RPSBLAST alignment for GI: 254780896 and conserved domain: TIGR03727

>gnl|CDD|163439 TIGR03727, urea_t_UrtC_arc, urea ABC transporter, permease protein UrtC, archaeal type. Members of this protein family are ABC transporter permease subunits restricted to the Archaea. Several lines of evidence suggest this protein is functionally analogous, as well as homologous, to the UrtC subunit of the Corynebacterium glutamicum urea transporter. All members of the operon show sequence similarity to urea transport subunits, the gene is located near the urease structural subunits in two of three species, and partial phylogenetic profiling identifies this permease subunit as closely matching the profile of urea utilization. Length = 364
 Score = 47.5 bits (113), Expect = 5e-06
 Identities = 67/293 (22%), Positives = 105/293 (35%), Gaps = 44/293 (15%)

Query: 17  LLAVVYPLLLFLFLGATKSQKYIDSMGIQILIYVMFAWGLSIVVGSLGLLSLNCVIAYAI 76
            L VVYPL+   +     S           L   +    LS+V G  G+LS   V  + I
Sbjct: 32  ALLVVYPLIRDSYAAGQFSL---------FLALALLGLSLSVVWGYTGILSFGQVAFFGI 82

Query: 77  GAYSYVILGSRYGLSIWLLIPVSAMISGACGMIMGLPSLKFRGD----YLAIATLIMSEI 132
            AY++ ++   +G +  +   +   I         L    F G     Y+ I TL+++ +
Sbjct: 83  AAYTFGVVSINFGTAGGITAALPVAIVVGTISAAILGYFMFYGGVRDVYVTIITLVVTLV 142

Query: 133 FQNILI-----KWKPIT------NGKAGIYVADRLYFLGTTVRSLIRFFRFPSSFVIYEI 181
            +  +      +W          NG   I        LG    S         SF   E 
Sbjct: 143 LETFMAQTAGSEWAIGEAKLGGFNGMPDI----PNLTLGVGGASF--------SFSGSE- 189

Query: 182 FMYYVLLGMCFLSASIILWLRRTAISNAWRT---IRDNQKAFFSLNTTIIFAKLSAFAVS 238
           F Y VL  + F      L LR    S    +   +R++++        +   KL  F   
Sbjct: 190 FYYLVLAVLVF----TYLGLRILVNSKYGYSMVAVREDEERTEMFGYNVKKIKLVVFTFG 245

Query: 239 SAFIGMAGAFFAASRDRISPDMFKFSENIIVISIVILGGMTSLSKIAKATAIL 291
            A  G++G F+A   + I P +F      + +  V LGG  SL     AT  +
Sbjct: 246 GALAGLSGVFYANWGNYIDPSVFTILFATLPVVWVSLGGRESLLGAIVATVAI 298