BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780894|ref|YP_003065307.1| hypothetical protein CLIBASIA_03955 [Candidatus Liberibacter asiaticus str. psy62] (103 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780894|ref|YP_003065307.1| hypothetical protein CLIBASIA_03955 [Candidatus Liberibacter asiaticus str. psy62] Length = 103 Score = 200 bits (508), Expect = 5e-54, Method: Compositional matrix adjust. Identities = 103/103 (100%), Positives = 103/103 (100%) Query: 1 MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAY 60 MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAY Sbjct: 1 MRLQEQRTRLKEFRLNDERRQLQQLRATILEFRRIVADLEKQIAIEERQVGIYDKDHFAY 60 Query: 61 PILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNSDKSVS 103 PILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNSDKSVS Sbjct: 61 PILAKSARQRIDNLLLSIRDLLLRQESLESHLESESNSDKSVS 103 >gi|254780403|ref|YP_003064816.1| hypothetical protein CLIBASIA_01440 [Candidatus Liberibacter asiaticus str. psy62] Length = 80 Score = 22.7 bits (47), Expect = 1.6, Method: Compositional matrix adjust. Identities = 9/27 (33%), Positives = 16/27 (59%) Query: 50 VGIYDKDHFAYPILAKSARQRIDNLLL 76 VGI+ AY + + ++Q +DN L+ Sbjct: 36 VGIFSSYSNAYDVWKEKSQQMVDNALM 62 >gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] Length = 162 Score = 21.6 bits (44), Expect = 3.3, Method: Compositional matrix adjust. Identities = 10/27 (37%), Positives = 15/27 (55%) Query: 65 KSARQRIDNLLLSIRDLLLRQESLESH 91 K ++RIDN+L S L +S + H Sbjct: 5 KYTKERIDNILASFSGGLSLSQSCKKH 31 >gi|254780613|ref|YP_003065026.1| adenylosuccinate synthetase [Candidatus Liberibacter asiaticus str. psy62] Length = 432 Score = 21.6 bits (44), Expect = 3.4, Method: Composition-based stats. Identities = 15/53 (28%), Positives = 22/53 (41%), Gaps = 7/53 (13%) Query: 21 QLQQLRATILEFRRIVADLEKQ-------IAIEERQVGIYDKDHFAYPILAKS 66 +L R IL F ++ L ++ I E Q + D DH YP + S Sbjct: 191 ELMYAREKILPFMDVIWSLLERESRKGAHILFEGAQGFLLDNDHGTYPFVTSS 243 >gi|254780960|ref|YP_003065373.1| phosphoserine phosphatase SerB [Candidatus Liberibacter asiaticus str. psy62] Length = 297 Score = 21.2 bits (43), Expect = 4.6, Method: Compositional matrix adjust. Identities = 11/24 (45%), Positives = 13/24 (54%) Query: 50 VGIYDKDHFAYPILAKSARQRIDN 73 V Y A P LAK A+ RID+ Sbjct: 253 VAGYGVAFHAKPALAKQAKIRIDH 276 >gi|254780955|ref|YP_003065368.1| hypothetical protein CLIBASIA_04270 [Candidatus Liberibacter asiaticus str. psy62] Length = 204 Score = 20.0 bits (40), Expect = 9.2, Method: Compositional matrix adjust. Identities = 10/24 (41%), Positives = 15/24 (62%) Query: 54 DKDHFAYPILAKSARQRIDNLLLS 77 + DH Y ILAK A + + ++LS Sbjct: 26 NYDHIRYDILAKEALRGLVKVVLS 49 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.320 0.134 0.345 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 52,078 Number of Sequences: 1233 Number of extensions: 1665 Number of successful extensions: 11 Number of sequences better than 100.0: 11 Number of HSP's better than 100.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of query: 103 length of database: 328,796 effective HSP length: 62 effective length of query: 41 effective length of database: 252,350 effective search space: 10346350 effective search space used: 10346350 T: 11 A: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 32 (16.9 bits)