RPSBLAST alignment of GI: 254780892 and protein with PDBid: 3bre

>3bre_A Probable two-component response regulator; protein-nucleotide complex, signaling protein; HET: C2E; 2.40A {Pseudomonas aeruginosa PAO1} PDB: 3i5a_A* Length = 358
 Score = 47.4 bits (112), Expect = 1e-06
 Identities = 27/107 (25%), Positives = 45/107 (42%), Gaps = 4/107 (3%)

Query: 5   LLVDSSHIVRK-VGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           LLVD   ++ + V R L ++ G      +   +A     +   P  ++ D  M GV  L 
Sbjct: 22  LLVDDQAMIGEAVRRSLASEAGIDFHFCSDPQQAVAVANQIK-PTVILQDLVMPGVDGLT 80

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRE 108
            +A  R  P   D+ +  L  + +     A   AGAN +L+K  +  
Sbjct: 81  LLAAYRGNPATRDIPIIVLSTKEEPTVKSAAFAAGANDYLVKLPDAI 127