HHsearch alignment for GI: 254780896 and conserved domain: TIGR03622

>TIGR03622 urea_t_UrtB_arc urea ABC transporter, permease protein UrtB. Members of this protein family are ABC transporter permease subunits restricted to the Archaea. Several lines of evidence suggest this protein is functionally analogous, as well as homologous, to the UrtB subunit of the Corynebacterium glutamicum urea transporter. All members of the operon show sequence similarity to urea transport subunits, the gene is located near the urease structural subunits in two of three species, and partial phylogenetic profiling identifies this permease subunit as closely matching the profile of urea utilization.
Probab=100.00  E-value=0  Score=328.60  Aligned_cols=278  Identities=15%  Similarity=0.161  Sum_probs=222.6

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             37999999999999999999999998432248999999999999999720456530365335788988987654444543
Q gi|254780896|r   37 KYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLK  116 (351)
Q Consensus        37 ~~~~~~~~~~~i~~l~alGl~li~G~~G~inl~~g~~~~~Gay~~~~l~~~~g~~~~~ai~~a~~~~a~~g~l~g~~~~r  116 (351)
T Consensus         2 ~~~l~~l~~~a~yaL~AlGl~Li~g~~g~~nfahg~f~~lGAY~a~~~~~~~glp~~~a~l~~~~~~~~~g~l~~~~~~r   81 (283)
T TIGR03622         2 ALLLQFLDSFAFIVLAAVGLAVIFGMMGVINLAHGEFILVGAYGTTLTYHQAGLPLPVAMVSGVVMTVIFGIIVERLIIQ   81 (283)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             28999999999999999999999988570109999999999999999999970049999999999999999999889998


Q ss_pred             HH-HHH--HHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHH
Q ss_conf             21-345--777799988989999985554058767885776521121234764343433331001489999999999999
Q gi|254780896|r  117 FR-GDY--LAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFL  193 (351)
Q Consensus       117 l~-g~~--~~i~Tl~~~~i~~~~~~~~~~~~~g~~gi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  193 (351)
T Consensus        82 ~l~~~~~~~li~t~gl~~i~~~~~~~~----~g~~~~~-~~~p~------------~~~~~~~~~~~~~~~~~~~~~~~~  144 (283)
T TIGR03622        82 HLYDRLLDSMVATFGLALILTQGLRIT----FGNSLDS-ISTPF------------GNVAYGPYTYSTYRVFLPLVAIGV  144 (283)
T ss_pred             HHHHCHHHHHHHHHHHHHHHHHHHHHH----CCCCCCC-CCCCC------------CCCCCCCCCCHHHHHHHHHHHHHH
T ss_conf             860243999999999999999999996----1888756-78886------------544437612329999999999999


Q ss_pred             HHHHHHHHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCHHHHHHHHHHH
Q ss_conf             99999996130599999996421222334202322367999998799999999999866440113543158999988988
Q gi|254780896|r  194 SASIILWLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIV  273 (351)
Q Consensus       194 ~~~l~~~l~rT~~G~~lrAv~~n~~aA~~~Ginv~~~~~~af~is~~lAgiaG~l~a~~~~~v~p~~~~~~~~~~~~~~v  273 (351)
T Consensus       145 ~~~l~~~l~rT~~G~a~RAv~~n~~~A~~~GIn~~r~~~~~f~is~~lAg~aG~l~a~-~~~v~p~~-g~~~~~~~~~a~  222 (283)
T TIGR03622       145 LVGLYVLFTRTEFGVRARATIQDPETARAMGVDTDRMYVTTFAIGSGLAGLTGALYAP-IGAITPDR-GSIFLVEAFVAV  222 (283)
T ss_pred             HHHHHHHHHHCHHHHHHHHHHCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHH-HHCCCCCC-HHHHHHHHHHEE
T ss_conf             9999999986889898899965899997769787489999999999999999999987-50758661-489999986712


Q ss_pred             HHCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCCCCCCCH
Q ss_conf             7347422389999999999999999873122100001234442025899999999999998589965667402
Q gi|254780896|r  274 ILGGMTSLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLLRLRTPS  346 (351)
Q Consensus       274 vlGG~gs~~Ga~lGa~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~lilvll~rP~Gl~g~r~~~  346 (351)
T Consensus       223 ilGG~gs~~Gaiigg~ilg~~~~~~~~~~~~~~~-------------~~~~~~ili~vL~~rP~Gl~G~~e~~  282 (283)
T TIGR03622       223 VVGGPSVVLGTALAGGLLGFINAVFSNLYGTFVG-------------LIALLIVAIIALRVLPDGITGYIEQW  282 (283)
T ss_pred             EECCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHH-------------HHHHHHHHHHHHHHCCCCCCCCHHHC
T ss_conf             1478765589999999999999999999658999-------------99999999999998799857072113