RPSBLAST alignment of GI: 254780892 and protein with PDBid: 3ilh

>3ilh_A Two component response regulator; NYSGXRC, PSI-II, protein structure initiative, structural genomics; 2.59A {Cytophaga hutchinsonii atcc 33406} Length = 146
 Score = 46.0 bits (108), Expect = 3e-06
 Identities = 19/128 (14%), Positives = 41/128 (32%), Gaps = 11/128 (8%)

Query: 1   MDSLLLVDSSHIVRKVGRHLFNDFGFM--VFEATSVCEAREFCEKELLPNY---LVIDES 55
           +DS+LL+D   IV  +   +      +  +   TS   A     +         ++  + 
Sbjct: 9   IDSVLLIDDDDIVNFLNTTIIRMTHRVEEIQSVTSGNAAINKLNELYAAGRWPSIICIDI 68

Query: 56  MEGVLEFIAHVRQM-----PLGTDVFVYYLLMEVD-FEKMIAGARAGANSFLLKPFNRET 109
               +     +        P+     V  L   +D  ++  A A    + ++ KP     
Sbjct: 69  NMPGINGWELIDLFKQHFQPMKNKSIVCLLSSSLDPRDQAKAEASDWVDYYVSKPLTANA 128

Query: 110 LRFAMREL 117
           L     ++
Sbjct: 129 LNNLYNKV 136