HHsearch alignment for GI: 254780895 and conserved domain: PRK09413

>PRK09413 insertion sequence 2 OrfA protein; Reviewed.
Probab=90.78  E-value=0.6  Score=27.49  Aligned_cols=59  Identities=14%  Similarity=0.258  Sum_probs=51.9

Q ss_pred             CCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHHH
Q ss_conf             75998850367799999999860886999999770679999999999999839986887
Q gi|254780895|r   25 LPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLRT   83 (91)
Q Consensus        25 LPp~~T~RWVasRKA~VV~aV~~GLis~~EA~~rY~LS~EEf~~W~~av~~hG~~gLr~   83 (91)
T Consensus         5 ~G~erRRrws~~EK~~IV~es~ePG~sVs~VARrHGi~~~qlf~WRr~~~eG~~~AV~a   63 (121)
T PRK09413          5 LGPEKRRRRTTQEKIAIVQQSFEPGMTVSLVARQHGVAASQLFLWRKQYQEGSLTAVAA   63 (121)
T ss_pred             CCCCHHCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHCCCCCCCC
T ss_conf             57204126888999999999956998499999994998999999999986212113467