subtilis subsp.
           subtilis str. JH642]
 gi|221325539|ref|ZP_03606833.1| hypothetical protein BsubsS_21821 [Bacillus subtilis subsp.
           subtilis str. SMY]
 gi|296329976|ref|ZP_06872460.1| two-component response regulator (YycG) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305676701|ref|YP_003868373.1| two-component response regulator [Bacillus subtilis subsp.
           spizizenii str. W23]
 gi|321313602|ref|YP_004205889.1| two-component response regulator [Bacillus subtilis BSn5]
 gi|291486678|dbj|BAI87753.1| hypothetical protein BSNT_06200 [Bacillus subtilis subsp. natto
           BEST195]
 gi|296153015|gb|EFG93880.1| two-component response regulator (YycG) [Bacillus subtilis subsp.
           spizizenii ATCC 6633]
 gi|305414945|gb|ADM40064.1| two-component response regulator (paired with YycG) [Bacillus
           subtilis subsp. spizizenii str. W23]
 gi|320019876|gb|ADV94862.1| two-component response regulator [Bacillus subtilis BSn5]
          Length = 236

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/122 (22%), Positives = 50/122 (40%), Gaps = 6/122 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  +        G+ V  A    EA E  E EL P+ +++D  +     
Sbjct: 4   KKILVVDDEKPIADILEFNLRKEGYEVHCAHDGNEAVEMVE-ELQPDLILLDIMLPNKDG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 63  VEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLEIGADDYVTKPFSTRELLARVKANLR 119

Query: 120 MQ 121
            Q
Sbjct: 120 RQ 121


>gi|159030857|emb|CAO88536.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
          Length = 246

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/122 (19%), Positives = 52/122 (42%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V  A    +  +    +L P+ +++D  +  V 
Sbjct: 1   MPRILVIDDDPAIAELVSINLEMAGYDVNPAEDGIKG-QALAVQLQPDLIMLDLMLPKVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+    +D+ +  +      +  + G  AGA+ +L KPF  E +   +R L 
Sbjct: 60  GFTVCQRLRRDERTSDIPILMMTALGQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|119945892|ref|YP_943572.1| two component transcriptional regulator, winged helix family
           protein [Psychromonas ingrahamii 37]
 gi|119864496|gb|ABM03973.1| two component transcriptional regulator, winged helix family
           protein [Psychromonas ingrahamii 37]
          Length = 227

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/131 (17%), Positives = 55/131 (41%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+V+    +R +   + +  G+   EA +   A      E  P+ +++D    G    
Sbjct: 4   RILVVEDEVAIRDMLCFVLDQHGYECIEADTYQSALNQL-HEPYPDLILLDWMFPGGSGI 62

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             ++H++Q  +   + V  L    + +  + G   GA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  KLLSHLKQDNILRSIPVVMLTARGEEQDKVRGLENGADDYVTKPFSPKELMARLKTVMRR 122

Query: 121 QKSKDENQFLD 131
                 +  L 
Sbjct: 123 VNPTSLDDELS 133


>gi|52082613|ref|YP_081404.1| putative two-component response regulator YycF [Bacillus
           licheniformis ATCC 14580]
 gi|52788011|ref|YP_093840.1| YycF [Bacillus licheniformis ATCC 14580]
 gi|319648478|ref|ZP_08002694.1| transcriptional regulatory protein yycF [Bacillus sp. BT1B_CT2]
 gi|52005824|gb|AAU25766.1| putative two-component response regulator YycF [Bacillus
           licheniformis ATCC 14580]
 gi|52350513|gb|AAU43147.1| YycF [Bacillus licheniformis ATCC 14580]
 gi|317389557|gb|EFV70368.1| transcriptional regulatory protein yycF [Bacillus sp. BT1B_CT2]
          Length = 235

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 52/129 (40%), Gaps = 6/129 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  +        G+ V  A    EA +  E +L P+ +++D  +     
Sbjct: 3   KKILVVDDEKPIADILEFNLKKEGYEVHCAYDGNEALQMVE-DLNPDMILLDIMLPNKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    VR+     D+ +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  VEVCREVRKK---YDMPIIMLTAKDSEIDKVIGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKSKDENQ 128
            Q +    +
Sbjct: 119 RQNTAAPAE 127


>gi|150016605|ref|YP_001308859.1| two component transcriptional regulator [Clostridium beijerinckii
           NCIMB 8052]
 gi|149903070|gb|ABR33903.1| two component transcriptional regulator, winged helix family
           [Clostridium beijerinckii NCIMB 8052]
          Length = 225

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/132 (18%), Positives = 53/132 (40%), Gaps = 5/132 (3%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD   ++RK+        G++  EA    +A      E   + +++D  +     
Sbjct: 4   KRILVVDDEPLIRKLVTDFLKKQGYVTIEADDGKKAMNLFSNEENIDLIILDVMLPEYDG 63

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R+      V +  L    +    + G   GA+ ++ KPF+   L   +  + +
Sbjct: 64  FTVCREIRKKSK---VPIIMLTARGEEFDEVFGLDIGADEYISKPFSPNILIARVNAVLR 120

Query: 120 MQKSKDENQFLD 131
              S+D+ + L 
Sbjct: 121 RANSEDKGKELK 132


>gi|116619023|ref|YP_819394.1| DNA-binding response regulator [Leuconostoc mesenteroides subsp.
           mesenteroides ATCC 8293]
 gi|116097870|gb|ABJ63021.1| DNA-binding response regulator, OmpR family (Rec-wHTH domains)
           [Leuconostoc mesenteroides subsp. mesenteroides ATCC
           8293]
          Length = 235

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/128 (20%), Positives = 55/128 (42%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +L+VD    +  + +      G+ V  A    EA +    E  P+ +++D+ +    
Sbjct: 1   MSKVLVVDDEKPISDIIKFNLTKEGYDVVTAADGQEALDMYNDEN-PDLVLLDQMLPEVD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E +  +R     +DV V  +  +      + G   GA+ ++ KPF+   L   ++   
Sbjct: 60  GIEVLRQIRSK---SDVPVIMVTAKDSEIDKVLGLEMGADDYVTKPFSNRELVARVKANL 116

Query: 119 QMQKSKDE 126
           + +KS  +
Sbjct: 117 RSRKSVSQ 124


>gi|323496468|ref|ZP_08101526.1| putative two-component response regulator [Vibrio sinaloensis DSM
           21326]
 gi|323318745|gb|EGA71698.1| putative two-component response regulator [Vibrio sinaloensis DSM
           21326]
          Length = 235

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/128 (18%), Positives = 53/128 (41%), Gaps = 2/128 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD +  +R+         GF V  A +     +   +   P+ +++D  M G   
Sbjct: 4   KRILVVDDNQELREALSDYLGRAGFEVLGAENGRAMWQTL-QHTTPDLIILDIMMPGEDG 62

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
           F    RQ+   + + +  L    +    +AG   GA+ ++ K F+   L   ++ + +  
Sbjct: 63  FCLC-RQLRQDSQIPIIMLTAVTEEADRVAGLEMGADDYITKSFSPRELLARIKTILRRS 121

Query: 122 KSKDENQF 129
           +  ++ Q 
Sbjct: 122 QPDNQIQL 129


>gi|322383919|ref|ZP_08057649.1| two-component response regulator YclK-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
 gi|321151396|gb|EFX44583.1| two-component response regulator YclK-like protein [Paenibacillus
           larvae subsp. larvae B-3650]
          Length = 244

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 61/128 (47%), Gaps = 6/128 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+V+  HI+R++ +    + G+ V EA +  EA    E+  + + +++D  M  +  
Sbjct: 20  KTILVVEDEHILREIIKDYLLNEGYQVLEAINGKEALTLFEENEV-HLVILDIMMPELDG 78

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+    +++ V  L    D +  + G   GA+ ++ KPF+   L    + L +
Sbjct: 79  WSVCRRIRK---TSNIPVIMLTARADEDDTLLGFELGADDYVTKPFSPPILLARAKRLLE 135

Query: 120 MQKSKDEN 127
            + + +E 
Sbjct: 136 SRYAIEEE 143


>gi|146277961|ref|YP_001168120.1| two component transcriptional regulator [Rhodobacter sphaeroides
           ATCC 17025]
 gi|145556202|gb|ABP70815.1| two component transcriptional regulator, winged helix family
           [Rhodobacter sphaeroides ATCC 17025]
          Length = 230

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/121 (21%), Positives = 52/121 (42%), Gaps = 3/121 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VLE 61
           +LLV+     R+V  +     GF V +A +  EA     +E  P+ +V+D  +     +E
Sbjct: 9   VLLVEDEPAQREVLSYNLESEGFRVVQAGTGDEAL-MLVEETGPDVIVLDWMLPSVSGIE 67

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               ++  P    V +  L    +    + G   GA+ +++KP++   L   +R   +  
Sbjct: 68  VCRQLKSRPSTRSVPIIMLSARSEEVDRVRGLETGADDYVVKPYSVVELMARVRSQLRRA 127

Query: 122 K 122
           +
Sbjct: 128 R 128


>gi|329576541|gb|EGG58048.1| putative transcriptional regulatory protein WalR [Enterococcus
           faecalis TX1467]
          Length = 159

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/120 (20%), Positives = 53/120 (44%), Gaps = 2/120 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    + ++ ++     G+ VF A    EA E  E E+ P+ +++D  +  + 
Sbjct: 1   MKKILVVDDEKPISEIVKYNLVKEGYEVFTAYDGEEALEKVE-EVEPDLIILDLMLPKMD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 R++    D+ +  +  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-REVRKTHDMPIIMVTAKDSEIDKVLGLELGADDYVTKPFSNRELVARVKANLRR 118


>gi|302342093|ref|YP_003806622.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Desulfarculus baarsii DSM 2075]
 gi|301638706|gb|ADK84028.1| response regulator receiver modulated metal dependent
           phosphohydrolase [Desulfarculus baarsii DSM 2075]
          Length = 518

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 30/128 (23%), Positives = 57/128 (44%), Gaps = 3/128 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--L 60
            +L+VD   I  ++   LF+  G     A+    A E   +E +P+ +++D  M G+   
Sbjct: 13  RILIVDDEPINIEIMSELFSLHGAETISASDGATALELARRE-MPDLVLLDVMMPGMNGY 71

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    ++   +   + V  +      +  I G  AGA+ FL KP +   L    R L ++
Sbjct: 72  EVCRRLKADEVTRRLPVVMVTGLGQIDDKIKGLEAGADDFLSKPVHMAELVTRTRSLLRV 131

Query: 121 QKSKDENQ 128
           ++  D+ +
Sbjct: 132 KELNDDLE 139


>gi|228924210|ref|ZP_04087481.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar huazhongensis BGSC
           4BD1]
 gi|228942615|ref|ZP_04105147.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228955717|ref|ZP_04117712.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228975545|ref|ZP_04136097.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228982181|ref|ZP_04142470.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis Bt407]
 gi|229035124|ref|ZP_04189070.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1271]
 gi|229051135|ref|ZP_04194679.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH676]
 gi|229072931|ref|ZP_04206127.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus F65185]
 gi|229082674|ref|ZP_04215131.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock4-2]
 gi|229112879|ref|ZP_04242410.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-15]
 gi|229130712|ref|ZP_04259665.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-Cer4]
 gi|229148016|ref|ZP_04276355.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST24]
 gi|229164416|ref|ZP_04292345.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus R309803]
 gi|229193717|ref|ZP_04320658.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 10876]
 gi|228589742|gb|EEK47620.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 10876]
 gi|228619066|gb|EEK75963.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus R309803]
 gi|228635441|gb|EEK91932.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST24]
 gi|228652729|gb|EEL08614.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-Cer4]
 gi|228670558|gb|EEL25871.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock1-15]
 gi|228700635|gb|EEL53164.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock4-2]
 gi|228710177|gb|EEL62155.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus F65185]
 gi|228722198|gb|EEL73599.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH676]
 gi|228728190|gb|EEL79220.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH1271]
 gi|228777533|gb|EEM25811.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis Bt407]
 gi|228784155|gb|EEM32182.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar thuringiensis str.
           T01001]
 gi|228803945|gb|EEM50569.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar kurstaki str.
           T03a001]
 gi|228817041|gb|EEM63134.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar berliner ATCC
           10792]
 gi|228835428|gb|EEM80798.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar huazhongensis BGSC
           4BD1]
          Length = 234

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E   +E  P+ +++D  + G   
Sbjct: 3   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEE-QPDMVLLDIMLPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  LEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|15602297|ref|NP_245369.1| PhoB [Pasteurella multocida subsp. multocida str. Pm70]
 gi|12720685|gb|AAK02516.1| PhoB [Pasteurella multocida subsp. multocida str. Pm70]
          Length = 231

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/129 (19%), Positives = 58/129 (44%), Gaps = 4/129 (3%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG-- 58
           M  +L+V+    +R++        G+ + EA     A +   ++  P  +++D  + G  
Sbjct: 1   MTKILVVEDESAIREMISLFLTQQGYDIIEAADYQSAVKKLVEK--PQLILLDWMLPGRS 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++FI  +++     ++ V  L    + E  I G   GA+ ++ KPF+ + L   +  + 
Sbjct: 59  GIQFIQFLKKHEDTENIPVIMLTARSEEEDCITGLNTGADDYITKPFSPKILLARIEAML 118

Query: 119 QMQKSKDEN 127
           +    + +N
Sbjct: 119 RRVYEQSQN 127


>gi|226946855|ref|YP_002801928.1| phosphate regulon response regulator PhoB [Azotobacter vinelandii
           DJ]
 gi|226721782|gb|ACO80953.1| phosphate regulon response regulator; PhoB [Azotobacter vinelandii
           DJ]
          Length = 229

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            ++L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   KTILIVDDEAPIREMIAVALEMAGYECLEAENTQQA-HAIIVDRRPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L T + +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTTGIPLIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|228918078|ref|ZP_04081606.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
 gi|228930472|ref|ZP_04093472.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228936746|ref|ZP_04099537.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228949188|ref|ZP_04111456.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228988693|ref|ZP_04148779.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|229094577|ref|ZP_04225644.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-42]
 gi|229124969|ref|ZP_04254143.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 95/8201]
 gi|229142215|ref|ZP_04270739.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST26]
 gi|229159026|ref|ZP_04287082.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 4342]
 gi|229187695|ref|ZP_04314831.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BGSC 6E1]
 gi|229199595|ref|ZP_04326256.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1293]
 gi|228584000|gb|EEK42157.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus m1293]
 gi|228595763|gb|EEK53447.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BGSC 6E1]
 gi|228624445|gb|EEK81216.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus ATCC 4342]
 gi|228641233|gb|EEK97540.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST26]
 gi|228658470|gb|EEL14136.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus 95/8201]
 gi|228688824|gb|EEL42655.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus Rock3-42]
 gi|228771144|gb|EEM19624.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar tochigiensis BGSC
           4Y1]
 gi|228810471|gb|EEM56824.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar monterrey BGSC
           4AJ1]
 gi|228822955|gb|EEM68796.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar andalousiensis BGSC
           4AW1]
 gi|228829191|gb|EEM74828.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pondicheriensis
           BGSC 4BA1]
 gi|228841558|gb|EEM86674.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus thuringiensis serovar pulsiensis BGSC
           4CC1]
          Length = 234

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 49/124 (39%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E    E  P+ +++D  + G   
Sbjct: 3   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKA-TEEQPDMVLLDIMLPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  LEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|256823309|ref|YP_003147272.1| two component transcriptional regulator PhoB, winged helix family
           [Kangiella koreensis DSM 16069]
 gi|256796848|gb|ACV27504.1| two component transcriptional regulator PhoB, winged helix family
           [Kangiella koreensis DSM 16069]
          Length = 230

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/120 (17%), Positives = 55/120 (45%), Gaps = 2/120 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--VL 60
            +L+++    +R++        G+ V +A +        ++  +P+ +++D  + G   +
Sbjct: 4   KVLILEDERDIREMLAFCMQQAGYQVEQAATAERVFGLLKEGFVPDIMLVDWMLPGASGV 63

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
           E    +++     DV V  L    + +  + G  AGA+ +++KPF+   L   ++ + + 
Sbjct: 64  ELTKKLKKDQKYQDVPVIMLTARGEEDDRVQGLEAGADDYVVKPFSPRELLARVQAVLRR 123


>gi|289579384|ref|YP_003478011.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
 gi|289529097|gb|ADD03449.1| two component transcriptional regulator, winged helix family
           [Thermoanaerobacter italicus Ab9]
          Length = 227

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/129 (15%), Positives = 52/129 (40%), Gaps = 6/129 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            + +VD    + ++        GF V +      A +  +    P  +++D  + G+   
Sbjct: 6   KIYVVDDDKNICEIVSLYLEKEGFEVEQIYDGQTALKKIQDNP-PRLVILDIMLPGIDGI 64

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                VR+    + V +  L  + D    +     GA+ +++KPF+ + L   ++ + + 
Sbjct: 65  ALCREVRK---FSKVPIIMLTAKGDTLDKVLALEIGADDYIVKPFDGKELIARVKAVLRR 121

Query: 121 QKSKDENQF 129
            + + + + 
Sbjct: 122 YEPESDERR 130


>gi|254415706|ref|ZP_05029464.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
 gi|196177412|gb|EDX72418.1| response regulator receiver domain protein [Microcoleus
           chthonoplastes PCC 7420]
          Length = 236

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 25/119 (21%), Positives = 53/119 (44%), Gaps = 3/119 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF- 62
           +L+V+    + K+ +      GF  +       A +  + +  P+ +++D  + G+    
Sbjct: 3   ILIVEDEAEIAKLIQLTLEREGFTCYSCRDGLAAIQAFQSQ-QPDVIILDLMLPGLDGLE 61

Query: 63  -IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             A +RQ P   D ++  L  + +    + G   GA+ +L+KPF+   L   +R L + 
Sbjct: 62  VCARIRQKPGPKDPYILMLTAKGEEIDRVIGLSTGADDYLVKPFSPTELVARVRALLRR 120


>gi|329115847|ref|ZP_08244564.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus parauberis NCFD 2020]
 gi|326906252|gb|EGE53166.1| alkaline phosphatase synthesis transcriptional regulatory protein
           PhoP [Streptococcus parauberis NCFD 2020]
          Length = 236

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/125 (16%), Positives = 51/125 (40%), Gaps = 2/125 (1%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+VD    +  + +      G+    A    EA    E+E  P+ +++D  +  + 
Sbjct: 1   MKKVLIVDDEKPISDIIKFNLTKEGYDTITAFDGREAVTAFEEEK-PDLVILDLMLPELD 59

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                 +++   + + +  L  +      + G   GA+ ++ KPF+   L   ++   + 
Sbjct: 60  GLEVA-KEIRKTSHIPIIMLSAKDSEFDKVIGLEIGADDYVTKPFSNRELLARVKAHLRR 118

Query: 121 QKSKD 125
            ++ +
Sbjct: 119 TETIE 123


>gi|228920111|ref|ZP_04083460.1| Two-component response regulator [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
 gi|228839567|gb|EEM84859.1| Two-component response regulator [Bacillus thuringiensis serovar
           huazhongensis BGSC 4BD1]
          Length = 218

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/129 (20%), Positives = 62/129 (48%), Gaps = 6/129 (4%)

Query: 5   LLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF-- 62
           L+VD    +R++     ++FG+   EA +  EA +  E +   +++V+D  M  +     
Sbjct: 2   LVVDDESDMRQLVGMYLDNFGYEWGEAENGKEALKKLETDHY-DFVVLDIMMPEMDGLSV 60

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
              +R+    +DV + +L  + +    + G R GA+ +++KPF+   L   M  + +   
Sbjct: 61  CKEIRK---TSDVPIIFLTAKGEEWNRVNGLRMGADDYIVKPFSPGELVARMEAVLRRYT 117

Query: 123 SKDENQFLD 131
            +++ + + 
Sbjct: 118 KQEQQEEIQ 126


>gi|184154491|ref|YP_001842831.1| two-component response regulator [Lactobacillus fermentum IFO 3956]
 gi|260662552|ref|ZP_05863447.1| two-component system response regulator [Lactobacillus fermentum
           28-3-CHN]
 gi|183225835|dbj|BAG26351.1| two-component response regulator [Lactobacillus fermentum IFO 3956]
 gi|260553243|gb|EEX26186.1| two-component system response regulator [Lactobacillus fermentum
           28-3-CHN]
          Length = 235

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 22/122 (18%), Positives = 48/122 (39%), Gaps = 2/122 (1%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD    +  + +      G+ V  A    EA +  E E  P+ +V+D  +  +  
Sbjct: 3   KKVLVVDDEKPISDIIKFNLEKEGYEVVVAYDGEEALQKVESES-PDLIVLDLMLPKIDG 61

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                +Q+       +  +  +      + G   GA+ ++ KPF+   L   ++   + Q
Sbjct: 62  LEVA-KQVRAKRSTPIIMVTAKDSELDKVLGLELGADDYVTKPFSNRELVARVKANLRRQ 120

Query: 122 KS 123
            +
Sbjct: 121 DA 122


>gi|114566483|ref|YP_753637.1| response regulator receiver protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
 gi|114337418|gb|ABI68266.1| response regulator receiver protein [Syntrophomonas wolfei subsp.
           wolfei str. Goettingen]
          Length = 239

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 20/130 (15%), Positives = 51/130 (39%), Gaps = 3/130 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    + ++ +      G+ V  A     A E   K+  P+ +++D  +  +   
Sbjct: 5   KILVVDDETHIVELVKFNLEKEGYRVAVAYDGQCALEMV-KDAPPDLILLDIMLPQMDGL 63

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + +  L  + +    I G   GA+ ++ KPF+   +   ++   + 
Sbjct: 64  EVCRTLKQHSEYKTIPIIMLTAKGEEIDTILGLEMGADDYIKKPFSPREMVARVKARLRA 123

Query: 121 QKSKDENQFL 130
            +     + +
Sbjct: 124 LRILKAEKAM 133


>gi|330938965|gb|EGH42452.1| response regulator receiver:transcriptional regulatory protein
           [Pseudomonas syringae pv. pisi str. 1704B]
 gi|330975743|gb|EGH75809.1| response regulator receiver:transcriptional regulatory protein
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 245

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 50/123 (40%), Gaps = 3/123 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            S+LLVD    +R++     +  GF V       + R     E   + L++D  +     
Sbjct: 6   KSILLVDDDQEIRELLDTYLSRAGFQVRTVGDGADFRRAFNDEPS-DLLILDVMLPDEDG 64

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +RQ P    V +  L    D    + G   GA+ +L KPF+   L+  ++ L +
Sbjct: 65  FSLCRWIRQHPRQPHVPIIMLTASSDEADRVIGLELGADDYLGKPFSPRELQARIKALLR 124

Query: 120 MQK 122
             +
Sbjct: 125 RAQ 127


>gi|302186956|ref|ZP_07263629.1| response regulator receiver:transcriptional regulatory protein,
           C-terminal [Pseudomonas syringae pv. syringae 642]
          Length = 245

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 50/123 (40%), Gaps = 3/123 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            S+LLVD    +R++     +  GF V       + R     E   + L++D  +     
Sbjct: 6   KSILLVDDDQEIRELLDTYLSRAGFQVRTVGDGADFRRAFNDEPS-DLLILDVMLPDEDG 64

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +RQ P    V +  L    D    + G   GA+ +L KPF+   L+  ++ L +
Sbjct: 65  FSLCRWIRQHPRQPHVPIIMLTASSDEADRVIGLELGADDYLGKPFSPRELQARIKALLR 124

Query: 120 MQK 122
             +
Sbjct: 125 RAQ 127


>gi|229014632|ref|ZP_04171746.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides DSM 2048]
 gi|229136291|ref|ZP_04265038.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST196]
 gi|229170168|ref|ZP_04297855.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH621]
 gi|228613313|gb|EEK70451.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus AH621]
 gi|228647163|gb|EEL03251.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus BDRD-ST196]
 gi|228746643|gb|EEL96532.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus mycoides DSM 2048]
          Length = 234

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E   +E  P+ +++D  + G   
Sbjct: 3   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEE-QPDMVLLDIMLPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  LEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|229176141|ref|ZP_04303634.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus MM3]
 gi|228607376|gb|EEK64705.1| Alkaline phosphatase synthesis transcriptional regulatory protein
           phoP [Bacillus cereus MM3]
          Length = 234

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/124 (19%), Positives = 50/124 (40%), Gaps = 6/124 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +  + +      GF +  A    EA E   +E  P+ +++D  + G   
Sbjct: 3   KKILVVDDEKPIADILKFNLEKEGFEIVMAHDGDEAIEKANEE-QPDMVLLDIMLPGKDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           LE    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  LEVCREIRKSSE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELLARVKANLR 118

Query: 120 MQKS 123
             + 
Sbjct: 119 RHQQ 122


>gi|194364248|ref|YP_002026858.1| winged helix family two component transcriptional regulator
           [Stenotrophomonas maltophilia R551-3]
 gi|194347052|gb|ACF50175.1| two component transcriptional regulator, winged helix family
           [Stenotrophomonas maltophilia R551-3]
          Length = 239

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 54/131 (41%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+V+    +  + R    D G+ V  A S        E++   + LV+D  + GV  
Sbjct: 4   KRVLIVEDDAHIADLLRMHLGDEGYDVAHAASGDGGLRLLEQDGPWDALVLDVMLPGVDG 63

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
                R   +   V +  +       + I G   GA+ +L KPF+   L   +R L +  
Sbjct: 64  LQVCQRARAMARYVPIIIISARGSETQRIVGLELGADDYLAKPFSMPELVARVRALLRRA 123

Query: 122 KSKDENQFLDA 132
           ++  ++  +DA
Sbjct: 124 EAMAQSARIDA 134


>gi|332708796|ref|ZP_08428767.1| two component transcriptional regulator, winged helix family
           [Lyngbya majuscula 3L]
 gi|332352338|gb|EGJ31907.1| two component transcriptional regulator, winged helix family
           [Lyngbya majuscula 3L]
          Length = 245

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V +A    +  +    +L P+ +++D  +  V 
Sbjct: 1   MPRILVIDDDPAISELVTINLEMAGYDVSQAMDGIKG-QALALQLQPDLIMLDLMLPKVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+    +D+ V  L      +  + G  AGA+ +L KPF  E +   +R L 
Sbjct: 60  GFTVCQRLRRDERTSDIPVLMLTALGQTQDKVEGFNAGADDYLTKPFELEEMLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|238063933|ref|ZP_04608642.1| two-component system response regulator receiver [Micromonospora
           sp. ATCC 39149]
 gi|237885744|gb|EEP74572.1| two-component system response regulator receiver [Micromonospora
           sp. ATCC 39149]
          Length = 318

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 32/125 (25%), Positives = 53/125 (42%), Gaps = 3/125 (2%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GVLE 61
           +L+VD    + +         GF V  A+   EA E  E++  P+  V+D  M     LE
Sbjct: 11  ILVVDDDADIARFVEFNLRLHGFEVIHASDGQEALEVIERQ-RPDLAVVDLMMPRIDGLE 69

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQ 121
               +R  P+ + + V  L  +      + G  AGA+ +L+KPF+   L   +    +  
Sbjct: 70  LTRRLRANPMTSALPVIMLTAKGMTVDKVHGLSAGADDYLVKPFDTAELVARVSSTLRRN 129

Query: 122 KSKDE 126
           K   E
Sbjct: 130 KEFRE 134


>gi|149180955|ref|ZP_01859456.1| hypothetical protein BSG1_10961 [Bacillus sp. SG-1]
 gi|148851239|gb|EDL65388.1| hypothetical protein BSG1_10961 [Bacillus sp. SG-1]
          Length = 236

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 22/123 (17%), Positives = 50/123 (40%), Gaps = 6/123 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD    +  + +      G+ V  A    EA +  E E+ P+ +++D  +     
Sbjct: 3   KKILVVDDEKPIADILQFNLKKEGYEVHCAYDGDEAVKMAE-EIKPDLVLLDIMLPNRDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +R+      + +  L  +      + G   GA+ ++ KPF+   L   ++   +
Sbjct: 62  MEVCREIRKKYE---MPIIMLTAKDSEIDKVLGLELGADDYVTKPFSTRELIARVKANLR 118

Query: 120 MQK 122
             +
Sbjct: 119 RHQ 121


>gi|153952801|ref|YP_001393566.1| sensory transduction protein [Clostridium kluyveri DSM 555]
 gi|219853466|ref|YP_002470588.1| hypothetical protein CKR_0123 [Clostridium kluyveri NBRC 12016]
 gi|146345682|gb|EDK32218.1| Predicted sensory transduction protein [Clostridium kluyveri DSM
           555]
 gi|219567190|dbj|BAH05174.1| hypothetical protein [Clostridium kluyveri NBRC 12016]
          Length = 228

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 53/128 (41%), Gaps = 6/128 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
            +L+VD    + +V +      G+ V  A     A E    E  P+ +++D  +  +   
Sbjct: 7   KILIVDDDENICEVIKMYVESAGYEVQVANDGKSA-ETTFLEYKPDLVILDIMLPNIDGI 65

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
             +  +R+        V  L  + +    + G   GA+ +++KPF  + +   ++ + + 
Sbjct: 66  DVLKWIRKDYE---TPVIMLTAKGETFDKVLGLELGADDYIVKPFEPKEMLARIKAVLRR 122

Query: 121 QKSKDENQ 128
               +EN+
Sbjct: 123 YSVDNENK 130


>gi|17231412|ref|NP_487960.1| two-component response regulator [Nostoc sp. PCC 7120]
 gi|17133054|dbj|BAB75619.1| two-component response regulator [Nostoc sp. PCC 7120]
          Length = 414

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 31/127 (24%), Positives = 55/127 (43%), Gaps = 3/127 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD     R     L    G+ V EA S   A +   ++  P+ +++D  M  +  F
Sbjct: 95  KVLVVDDHSASRMTAAALLGMEGYAVIEADSGATAIKLVGQQ-QPDLILLDVMMPEMDGF 153

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                ++Q      + V ++    D    I G   GA+ FL KPF+R  L   ++ L Q 
Sbjct: 154 EVCQLLKQDEHTRLIPVIFITALNDRRSRIRGIEVGADDFLSKPFDRVELVARVKSLVQQ 213

Query: 121 QKSKDEN 127
           ++  ++ 
Sbjct: 214 KRLNEDL 220


>gi|296133006|ref|YP_003640253.1| response regulator receiver modulated diguanylate cyclase
           [Thermincola sp. JR]
 gi|296031584|gb|ADG82352.1| response regulator receiver modulated diguanylate cyclase
           [Thermincola potens JR]
          Length = 314

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/126 (19%), Positives = 55/126 (43%), Gaps = 3/126 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L++D    + ++ +      GF+V+ A     A E    ++ P+ +++D  +  +  
Sbjct: 7   QRILVIDDDKFMVRIIKDCLEKVGFIVYGAEDFSSAMELIY-QMTPDLILLDVVLPKMNG 65

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +R     + V +  +  +   E  +AG  AGA+ ++ KPF+   L   ++   +
Sbjct: 66  FEICRLLRNDTRTSHVPIIMITSKAMTEDKVAGLEAGADDYITKPFDPLELVARVKTHLR 125

Query: 120 MQKSKD 125
             K + 
Sbjct: 126 RAKQEK 131


>gi|291484740|dbj|BAI85815.1| two-component response regulator [Bacillus subtilis subsp. natto
           BEST195]
          Length = 251

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/121 (19%), Positives = 51/121 (42%), Gaps = 6/121 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
             +L+VD    +R++ R       + + EA +  EA      E   + +++D  M G   
Sbjct: 18  TKILVVDDEARIRRLLRMYLERENYAIDEAENGDEAIAK-GLEANYDLILLDLMMPGTDG 76

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +R+        +  L  + +    + G  AG + +++KPF+   +   ++ L +
Sbjct: 77  IEVCRQIREK---KATPIIMLTAKGEEANRVQGFEAGTDDYIVKPFSPREVVLRVKALLR 133

Query: 120 M 120
            
Sbjct: 134 R 134


>gi|311103716|ref|YP_003976569.1| phosphate regulon transcriptional regulatory protein PhoB
           [Achromobacter xylosoxidans A8]
 gi|310758405|gb|ADP13854.1| phosphate regulon transcriptional regulatory protein PhoB
           [Achromobacter xylosoxidans A8]
          Length = 232

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/131 (18%), Positives = 57/131 (43%), Gaps = 3/131 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           ++L+V+    ++++     +  G  V  A    +A+     E LP+ +++D  + G    
Sbjct: 4   TILVVEDEPAIQELIAVNLSFAGHKVLRAFDADQAQTLIRAE-LPDLILLDWMLPGTSGL 62

Query: 63  I--AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
                +R       V V  L  +   +  + G  AGA+ ++ KPF+ + L   ++ + + 
Sbjct: 63  AMARKLRNDERTRAVPVIMLTAKGSEQDKVDGLEAGADDYITKPFSPKELMARIKAVLRR 122

Query: 121 QKSKDENQFLD 131
           +  +  +  +D
Sbjct: 123 RAPQLTDDVID 133


>gi|22298592|ref|NP_681839.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
 gi|22294772|dbj|BAC08601.1| two-component response regulator [Thermosynechococcus elongatus
           BP-1]
          Length = 214

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 30/133 (22%), Positives = 57/133 (42%), Gaps = 3/133 (2%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE- 61
           ++LLVD    +  + +      G+ V  A    E     +++  P+ ++ D  M  +   
Sbjct: 12  TILLVDDDPNLVLLVKDYLEMQGYRVLTAAHGNEGLAMLQQQT-PDLVICDVMMPQMDGY 70

Query: 62  -FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
            F++ VRQ    + + V +L  +      I G + G + +L+KPF  E L   ++ L + 
Sbjct: 71  SFVSAVRQQTHLSWLPVLFLSAKGQTHDRIKGLQTGGDVYLVKPFEPEELLAQIQALLKQ 130

Query: 121 QKSKDENQFLDAI 133
                E Q   A+
Sbjct: 131 TARLREAQGRQAL 143


>gi|304406985|ref|ZP_07388639.1| two component transcriptional regulator, winged helix family
           [Paenibacillus curdlanolyticus YK9]
 gi|304343972|gb|EFM09812.1| two component transcriptional regulator, winged helix family
           [Paenibacillus curdlanolyticus YK9]
          Length = 238

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/125 (16%), Positives = 53/125 (42%), Gaps = 6/125 (4%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
            +L+VD    +R++ +      G+ + EA     A          + +++D  + G+   
Sbjct: 7   RILVVDDEERIRRLLKMYLEKEGYEIEEAEDGETALRMA-AGKDYDLIMLDVMLPGIDGV 65

Query: 63  --IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQM 120
              + +RQ+       V  L  + +    + G  AGA+ +++KPF+   + + ++ + + 
Sbjct: 66  EVCSRLRQV---KATPVIMLTAKGEEMNRVQGFEAGADDYVVKPFSPREVIYRVKAILRR 122

Query: 121 QKSKD 125
             +  
Sbjct: 123 SSATA 127


>gi|167464300|ref|ZP_02329389.1| two component transcriptional regulator, winged helix family
           protein [Paenibacillus larvae subsp. larvae BRL-230010]
          Length = 227

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 27/128 (21%), Positives = 61/128 (47%), Gaps = 6/128 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            ++L+V+  HI+R++ +    + G+ V EA +  EA    E+  + + +++D  M  +  
Sbjct: 3   KTILVVEDEHILREIIKDYLLNEGYQVLEAINGKEALTLFEENEV-HLVILDIMMPELDG 61

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R+    +++ V  L    D +  + G   GA+ ++ KPF+   L    + L +
Sbjct: 62  WSVCRRIRK---TSNIPVIMLTARADEDDTLLGFELGADDYVTKPFSPPILLARAKRLLE 118

Query: 120 MQKSKDEN 127
            + + +E 
Sbjct: 119 SRYAIEEE 126


>gi|153854191|ref|ZP_01995499.1| hypothetical protein DORLON_01490 [Dorea longicatena DSM 13814]
 gi|149753240|gb|EDM63171.1| hypothetical protein DORLON_01490 [Dorea longicatena DSM 13814]
          Length = 229

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 30/129 (23%), Positives = 57/129 (44%), Gaps = 6/129 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--GV 59
             +L+VD   ++ K  R      G+ V  A    EA +   KE   + +++D  +     
Sbjct: 3   RRVLVVDDEKLIVKGIRFSLEQDGYDVDCAYDGEEALKLA-KENAYDIILLDVMLPKYDG 61

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
            E    +R+    +DV +  L  + D    I G   GA+ ++ KPFN   ++  ++ + +
Sbjct: 62  FEVCQQIRE---YSDVPIIMLTAKGDDMDKILGLDYGADDYITKPFNILEVKARIKAIMR 118

Query: 120 MQKSKDENQ 128
               +D+NQ
Sbjct: 119 RVSKRDKNQ 127


>gi|186683295|ref|YP_001866491.1| response regulator receiver protein [Nostoc punctiforme PCC 73102]
 gi|186465747|gb|ACC81548.1| response regulator receiver protein [Nostoc punctiforme PCC 73102]
          Length = 125

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/127 (20%), Positives = 55/127 (43%), Gaps = 6/127 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M  +LLVD    + +   +     G+ V  A     A +   K+ +P+ +++D  +    
Sbjct: 1   MPHVLLVDDEAALCESLTYTLQKEGYTVTTAADGHSAIKQFHKQ-VPDVILLDLMLPEVD 59

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            +E    +R     ++V +  L  + +    I G  AGA+ ++ KPFN   L   ++ + 
Sbjct: 60  GMEVCWRIRA---FSNVPIVMLTAKDEDIDKIWGLEAGADDYITKPFNTRELLARIKAVL 116

Query: 119 QMQKSKD 125
           + +  + 
Sbjct: 117 RRRSGEQ 123


>gi|330976281|gb|EGH76342.1| phosphate regulon transcriptional regulatory protein PhoB
           [Pseudomonas syringae pv. aptata str. DSM 50252]
          Length = 229

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 24/121 (19%), Positives = 55/121 (45%), Gaps = 3/121 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEG--V 59
            S+L+VD    +R++        G+   EA +  +A      +  P+ +++D  + G   
Sbjct: 4   RSILIVDDEAPIREMIAVALEMAGYDCIEAENSQQAHPIIV-DRKPDLILLDWMLPGTSG 62

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           +E    +++  L  D+ +  L  + + +  I G   GA+ ++ KPF+   L   ++ + +
Sbjct: 63  IELARRLKRDELTGDIPIIMLTAKGEEDNKIQGLEVGADDYITKPFSPRELVARLKAVLR 122

Query: 120 M 120
            
Sbjct: 123 R 123


>gi|330950929|gb|EGH51189.1| response regulator receiver:transcriptional regulatory protein
           [Pseudomonas syringae Cit 7]
          Length = 245

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/123 (23%), Positives = 50/123 (40%), Gaps = 3/123 (2%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
            S+LLVD    +R++     +  GF V       + R     E   + L++D  +     
Sbjct: 6   KSILLVDDDQEIRELLDTYLSRAGFQVRTVGDGADFRRAFNDEPS-DLLILDVMLPDEDG 64

Query: 62  F--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
           F     +RQ P    V +  L    D    + G   GA+ +L KPF+   L+  ++ L +
Sbjct: 65  FSLCRWIRQHPRQPHVPIIMLTASSDEADRVIGLELGADDYLGKPFSPRELQARIKALLR 124

Query: 120 MQK 122
             +
Sbjct: 125 RAQ 127


>gi|307150227|ref|YP_003885611.1| winged helix family two component transcriptional regulator
           [Cyanothece sp. PCC 7822]
 gi|306980455|gb|ADN12336.1| two component transcriptional regulator, winged helix family
           [Cyanothece sp. PCC 7822]
          Length = 246

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 26/122 (21%), Positives = 53/122 (43%), Gaps = 3/122 (2%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L++D    + ++        G+ V +A    +  +    +L P+ +++D  +  V 
Sbjct: 1   MPRILVIDDDPAISELVSINLEMAGYDVNQAEDGIKG-QALAVQLQPDLIMLDLMLPKVD 59

Query: 61  EF--IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            F     +R+    +D+ V  L      +  + G  AGA+ +L KPF  E +   +R L 
Sbjct: 60  GFTVCQRLRRDERTSDIPVLMLTALGQTQDKVEGFNAGADDYLTKPFEVEEMLARVRALL 119

Query: 119 QM 120
           + 
Sbjct: 120 RR 121


>gi|119025295|ref|YP_909140.1| response regulator of two-component system [Bifidobacterium
           adolescentis ATCC 15703]
 gi|118764879|dbj|BAF39058.1| response regulator of two-component system [Bifidobacterium
           adolescentis ATCC 15703]
          Length = 235

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 23/128 (17%), Positives = 50/128 (39%), Gaps = 6/128 (4%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVL 60
           M  +L+V+     R+   +     G+ V  A +  E  E   K    + +++D  + G+ 
Sbjct: 2   MTRILIVEDEESYREPLVYQLTREGYDVSAAATGEEGLELFTKGG-IDLVLLDLMLPGLD 60

Query: 61  E--FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
                  +R+      V +  L  +      + G   GA+ ++ KP++   L   +R + 
Sbjct: 61  GTALCRRIREQSR---VPIIMLTAKSAEIDKVVGLEIGADDYITKPYSFRELLARIRAVL 117

Query: 119 QMQKSKDE 126
           +  +   E
Sbjct: 118 RRNQMVAE 125


>gi|317050079|ref|YP_004117727.1| winged helix family two component transcriptional regulator
           [Pantoea sp. At-9b]
 gi|316951696|gb|ADU71171.1| two component transcriptional regulator, winged helix family
           [Pantoea sp. At-9b]
          Length = 232

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 29/131 (22%), Positives = 52/131 (39%), Gaps = 7/131 (5%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESME--G 58
           M+ +LLVD    +  + + L    GF V  A+   +A      +   + L++D  M    
Sbjct: 1   MNKILLVDDDRELTSLLKELLEMEGFEVMVASDGEQALNLL--DNTVDLLLLDVMMPKKN 58

Query: 59  VLEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELP 118
            ++ +  +RQ        V  L         + G   GA+ +L KPFN   L   +R + 
Sbjct: 59  GIDTLKELRQQ---HQTPVIMLTARGSELDRVLGLELGADDYLPKPFNDRELVARIRAIL 115

Query: 119 QMQKSKDENQF 129
           +     ++ Q 
Sbjct: 116 RRSNWSEQQQQ 126


>gi|153810970|ref|ZP_01963638.1| hypothetical protein RUMOBE_01361 [Ruminococcus obeum ATCC 29174]
 gi|149832858|gb|EDM87941.1| hypothetical protein RUMOBE_01361 [Ruminococcus obeum ATCC 29174]
          Length = 233

 Score =  149 bits (377), Expect = 1e-34,   Method: Composition-based stats.
 Identities = 21/126 (16%), Positives = 51/126 (40%), Gaps = 6/126 (4%)

Query: 2   DSLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLE 61
             +L+VD  + + ++         F         +A +       P+ +++D  + G+  
Sbjct: 5   QKILIVDDDNNIAELISLYLTKECFETRIVNDGEQALKDF-ASFQPDLILLDLMLPGIDG 63

Query: 62  --FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQ 119
                 +R     +DV +  L  + +    + G   GA+ +++KPF+ + L   +R + +
Sbjct: 64  YQVCREIR---HTSDVPIIMLSAKGETFDKVLGLELGADDYIIKPFDTKELVARVRAVLR 120

Query: 120 MQKSKD 125
             K + 
Sbjct: 121 RFKVRQ 126


>gi|156741487|ref|YP_001431616.1| two component transcriptional regulator [Roseiflexus castenholzii
           DSM 13941]
 gi|156232815|gb|ABU57598.1| tw