RPSBLAST alignment of GI: 254780892 and protein with PDBid: 3c97

>3c97_A Signal transduction histidine kinase; structural genomics, signaling, PSI-2, protein structure initiative; 1.70A {Aspergillus oryzae RIB40} Length = 140
 Score = 58.5 bits (141), Expect = 5e-10
 Identities = 17/116 (14%), Positives = 39/116 (33%), Gaps = 1/116 (0%)

Query: 3   SLLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLV-IDESMEGVLE 61
           S+L+ + + I R V           +   T+  +A +  +       ++ I   +   LE
Sbjct: 12  SVLIAEDNDICRLVAAKALEKCTNDITVVTNGLQALQAYQNRQFDVIIMDIQMPVMDGLE 71

Query: 62  FIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            ++ +R      +     ++             A  + ++ KP N   LR  +   
Sbjct: 72  AVSEIRNYERTHNTKRASIIAITADTIDDDRPGAELDEYVSKPLNPNQLRDVVLTC 127