HHSEARCH alignment of GI: 254780895 and SCOP domain: d2oa4a1

Alignment
>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678 {Silicibacter pomeroyi [TaxId: 89184]}
Probab=100.00  E-value=1e-41  Score=260.64  Aligned_cols=89  Identities=47%  Similarity=0.718  Sum_probs=85.4

Q ss_pred             CCCCCCCCEEECCCCCCCCHHHCCCCCCCCHHHHHHHHHHHHHHCCCCCHHHHHHHCCCCHHHHHHHHHHHHHHCHHHHH
Q ss_conf             42032322677799983353217599885036779999999986088699999977067999999999999983998688
Q gi|254780895|r    3 EKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHGLAGLR   82 (91)
Q Consensus         3 e~~~~~~~~V~gPdGs~lt~aDLPp~~T~RWVasRKA~VV~aV~~GLis~~EA~~rY~LS~EEf~~W~~av~~hG~~gLr   82 (91)
                      -..-..|+.|+|||||+||++||||++|+||||||||+||++|.+||||++|||++|+||+|||.+|++++++||++|||
T Consensus         4 ~~~~~gpr~vt~pdgs~~t~~dLp~~~trRWva~RKaaVV~av~~Gl~S~~EAcrrY~LS~eEf~~W~~a~~~hGe~aLr   83 (93)
T d2oa4a1           4 LRKVEGPRSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSWVSALAEHGKDALK   83 (93)
T ss_dssp             SSCCSSSCEEECSSSCEEETTSSCCSCCSCCCHHHHHHHHHHHHHTTCCHHHHHHTTCSSHHHHHHHHHHHHCCCSSSSC
T ss_pred             CCCCCCCCEEECCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHCCCCCHHHHHHHHCCCHHHHHHHHHHHHHHHHHHHH
T ss_conf             24589985145799984411119996664113999999999998385779999988399999999999999998699999


Q ss_pred             HHHHHHHCC
Q ss_conf             757776339
Q gi|254780895|r   83 TTQIQKYRE   91 (91)
Q Consensus        83 ~T~lQ~YRq   91 (91)
                      +|+||+|||
T Consensus        84 ~t~~q~yr~   92 (93)
T d2oa4a1          84 VTALKKYRQ   92 (93)
T ss_dssp             CHHHHHHHH
T ss_pred             HHHHHHHHC
T ss_conf             998999863


SCOP domain information

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: TrpR-like
family: SPO1678-like
domain: Uncharacterized protein SPO1678
species: Silicibacter pomeroyi [TaxId: 89184]