RPSBLAST alignment of GI: 254780895 and protein with PDBid: 2jrt

>2jrt_A Uncharacterized protein; solution, structure, NESG, PSI, target RHR5, structural genomics, protein structure initiative; NMR {Rhodobacter sphaeroides} Length = 95
 Score =  128 bits (323), Expect = 4e-31
 Identities = 41/82 (50%), Positives = 56/82 (68%)

Query: 10 KYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69
          + V  PDG+ L+ A+LPP +TRRWVA RKA VV AV  GL++  EA   Y+L+ EEF  W
Sbjct: 10 RQVTLPDGTVLSRADLPPLDTRRWVASRKAAVVKAVIHGLITEREALDRYSLSEEEFALW 69

Query: 70 QASIVQHGLAGLRTTQIQKYRE 91
          ++++  HG   L+ T IQKYR+
Sbjct: 70 RSAVAAHGEKALKVTMIQKYRQ 91