RPSBLAST alignment for GI: 254780892 and conserved domain: COG2197

>gnl|CDD|32379 COG2197, CitB, Response regulator containing a CheY-like receiver domain and an HTH DNA-binding domain [Signal transduction mechanisms / Transcription]. Length = 211
 Score = 41.5 bits (97), Expect = 8e-05
 Identities = 39/119 (32%), Positives = 61/119 (51%), Gaps = 7/119 (5%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFM--VFEATSVCEAREFCEKELLPNYLVIDESMEGV- 59
            +L+VD   +VR+  R L      +  V EA++  EA +    EL P+ +++D SM G+ 
Sbjct: 2   KVLIVDDHPLVREGLRQLLELEPDLEVVGEASNGEEALDLAR-ELKPDVVLLDLSMPGMD 60

Query: 60  -LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            LE +  +R    G D+ V  L    D   +I   RAGA+ +LLK  + E L  A+R +
Sbjct: 61  GLEALKQLRA--RGPDIKVVVLTAHDDPAYVIRALRAGADGYLLKDASPEELVEAIRAV 117