BLAST/PSIBLAST alignment of GI: 254780895 and GI: 114706636 at iteration 1
>gi|114706636|ref|ZP_01439537.1| hypothetical protein FP2506_12829 [Fulvimarina pelagi HTCC2506] Length = 96
>gi|114538028|gb|EAU41151.1| hypothetical protein FP2506_12829 [Fulvimarina pelagi HTCC2506] Length = 96
 Score =  155 bits (392), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 82/90 (91%)

Query: 1  MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYT 60
          M ++++S +KYVIGPDGSPLT+A+LPP NTRRWV RRKAEVVAAV+GGLLSLEEAC  YT
Sbjct: 1  MADQVRSRIKYVIGPDGSPLTLADLPPCNTRRWVIRRKAEVVAAVRGGLLSLEEACSKYT 60

Query: 61 LTVEEFLSWQASIVQHGLAGLRTTQIQKYR 90
          LTVEEFLSWQ SI QHGLAGLRTTQIQ+YR
Sbjct: 61 LTVEEFLSWQLSIDQHGLAGLRTTQIQEYR 90