RPSBLAST alignment of GI: 254780892 and protein with PDBid: 3kcn

>3kcn_A Adenylate cyclase homolog; SGX, PSI 2, structural genomics, protein structure initiative; 2.45A {Rhodopirellula baltica} Length = 151
 Score = 48.9 bits (116), Expect = 4e-07
 Identities = 21/126 (16%), Positives = 41/126 (32%), Gaps = 2/126 (1%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGVLEFI 63
           +LLVD  + +    +   +   F V    S  EA    +K    + +++D  M G+    
Sbjct: 7   ILLVDDDYSLLNTLKRNLSF-DFEVTTCESGPEALACIKKSDPFSVIMVDMRMPGMEGTE 65

Query: 64  AHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAG-ANSFLLKPFNRETLRFAMRELPQMQK 122
              +   +  +     L    D    +     G    FL KP     ++ A+    +   
Sbjct: 66  VIQKARLISPNSVYLMLTGNQDLTTAMEAVNEGQVFRFLNKPCQMSDIKAAINAGIKQYD 125

Query: 123 SKDENQ 128
                +
Sbjct: 126 LVTSKE 131