BLASTP 2.2.22 [Sep-27-2009] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Reference for compositional score matrix adjustment: Altschul, Stephen F., John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis, Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109. Query= gi|254780895|ref|YP_003065308.1| hypothetical protein CLIBASIA_03960 [Candidatus Liberibacter asiaticus str. psy62] (91 letters) Database: las_proteome 1233 sequences; 328,796 total letters Searching...................................................done >gi|254780895|ref|YP_003065308.1| hypothetical protein CLIBASIA_03960 [Candidatus Liberibacter asiaticus str. psy62] Length = 91 Score = 189 bits (480), Expect = 7e-51, Method: Compositional matrix adjust. Identities = 91/91 (100%), Positives = 91/91 (100%) Query: 1 MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYT 60 MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYT Sbjct: 1 MTEKIQSHMKYVIGPDGSPLTIANLPPPNTRRWVARRKAEVVAAVKGGLLSLEEACQIYT 60 Query: 61 LTVEEFLSWQASIVQHGLAGLRTTQIQKYRE 91 LTVEEFLSWQASIVQHGLAGLRTTQIQKYRE Sbjct: 61 LTVEEFLSWQASIVQHGLAGLRTTQIQKYRE 91 >gi|254781217|ref|YP_003065630.1| hypothetical protein CLIBASIA_05620 [Candidatus Liberibacter asiaticus str. psy62] Length = 162 Score = 27.3 bits (59), Expect = 0.045, Method: Compositional matrix adjust. Identities = 12/38 (31%), Positives = 22/38 (57%), Gaps = 1/38 (2%) Query: 32 RWVARRKAEVVAAVKGGLLSLEEACQIYTLTVEEFLSW 69 ++ R ++A+ GGL SL ++C+ + +TV F W Sbjct: 5 KYTKERIDNILASFSGGL-SLSQSCKKHGVTVVSFHGW 41 >gi|254780343|ref|YP_003064756.1| probable cation efflux protein [Candidatus Liberibacter asiaticus str. psy62] Length = 311 Score = 21.6 bits (44), Expect = 2.6, Method: Composition-based stats. Identities = 14/31 (45%), Positives = 17/31 (54%), Gaps = 1/31 (3%) Query: 20 LTIANLPPPNTRRWVARRKAEVVAAVKGGLL 50 L A P NT + +KAE +AAV GLL Sbjct: 60 LKYAYRPADNTHPF-GHQKAEYIAAVVEGLL 89 >gi|254780866|ref|YP_003065279.1| NADH dehydrogenase subunit M [Candidatus Liberibacter asiaticus str. psy62] Length = 499 Score = 20.8 bits (42), Expect = 4.0, Method: Composition-based stats. Identities = 13/37 (35%), Positives = 18/37 (48%), Gaps = 8/37 (21%) Query: 33 WVARR------KAEVVAAVKGGLLSLEEACQIYTLTV 63 W+ R+ K E V +K LSL E C +Y + V Sbjct: 426 WLYRKVVFGVSKCEKVQQLKD--LSLRERCMVYPIAV 460 >gi|254780947|ref|YP_003065360.1| transcription-repair coupling factor [Candidatus Liberibacter asiaticus str. psy62] Length = 1187 Score = 20.4 bits (41), Expect = 6.5, Method: Compositional matrix adjust. Identities = 8/23 (34%), Positives = 15/23 (65%) Query: 44 AVKGGLLSLEEACQIYTLTVEEF 66 AV+GG+L + E + Y + ++ F Sbjct: 168 AVRGGILDVYEPTKKYPVRLDFF 190 Database: las_proteome Posted date: Jun 5, 2011 6:30 PM Number of letters in database: 328,796 Number of sequences in database: 1233 Lambda K H 0.318 0.132 0.389 Lambda K H 0.267 0.0410 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 54,347 Number of Sequences: 1233 Number of extensions: 1627 Number of successful extensions: 5 Number of sequences better than 100.0: 5 Number of HSP's better than 100.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of query: 91 length of database: 328,796 effective HSP length: 59 effective length of query: 32 effective length of database: 256,049 effective search space: 8193568 effective search space used: 8193568 T: 11 A: 40 X1: 16 ( 7.3 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 40 (21.3 bits) S2: 31 (16.5 bits)