HHsearch alignment for GI: 254780896 and conserved domain: cd06582

>cd06582 TM_PBP1_LivH_like Transmembrane subunit (TM) of Escherichia coli LivH and related proteins. LivH is one of two TMs of the E. coli LIV-1/LS transporter, a Periplasmic Binding Protein (PBP)-dependent ATP-Binding Cassette (ABC) transporter involved in the uptake of branched-chain amino acids (AAs). These types of transporters generally bind type 1 PBPs. PBP-dependent ABC transporters consist of a PBP, two TMs, and two cytoplasmic ABCs, and are mainly involved in importing solutes from the environment. The solute is captured by the PBP, which delivers it to a gated translocation pathway formed by the two TMs. The two ABCs bind and hydrolyze ATP and drive the transport reaction. E. coli LivH forms a heterodimer with another TM, LivM, to generate the transmembrane pore. LivM is not included in this subgroup. The LIV-1/LS transporter is comprised of two TMs (LivM and LivH), two ABCs (LivG and LivF), and one of two alternative PBPs, LivJ (LIV-BP) or LivK (LS-BP). In addition to transpo
Probab=100.00  E-value=0  Score=304.73  Aligned_cols=268  Identities=22%  Similarity=0.289  Sum_probs=210.4

Q ss_pred             HHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHHHHHHHHCCCCCCHHHHHHHHHHHHHHHHHHHHHHHHHH---HH
Q ss_conf             999999999999999999984322489999999999999997204565303653357889889876544445432---13
Q gi|254780896|r   43 GIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAIGAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKF---RG  119 (351)
Q Consensus        43 ~~~~~i~~l~alGl~li~G~~G~inl~~g~~~~~Gay~~~~l~~~~g~~~~~ai~~a~~~~a~~g~l~g~~~~rl---~g  119 (351)
T Consensus         2 L~~a~i~ai~Algl~l~~g~~G~i~lg~~~~~~lgay~~~~l~~~~g~~~~~~~~~a~~~~~~~g~~~g~~~~r~~~~~~   81 (272)
T cd06582           2 LALGAIYALIALGLTLIFGVTGVINFAHGEFYMLGAYVAYTLLVALGLPFWLALLLALLVAALLGVLLERLVLRPLRGAP   81 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHCCCCCHHHHHHHHHHHHHHHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH
T ss_conf             78999999999999999999198608999999999999999999837649999999999999999999999999996410


Q ss_pred             HHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHHHH
Q ss_conf             45777799988989999985554058767885776521121234764343433331001489999999999999999999
Q gi|254780896|r  120 DYLAIATLIMSEIFQNILIKWKPITNGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEIFMYYVLLGMCFLSASIIL  199 (351)
Q Consensus       120 ~~~~i~Tl~~~~i~~~~~~~~~~~~~g~~gi~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~  199 (351)
T Consensus        82 ~~~~~~t~~~~~~~~~~~~~~~~---~~~~~~~~~~~~-------~~~~~~-----~~~~~~~~~~~~~~~~~~~~~~~~  146 (272)
T cd06582          82 LLTLLITFGGLLILLQGLLLIFG---GDPRVPPPPLLS-------GSVELG-----GVTIPPYRLFIIAVALVLLAALYL  146 (272)
T ss_pred             HHHHHHHHHHHHHHHHHHHHHHC---CCCCCCCCCCCC-------CCHHCC-----CCCCCHHHHHHHHHHHHHHHHHHH
T ss_conf             79999999999999999999606---888777865332-------103316-----603418999999999999999999


Q ss_pred             HHHCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHEECCCCCCHHHHHHHHHHHHHCCCC
Q ss_conf             96130599999996421222334202322367999998799999999999866440113543158999988988734742
Q gi|254780896|r  200 WLRRTAISNAWRTIRDNQKAFFSLNTTIIFAKLSAFAVSSAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMT  279 (351)
Q Consensus       200 ~l~rT~~G~~lrAv~~n~~aA~~~Ginv~~~~~~af~is~~lAgiaG~l~a~~~~~v~p~~~~~~~~~~~~~~vvlGG~g  279 (351)
T Consensus       147 ~l~rT~~Gr~l~Ai~~n~~aA~~~Ginv~r~k~~af~isg~laglaG~l~a~~~~-~~~~~-~~~~~~~~i~~vvlGG~g  224 (272)
T cd06582         147 FLRRTRLGRAIRAVAQNPEAARLLGINVRRVFALTFALGAALAGLAGVLLAPITG-VSPTM-GLLLLLKAFAAVVLGGLG  224 (272)
T ss_pred             HHHHCCCCHHHHHHHCCHHHHHHCCCCHHHHHHHHHHHHHHHHHHHHHHHHHHHC-CCCCC-HHHHHHHHHHHEEECCCC
T ss_conf             9983950456847633989998859988898799989999999999999999865-79850-378998887820368988


Q ss_pred             CHHHHHHHHHHHHHHHHHHHHHHHHHHCCCCCCCCCCHHHHHHHHHHHHHHHHHHCCCCCC
Q ss_conf             2389999999999999999873122100001234442025899999999999998589965
Q gi|254780896|r  280 SLSKIAKATAILIGVVELCCGMNFYYFNSLLKFDCSFNMRHTTLMVIALFLVILMRSHSLL  340 (351)
Q Consensus       280 s~~Ga~lGa~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~lilvll~rP~Gl~  340 (351)
T Consensus       225 s~~G~v~Ga~~~~~l~~~~~~~~~-------------~~~~~~~~~~~li~vll~~P~Glf  272 (272)
T cd06582         225 SIPGAVVGGLLLGLAESLAAAYLS-------------SGYKDAVAFVLLILVLLVRPQGLF  272 (272)
T ss_pred             CHHHHHHHHHHHHHHHHHHHHHHH-------------HHHHHHHHHHHHHHHHHHCCCCCC
T ss_conf             569999999999999999998514-------------999999999999999997489999