RPSBLAST alignment of GI: 254780892 and protein with PDBid: 2oqr

>2oqr_A Sensory transduction protein REGX3; response regulator, winged-helix-turn-helix, DNA-binding, 3D domain swapping; 2.03A {Mycobacterium tuberculosis H37RV} Length = 230
 Score = 51.6 bits (123), Expect = 5e-08
 Identities = 21/126 (16%), Positives = 44/126 (34%), Gaps = 2/126 (1%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEF 62
           S+L+V+    +      L    GF     T    A    ++      +V+ + M   +  
Sbjct: 6   SVLIVEDEESLADPLAFLLRKEGFEATVVTDGPAALAEFDRA--GADIVLLDLMLPGMSG 63

Query: 63  IAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMRELPQMQK 122
               +Q+   + V V  +         + G   GA+ ++ KP++   L   +R + +   
Sbjct: 64  TDVCKQLRARSSVPVIMVTARDSEIDKVVGLELGADDYVTKPYSARELIARIRAVLRRGG 123

Query: 123 SKDENQ 128
             D   
Sbjct: 124 DDDSEM 129