RPS-BLAST 2.2.22 [Sep-27-2009]

Database: scop70_1_75 
           13,730 sequences; 2,407,596 total letters

Searching..................................................done

Query= gi|254780895|ref|YP_003065308.1| hypothetical protein
CLIBASIA_03960 [Candidatus Liberibacter asiaticus str. psy62]
         (91 letters)



>d2oa4a1 a.4.12.3 (A:1-93) Uncharacterized protein SPO1678
          {Silicibacter pomeroyi [TaxId: 89184]}
          Length = 93

 Score =  128 bits (323), Expect = 1e-31
 Identities = 42/82 (51%), Positives = 56/82 (68%)

Query: 10 KYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69
          + V  PDGS +T A+LPP NTRRWVA RK  VV  V  GL++L EA Q Y L+ EEF SW
Sbjct: 11 RSVTLPDGSIMTRADLPPANTRRWVASRKIAVVRGVIYGLITLAEAKQTYGLSDEEFNSW 70

Query: 70 QASIVQHGLAGLRTTQIQKYRE 91
           +++ +HG   L+ T ++KYR+
Sbjct: 71 VSALAEHGKDALKVTALKKYRQ 92


>d2j3wa1 d.110.4.3 (A:1-140) Sedlin (SEDL) {Mouse (Mus musculus)
          [TaxId: 10090]}
          Length = 140

 Score = 26.0 bits (57), Expect = 0.78
 Identities = 4/26 (15%), Positives = 8/26 (30%)

Query: 11 YVIGPDGSPLTIANLPPPNTRRWVAR 36
           ++G   +P+      PP        
Sbjct: 8  VIVGHHDNPVFEMEFLPPGKAESKDD 33


>d2gtta1 a.260.1.1 (A:6-448) Nucleoprotein {Rabies virus [TaxId:
           11292]}
          Length = 443

 Score = 25.6 bits (56), Expect = 1.0
 Identities = 6/22 (27%), Positives = 10/22 (45%)

Query: 48  GLLSLEEACQIYTLTVEEFLSW 69
           GL+S     +   LT  E + +
Sbjct: 233 GLVSFTGFIKQINLTAREAILY 254


>d2gica1 a.260.1.1 (A:2-422) Nucleoprotein {Vesicular stomatitis
           indiana virus [TaxId: 11277]}
          Length = 421

 Score = 25.2 bits (55), Expect = 1.4
 Identities = 5/22 (22%), Positives = 11/22 (50%)

Query: 48  GLLSLEEACQIYTLTVEEFLSW 69
            L +    C+I  ++ E+  +W
Sbjct: 226 ALATFGHLCKITGMSTEDVTTW 247


>d2vkva2 a.121.1.1 (A:68-205) Tetracyclin repressor
          (Tet-repressor, TetR) {Escherichia coli [TaxId: 562]}
          Length = 138

 Score = 25.3 bits (55), Expect = 1.5
 Identities = 6/47 (12%), Positives = 13/47 (27%), Gaps = 4/47 (8%)

Query: 15 PDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTL 61
           DG+ + +   P       V       +  +     SL +     + 
Sbjct: 27 RDGAKVHLGTRPDEKQYDTVET----QLRFMTENGFSLRDGLYAISA 69


>d1gppa_ b.86.1.2 (A:) VMA1-derived endonuclease (VDE) PI-Scei
          intein {Baker's yeast (Saccharomyces cerevisiae)
          [TaxId: 4932]}
          Length = 229

 Score = 25.3 bits (55), Expect = 1.6
 Identities = 7/16 (43%), Positives = 9/16 (56%)

Query: 11 YVIGPDGSPLTIANLP 26
           V+G DG P  +  LP
Sbjct: 28 KVMGKDGRPREVIKLP 43


>d2p12a1 b.175.1.1 (A:8-172) Hypothetical protein RHA1_ro00977
           {Rhodococcus sp. RHA1 [TaxId: 101510]}
          Length = 165

 Score = 23.2 bits (50), Expect = 5.5
 Identities = 8/53 (15%), Positives = 14/53 (26%), Gaps = 6/53 (11%)

Query: 25  LPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSWQASIVQHG 77
           +        +     E++ A   GLL            +    +    I  HG
Sbjct: 102 VRTGRDTELL--DVDELMEAHTTGLLDTAT----AEQAILTATTAIDGIAAHG 148


>d5csma_ a.130.1.2 (A:) Allosteric chorismate mutase {Baker's
          yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
          Length = 256

 Score = 23.2 bits (50), Expect = 5.8
 Identities = 5/27 (18%), Positives = 9/27 (33%)

Query: 2  TEKIQSHMKYVIGPDGSPLTIANLPPP 28
           E   S ++    PD +P     +   
Sbjct: 67 LEIAHSRIRRFESPDETPFFPDKIQKS 93


>d1mj5a_ c.69.1.8 (A:) Haloalkane dehalogenase {Sphingomonas
           paucimobilis, UT26, LinB [TaxId: 13689]}
          Length = 298

 Score = 22.9 bits (47), Expect = 7.3
 Identities = 6/43 (13%), Positives = 12/43 (27%)

Query: 25  LPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFL 67
           L     R +      +    V G     E++       +  F+
Sbjct: 247 LTTGRMRDFCRTWPNQTEITVAGAHFIQEDSPDEIGAAIAAFV 289


>d1qi9a_ a.111.1.2 (A:) Haloperoxidase (bromoperoxidase)
           {Ascophyllum nodosum [TaxId: 52969]}
          Length = 555

 Score = 22.9 bits (49), Expect = 7.8
 Identities = 10/30 (33%), Positives = 13/30 (43%), Gaps = 1/30 (3%)

Query: 12  VIGPDGSPLTIANLPPPNTRRWVARRKAEV 41
           + GP  S  TI    P      +A + AEV
Sbjct: 112 ISGPAFSATTIPP-VPTLPSPELAAQLAEV 140


>d1oc7a_ c.6.1.1 (A:) Cellobiohydrolase II (Cel6) {Humicola
           insolens, Cel6a [TaxId: 34413]}
          Length = 364

 Score = 22.6 bits (48), Expect = 9.9
 Identities = 8/35 (22%), Positives = 14/35 (40%)

Query: 12  VIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVK 46
           VI PD     + N+  P      +  +   + A+K
Sbjct: 136 VIEPDSLANMVTNMNVPKCSGAASTYRELTIYALK 170


  Database: scop70_1_75
    Posted date:  Mar 27, 2010  6:21 PM
  Number of letters in database: 2,407,596
  Number of sequences in database:  13,730
  
Lambda     K      H
   0.318    0.132    0.389 

Gapped
Lambda     K      H
   0.267   0.0667    0.140 


Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 13730
Number of Hits to DB: 341,844
Number of extensions: 13478
Number of successful extensions: 47
Number of sequences better than 10.0: 1
Number of HSP's gapped: 47
Number of HSP's successfully gapped: 11
Length of query: 91
Length of database: 2,407,596
Length adjustment: 55
Effective length of query: 36
Effective length of database: 1,652,446
Effective search space: 59488056
Effective search space used: 59488056
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 47 (22.0 bits)