RPSBLAST alignment of GI: 254780892 and protein with PDBid: 1tmy

>1tmy_A CHEY protein, TMY; chemotaxis, phosphoryl transfer, signal transduction; 1.90A {Thermotoga maritima} SCOP: c.23.1.1 PDB: 2tmy_A 3tmy_A 4tmy_A 1u0s_Y Length = 120
 Score = 49.1 bits (117), Expect = 3e-07
 Identities = 22/116 (18%), Positives = 51/116 (43%), Gaps = 4/116 (3%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+VD +  +R + + +    G+ V    +         KEL P+ + +D +M  +  ++
Sbjct: 5   VLIVDDAAFMRMMLKDIITKAGYEVAGEATNGREAVEKYKELKPDIVTMDITMPEMNGID 64

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            I  + ++    +  +           +I   +AGA  F++KPF    +  A+ ++
Sbjct: 65  AIKEIMKI--DPNAKIIVCSAMGQQAMVIEAIKAGAKDFIVKPFQPSRVVEALNKV 118