BLAST/PSIBLAST alignment of GI: 254780895 and GI: 17986710 at iteration 1
>gi|17986710|ref|NP_539344.1| hypothetical protein BMEI0427 [Brucella melitensis bv. 1 str. 16M] Length = 91
>gi|23502456|ref|NP_698583.1| hypothetical protein BR1593 [Brucella suis 1330] Length = 91
>gi|62290473|ref|YP_222266.1| hypothetical protein BruAb1_1580 [Brucella abortus bv. 1 str. 9-941] Length = 91
>gi|82700397|ref|YP_414971.1| hypothetical protein BAB1_1609 [Brucella melitensis biovar Abortus 2308] Length = 91
>gi|148559203|ref|YP_001259460.1| hypothetical protein BOV_1536 [Brucella ovis ATCC 25840] Length = 91
>gi|161619533|ref|YP_001593420.1| hypothetical protein BCAN_A1628 [Brucella canis ATCC 23365] Length = 91
>gi|163843842|ref|YP_001628246.1| hypothetical protein BSUIS_A1648 [Brucella suis ATCC 23445] Length = 91
>gi|189024701|ref|YP_001935469.1| hypothetical protein BAbS19_I15050 [Brucella abortus S19] Length = 91
>gi|225628028|ref|ZP_03786064.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] Length = 91
>gi|225853067|ref|YP_002733300.1| hypothetical protein BMEA_A1646 [Brucella melitensis ATCC 23457] Length = 91
>gi|237815982|ref|ZP_04594979.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] Length = 91
>gi|239832471|ref|ZP_04680800.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 91
>gi|254689774|ref|ZP_05153028.1| hypothetical protein Babob68_06284 [Brucella abortus bv. 6 str. 870] Length = 91
>gi|254694263|ref|ZP_05156091.1| hypothetical protein Babob3T_06294 [Brucella abortus bv. 3 str. Tulya] Length = 91
>gi|254697918|ref|ZP_05159746.1| hypothetical protein Babob28_09455 [Brucella abortus bv. 2 str. 86/8/59] Length = 91
>gi|254702311|ref|ZP_05164139.1| hypothetical protein Bsuib55_15826 [Brucella suis bv. 5 str. 513] Length = 91
>gi|254704839|ref|ZP_05166667.1| hypothetical protein Bsuib36_13154 [Brucella suis bv. 3 str. 686] Length = 91
>gi|254708253|ref|ZP_05170081.1| hypothetical protein BpinM_15174 [Brucella pinnipedialis M163/99/10] Length = 91
>gi|254710625|ref|ZP_05172436.1| hypothetical protein BpinB_10216 [Brucella pinnipedialis B2/94] Length = 91
>gi|254714809|ref|ZP_05176620.1| hypothetical protein BcetM6_16014 [Brucella ceti M644/93/1] Length = 91
>gi|254717869|ref|ZP_05179680.1| hypothetical protein BcetM_15981 [Brucella ceti M13/05/1] Length = 91
>gi|254719619|ref|ZP_05181430.1| hypothetical protein Bru83_08760 [Brucella sp. 83/13] Length = 91
>gi|254730808|ref|ZP_05189386.1| hypothetical protein Babob42_06314 [Brucella abortus bv. 4 str. 292] Length = 91
>gi|256032118|ref|ZP_05445732.1| hypothetical protein BpinM2_15983 [Brucella pinnipedialis M292/94/1] Length = 91
>gi|256045210|ref|ZP_05448108.1| hypothetical protein Bmelb1R_12016 [Brucella melitensis bv. 1 str. Rev.1] Length = 91
>gi|256061640|ref|ZP_05451779.1| hypothetical protein Bneo5_14935 [Brucella neotomae 5K33] Length = 91
>gi|256114162|ref|ZP_05454916.1| hypothetical protein Bmelb3E_15232 [Brucella melitensis bv. 3 str. Ether] Length = 91
>gi|256160314|ref|ZP_05458008.1| hypothetical protein BcetM4_15011 [Brucella ceti M490/95/1] Length = 91
>gi|256255519|ref|ZP_05461055.1| hypothetical protein BcetB_14788 [Brucella ceti B1/94] Length = 91
>gi|256258026|ref|ZP_05463562.1| hypothetical protein Babob9C_11898 [Brucella abortus bv. 9 str. C68] Length = 91
>gi|256263450|ref|ZP_05465982.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] Length = 91
>gi|256370006|ref|YP_003107517.1| hypothetical protein BMI_I1606 [Brucella microti CCM 4915] Length = 91
>gi|260169253|ref|ZP_05756064.1| hypothetical protein BruF5_13003 [Brucella sp. F5/99] Length = 91
>gi|260547005|ref|ZP_05822744.1| conserved hypothetical protein [Brucella abortus NCTC 8038] Length = 91
>gi|260565192|ref|ZP_05835676.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] Length = 91
>gi|260565919|ref|ZP_05836389.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] Length = 91
>gi|260755306|ref|ZP_05867654.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] Length = 91
>gi|260758527|ref|ZP_05870875.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] Length = 91
>gi|260762351|ref|ZP_05874694.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] Length = 91
>gi|260884322|ref|ZP_05895936.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] Length = 91
>gi|261214570|ref|ZP_05928851.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 91
>gi|261219715|ref|ZP_05933996.1| conserved hypothetical protein [Brucella ceti M13/05/1] Length = 91
>gi|261222728|ref|ZP_05937009.1| conserved hypothetical protein [Brucella ceti B1/94] Length = 91
>gi|261315754|ref|ZP_05954951.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 91
>gi|261318197|ref|ZP_05957394.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] Length = 91
>gi|261322604|ref|ZP_05961801.1| conserved hypothetical protein [Brucella ceti M644/93/1] Length = 91
>gi|261325650|ref|ZP_05964847.1| conserved hypothetical protein [Brucella neotomae 5K33] Length = 91
>gi|261752877|ref|ZP_05996586.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] Length = 91
>gi|261755535|ref|ZP_05999244.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] Length = 91
>gi|261758766|ref|ZP_06002475.1| conserved hypothetical protein [Brucella sp. F5/99] Length = 91
>gi|265984630|ref|ZP_06097365.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 91
>gi|265989229|ref|ZP_06101786.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] Length = 91
>gi|265991643|ref|ZP_06104200.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] Length = 91
>gi|265995481|ref|ZP_06108038.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] Length = 91
>gi|265998691|ref|ZP_06111248.1| conserved hypothetical protein [Brucella ceti M490/95/1] Length = 91
>gi|294852906|ref|ZP_06793579.1| hypothetical protein BAZG_01842 [Brucella sp. NVSL 07-0026] Length = 91
>gi|297248857|ref|ZP_06932575.1| hypothetical protein BAYG_01825 [Brucella abortus bv. 5 str. B3196] Length = 91
>gi|306843062|ref|ZP_07475685.1| Hypothetical protein BIBO2_2824 [Brucella sp. BO2] Length = 91
>gi|306844593|ref|ZP_07477180.1| Hypothetical protein BIBO1_1267 [Brucella sp. BO1] Length = 91
>gi|17982333|gb|AAL51608.1| hypothetical protein BMEI0427 [Brucella melitensis bv. 1 str. 16M] Length = 91
>gi|23348447|gb|AAN30498.1| conserved hypothetical protein [Brucella suis 1330] Length = 91
>gi|62196605|gb|AAX74905.1| conserved hypothetical protein [Brucella abortus bv. 1 str. 9-941] Length = 91
>gi|82616498|emb|CAJ11565.1| conserved hypothetical protein [Brucella melitensis biovar Abortus 2308] Length = 91
>gi|148370460|gb|ABQ60439.1| conserved hypothetical protein [Brucella ovis ATCC 25840] Length = 91
>gi|161336344|gb|ABX62649.1| Hypothetical protein BCAN_A1628 [Brucella canis ATCC 23365] Length = 91
>gi|163674565|gb|ABY38676.1| Hypothetical protein BSUIS_A1648 [Brucella suis ATCC 23445] Length = 91
>gi|189020273|gb|ACD72995.1| hypothetical protein BAbS19_I15050 [Brucella abortus S19] Length = 91
>gi|225617191|gb|EEH14237.1| Hypothetical protein, conserved [Brucella ceti str. Cudo] Length = 91
>gi|225641432|gb|ACO01346.1| Hypothetical protein, conserved [Brucella melitensis ATCC 23457] Length = 91
>gi|237789280|gb|EEP63491.1| Hypothetical protein, conserved [Brucella abortus str. 2308 A] Length = 91
>gi|239824738|gb|EEQ96306.1| Hypothetical protein, conserved [Ochrobactrum intermedium LMG 3301] Length = 91
>gi|256000169|gb|ACU48568.1| hypothetical protein BMI_I1606 [Brucella microti CCM 4915] Length = 91
>gi|260096055|gb|EEW79932.1| conserved hypothetical protein [Brucella abortus NCTC 8038] Length = 91
>gi|260151260|gb|EEW86354.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. 16M] Length = 91
>gi|260155437|gb|EEW90517.1| conserved hypothetical protein [Brucella suis bv. 4 str. 40] Length = 91
>gi|260668845|gb|EEX55785.1| conserved hypothetical protein [Brucella abortus bv. 4 str. 292] Length = 91
>gi|260672783|gb|EEX59604.1| conserved hypothetical protein [Brucella abortus bv. 2 str. 86/8/59] Length = 91
>gi|260675414|gb|EEX62235.1| conserved hypothetical protein [Brucella abortus bv. 6 str. 870] Length = 91
>gi|260873850|gb|EEX80919.1| conserved hypothetical protein [Brucella abortus bv. 9 str. C68] Length = 91
>gi|260916177|gb|EEX83038.1| conserved hypothetical protein [Brucella abortus bv. 3 str. Tulya] Length = 91
>gi|260921312|gb|EEX87965.1| conserved hypothetical protein [Brucella ceti B1/94] Length = 91
>gi|260924804|gb|EEX91372.1| conserved hypothetical protein [Brucella ceti M13/05/1] Length = 91
>gi|261295294|gb|EEX98790.1| conserved hypothetical protein [Brucella ceti M644/93/1] Length = 91
>gi|261297420|gb|EEY00917.1| conserved hypothetical protein [Brucella pinnipedialis B2/94] Length = 91
>gi|261301630|gb|EEY05127.1| conserved hypothetical protein [Brucella neotomae 5K33] Length = 91
>gi|261304780|gb|EEY08277.1| conserved hypothetical protein [Brucella pinnipedialis M163/99/10] Length = 91
>gi|261738750|gb|EEY26746.1| conserved hypothetical protein [Brucella sp. F5/99] Length = 91
>gi|261742630|gb|EEY30556.1| conserved hypothetical protein [Brucella suis bv. 5 str. 513] Length = 91
>gi|261745288|gb|EEY33214.1| conserved hypothetical protein [Brucella suis bv. 3 str. 686] Length = 91
>gi|262553315|gb|EEZ09149.1| conserved hypothetical protein [Brucella ceti M490/95/1] Length = 91
>gi|262766594|gb|EEZ12383.1| conserved hypothetical protein [Brucella melitensis bv. 3 str. Ether] Length = 91
>gi|263002427|gb|EEZ15002.1| conserved hypothetical protein [Brucella melitensis bv. 1 str. Rev.1] Length = 91
>gi|263093458|gb|EEZ17508.1| conserved hypothetical protein [Brucella melitensis bv. 2 str. 63/9] Length = 91
>gi|264661426|gb|EEZ31687.1| conserved hypothetical protein [Brucella pinnipedialis M292/94/1] Length = 91
>gi|264663222|gb|EEZ33483.1| conserved hypothetical protein [Brucella sp. 83/13] Length = 91
>gi|294821495|gb|EFG38494.1| hypothetical protein BAZG_01842 [Brucella sp. NVSL 07-0026] Length = 91
>gi|297176026|gb|EFH35373.1| hypothetical protein BAYG_01825 [Brucella abortus bv. 5 str. B3196] Length = 91
>gi|306275037|gb|EFM56800.1| Hypothetical protein BIBO1_1267 [Brucella sp. BO1] Length = 91
>gi|306286741|gb|EFM58291.1| Hypothetical protein BIBO2_2824 [Brucella sp. BO2] Length = 91
>gi|326409610|gb|ADZ66675.1| conserved hypothetical protein [Brucella melitensis M28] Length = 91
>gi|326539313|gb|ADZ87528.1| conserved hypothetical protein [Brucella melitensis M5-90] Length = 91
Score = 155 bits (391), Expect = 2e-36, Method: Compositional matrix adjust.
Identities = 73/90 (81%), Positives = 83/90 (92%)
Query: 1 MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYT 60
MT+ ++ +KYVIGPDGSPLTIA+LPP NTRRWV RRKAEVVAAV+GGLLSLEEACQ YT
Sbjct: 1 MTDLVRPRIKYVIGPDGSPLTIADLPPANTRRWVIRRKAEVVAAVRGGLLSLEEACQRYT 60
Query: 61 LTVEEFLSWQASIVQHGLAGLRTTQIQKYR 90
LTVEEFLSWQ+SI +HGLAGLRTT+IQ+YR
Sbjct: 61 LTVEEFLSWQSSIDEHGLAGLRTTRIQQYR 90