HHsearch results for GI: 254780897 and protein with PDBid: 2jwx_A

>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens}
Probab=97.64  E-value=5.6e-05  Score=56.81  Aligned_cols=84  Identities=13%  Similarity=0.160  Sum_probs=65.4

Q ss_pred             CCCCCEEEEEEEEEE-CCCCCCCCCCCCEEEEECCCCCCCCHHHHCCCCCCCCCCCCCCCCCCCCCCCCC------CCCC
Q ss_conf             221111344456664-265346665442036517866563103420688788754332344444441000------3873
Q gi|254780897|r  167 SEIGDKVTVDYTVSV-DNVILEDQSKKNVQFIVGSADLFSETTEILVGLKTGDQKEIERFFPEDHSIKDL------AGKK  239 (473)
Q Consensus       167 ~~~gD~v~id~~~~~-dg~~~~~~~~~~~~~~lg~~~~~~~f~~~liG~k~Gd~~~~~~~~P~d~~~~~l------aGk~  239 (473)
                      ...||.|+|+|.+.. ||..|..  ...+.|.+|.+.+++||+.+|.+|++|+...|.+..-.-|...-.      ++..
T Consensus        60 P~~gd~V~v~Y~~~l~DGt~~d~--~~p~~f~lG~~~vi~Gle~al~~Mk~Ge~~~v~ipp~laYG~~G~~~~~IPp~s~  137 (157)
T 2jwx_A           60 PVKGQVVTVHLQTSLENGTRVQE--EPELVFTLGDCDVIQALDLSVPLMDVGETAMVTADSKYCYGPQGSRSPYIPPHAA  137 (157)
T ss_dssp             CCTTEEEEEEEEEECTTSCEEEE--EEEEEEETTTTSSCHHHHHHTTTSCTTCEEEEEECGGGTTTTTCCSSSCCCTTCC
T ss_pred             CCCCCEEEEEEEEEECCCCEEEC--CCCEEEEECCCCCHHHHHHHHCCCCCCCCEEEEECHHHCCCCCCCCCCCCCCCCE
T ss_conf             89899999999999799999807--9997789148751378999858911899379988989982667888897296985


Q ss_pred             EEEEEEHHHHHCC
Q ss_conf             0467610110024
Q gi|254780897|r  240 VRLNFSIKEVFSP  252 (473)
Q Consensus       240 v~f~v~v~~I~~~  252 (473)
                      +.|.|++.++...
T Consensus       138 LifeVeLl~~~d~  150 (157)
T 2jwx_A          138 LCLEVTLKTAVDL  150 (157)
T ss_dssp             EEEEEEEEEEEEC
T ss_pred             EEEEEEEEEEECC
T ss_conf             9999999774963