RPSBLAST alignment of GI: 254780892 and protein with PDBid: 3m6m

>3m6m_D Sensory/regulatory protein RPFC; RPFF, REC, enoyl-COA hydratase, lyase-transferase COMP; 2.50A {Xanthomonas campestris PV} Length = 143
 Score = 57.7 bits (140), Expect = 7e-10
 Identities = 28/118 (23%), Positives = 48/118 (40%), Gaps = 5/118 (4%)

Query: 4   LLLVDSSHIVRKVGRHLFNDFGFMVFEATSVCEAREFCEKELLPNYLVIDESMEGV--LE 61
           +L+ D     R V + L    G  V       +  +   +E   + +++D  M G+  L+
Sbjct: 17  MLVADDHEANRMVLQRLLEKAGHKVLCVNGAEQVLDAMAEED-YDAVIVDLHMPGMNGLD 75

Query: 62  FIAHVRQM--PLGTDVFVYYLLMEVDFEKMIAGARAGANSFLLKPFNRETLRFAMREL 117
            +  +R M         V  L  +V  E + A  +AGA +FL KP     L   + +L
Sbjct: 76  MLKQLRVMQASGMRYTPVVVLSADVTPEAIRACEQAGARAFLAKPVVAAKLLDTLADL 133