RPSBLAST alignment of GI: 254780892 and protein with PDBid: 3kyj

>3kyj_B CHEY6 protein, putative histidine protein kinase; protein-protein interaction, histidine kinase, response regulator, phosphorylation; 1.40A {Rhodobacter sphaeroides} PDB: 3kyi_B* Length = 145
 Score = 55.2 bits (133), Expect = 4e-09
 Identities = 16/116 (13%), Positives = 41/116 (35%), Gaps = 5/116 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFM--VFEATSVCEAREFCEKELLPNYLVIDESMEGV-- 59
           +++VD + ++R               V +A +  EA +    +   + +++D  M  +  
Sbjct: 16  VMIVDDAAMMRLYIASFIKTLPDFKVVAQAANGQEALDKLAAQPNVDLILLDIEMPVMDG 75

Query: 60  LEFIAHVRQMPLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMR 115
           +EF+ H +       + +   +              GA+  + KP    +     +
Sbjct: 76  MEFLRHAKLKT-RAKICMLSSVAVSGSPHAARARELGADGVVAKPSGTVSHDLEEK 130