RPSBLAST alignment of GI: 254780892 and protein with PDBid: 2pl1

>2pl1_A Transcriptional regulatory protein PHOP; CHEY-like fold, response regulator, beryllium fluoride, transcription factor, activated, virulence; 1.90A {Escherichia coli} SCOP: c.23.1.1 PDB: 2pkx_A Length = 121
 Score = 50.5 bits (120), Expect = 1e-07
 Identities = 22/114 (19%), Positives = 48/114 (42%), Gaps = 1/114 (0%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +L+V+ + ++R   +    D G  V +A    EA  +  + + P+  ++D  +       
Sbjct: 3   VLVVEDNALLRHHLKVQIQDAGHQVDDAEDAKEADYYLNEHI-PDIAIVDLGLPDEDGLS 61

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
              R       + +  L     ++  +    AGA+ ++ KPF+ E +   M+ L
Sbjct: 62  LIRRWRSNDVSLPILVLTARESWQDKVEVLSAGADDYVTKPFHIEEVMARMQAL 115