RPSBLAST alignment of GI: 254780892 and protein with PDBid: 2zay

>2zay_A Response regulator receiver protein; structural genomics, NYSGXRC, target 11006U, PSI-2, protein structure initiative; 2.00A {Desulfuromonas acetoxidans dsm 684} Length = 147
 Score = 54.7 bits (131), Expect = 7e-09
 Identities = 20/117 (17%), Positives = 42/117 (35%), Gaps = 5/117 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESM---EGVL 60
           ++LVD+            +  GF + +  +  EA     K     +L+I E+       +
Sbjct: 11  IMLVDTQLPALAASISALSQEGFDIIQCGNAIEAVPVAVKT--HPHLIITEANMPKISGM 68

Query: 61  EFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
           +    +++ P    + V  L      ++       G   F+ KP N   L   ++ +
Sbjct: 69  DLFNSLKKNPQTASIPVIALSGRATAKEEAQLLDMGFIDFIAKPVNAIRLSARIKRV 125