RPS-BLAST 2.2.22 [Sep-27-2009] Database: CddB 21,608 sequences; 5,994,473 total letters Searching..................................................done Query= gi|254780898|ref|YP_003065311.1| hypothetical protein CLIBASIA_03975 [Candidatus Liberibacter asiaticus str. psy62] (207 letters) >gnl|CDD|178328 PLN02727, PLN02727, NAD kinase. Length = 986 Score = 43.0 bits (101), Expect = 6e-05 Identities = 26/142 (18%), Positives = 64/142 (45%), Gaps = 5/142 (3%) Query: 69 EYGIKSILNLRGK-LPESWHKEEEKAANDLG-IQLINFPLSATRELNDEQIKQLISILK- 125 E G K+I++LR + + +++++ A G I+++ P+ + EQ+++ S++ Sbjct: 279 EKGFKTIVDLRAEIVKDNFYQAAVDDAISSGKIEVVKIPVEVRTAPSAEQVEKFASLVSD 338 Query: 126 TAPKPLLIHCKSGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFE 185 ++ KP+ +H K G RT + + + + + + +T ++ T + Sbjct: 339 SSKKPIYLHSKEGVWRTSAMVSRWKQYMTRSAERLLGQNSVVNGNGKLDQETGSLQETND 398 Query: 186 KITQLYPNNVSKGDTEQPMNAT 207 K + N G++ + T Sbjct: 399 KDSS--SNGSESGESCSIKDET 418 >gnl|CDD|128492 smart00195, DSPc, Dual specificity phosphatase, catalytic domain. Length = 138 Score = 32.6 bits (75), Expect = 0.077 Identities = 19/107 (17%), Positives = 38/107 (35%), Gaps = 14/107 (13%) Query: 48 VPHEIYRSAQPNGTFIEYLKKEYGIKSILNLRGKLPESWHKEEEKAANDLGIQLINFPLS 107 + +Y + + + L K+ GI ++N+ E N G + P+ Sbjct: 4 ILPHLYLGSYSSALNLA-LLKKLGITHVINV---------TNEVPNLNKKGFTYLGVPIL 53 Query: 108 ATRELND----EQIKQLISILKTAPKPLLIHCKSGADRTGLASAVYL 150 E + + I + +L+HC++G R+ YL Sbjct: 54 DNTETKISPYFPEAVEFIEDAEKKGGKVLVHCQAGVSRSATLIIAYL 100 >gnl|CDD|165105 PHA02738, PHA02738, hypothetical protein; Provisional. Length = 320 Score = 31.8 bits (72), Expect = 0.13 Identities = 14/47 (29%), Positives = 24/47 (51%), Gaps = 5/47 (10%) Query: 100 QLINFPL---SATRELNDEQIKQLISILKTAPKPLLIHCKSGADRTG 143 + +NF L +EL E ++ I + P P+++HC +G RT Sbjct: 198 EFLNFVLEVRQCQKELAQESLQ--IGHNRLQPPPIVVHCNAGLGRTP 242 >gnl|CDD|180919 PRK07282, PRK07282, acetolactate synthase catalytic subunit; Reviewed. Length = 566 Score = 30.2 bits (68), Expect = 0.42 Identities = 13/33 (39%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Query: 102 INFP-LSATRELNDEQIKQLISILKTAPKPLLI 133 +N P T E ND QIK+++ L A KP+++ Sbjct: 184 VNLPSYQPTLEPNDMQIKKILKQLSKAKKPVIL 216 >gnl|CDD|128683 smart00404, PTPc_motif, Protein tyrosine phosphatase, catalytic domain motif. Length = 105 Score = 29.6 bits (67), Expect = 0.60 Identities = 8/24 (33%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Query: 129 KPLLIHCKSGADRTG-LASAVYLY 151 P+++HC +G RTG + L Sbjct: 40 GPVVVHCSAGVGRTGTFVALDILL 63 >gnl|CDD|128329 smart00012, PTPc_DSPc, Protein tyrosine phosphatase, catalytic domain, undefined specificity. Protein tyrosine phosphatases. Homologues detected by this profile and not by those of "PTPc" or "DSPc" are predicted to be protein phosphatases with a similar fold to DSPs and PTPs, yet with unpredicted specificities. Length = 105 Score = 29.6 bits (67), Expect = 0.60 Identities = 8/24 (33%), Positives = 13/24 (54%), Gaps = 1/24 (4%) Query: 129 KPLLIHCKSGADRTG-LASAVYLY 151 P+++HC +G RTG + L Sbjct: 40 GPVVVHCSAGVGRTGTFVALDILL 63 >gnl|CDD|128491 smart00194, PTPc, Protein tyrosine phosphatase, catalytic domain. Length = 258 Score = 29.5 bits (67), Expect = 0.60 Identities = 8/29 (27%), Positives = 17/29 (58%) Query: 115 EQIKQLISILKTAPKPLLIHCKSGADRTG 143 + ++ + T+ P+++HC +G RTG Sbjct: 180 DLVRAVRKSQSTSTGPIVVHCSAGVGRTG 208 >gnl|CDD|183984 PRK13340, PRK13340, alanine racemase; Reviewed. Length = 406 Score = 28.8 bits (65), Expect = 1.1 Identities = 22/69 (31%), Positives = 28/69 (40%), Gaps = 20/69 (28%) Query: 113 NDEQIKQLISILKTAPKPLLIHCK---SGADRTGL--------------ASAVYLYIVA- 154 +DEQ K L +I K KP+ IH G R GL A+ L IV Sbjct: 140 DDEQAKLLAAIAKKNGKPIDIHLALNSGGMSRNGLDMSTARGKWEALRIATLPSLGIVGI 199 Query: 155 --HYPKEEA 161 H+P E+ Sbjct: 200 MTHFPNEDE 208 >gnl|CDD|182692 PRK10744, pstB, phosphate transporter ATP-binding protein; Provisional. Length = 260 Score = 28.4 bits (64), Expect = 1.3 Identities = 16/58 (27%), Positives = 24/58 (41%), Gaps = 21/58 (36%) Query: 163 RQLSMLYGHFPVLKTITMDI---------------------TFEKITQLYPNNVSKGD 199 R L+ YG F LK I +DI TF ++ +LYP ++G+ Sbjct: 17 RNLNFYYGKFHALKNINLDIAKNQVTAFIGPSGCGKSTLLRTFNRMYELYPEQRAEGE 74 >gnl|CDD|184586 PRK14240, PRK14240, phosphate transporter ATP-binding protein; Provisional. Length = 250 Score = 28.5 bits (64), Expect = 1.4 Identities = 11/28 (39%), Positives = 16/28 (57%) Query: 163 RQLSMLYGHFPVLKTITMDITFEKITQL 190 + L + YG F LK I +DI ++T L Sbjct: 7 KDLDLFYGDFQALKKINLDIEENQVTAL 34 >gnl|CDD|161942 TIGR00587, nfo, apurinic endonuclease (APN1). All proteins in this family for which functions are known are 5' AP endonculeases that are used in base excision repair and the repair of abasic sites in DNA.This family is based on the phylogenomic analysis of JA Eisen (1999, Ph.D. Thesis, Stanford University). Length = 274 Score = 28.1 bits (63), Expect = 1.9 Identities = 14/43 (32%), Positives = 20/43 (46%), Gaps = 1/43 (2%) Query: 89 EEEKAANDLGIQLINFPLSATRELNDEQ-IKQLISILKTAPKP 130 EE K LGI L NF + + ++E+ + LI L K Sbjct: 92 EELKRCELLGIMLYNFHPGSALKCSEEEGLDNLIESLNVVIKE 134 >gnl|CDD|130311 TIGR01244, TIGR01244, conserved hypothetical protein TIGR01244. No member of this family is characterized. The member from Xylella fastidiosa is a longer protein with an N-terminal region described by this model, followed by a metallo-beta-lactamase family domain and an additional C-terminal region. Members scoring above the trusted cutoff are limited to the proteobacteria. Length = 135 Score = 27.6 bits (61), Expect = 2.5 Identities = 15/71 (21%), Positives = 35/71 (49%), Gaps = 4/71 (5%) Query: 71 GIKSILNLR--GKLPESWHKEE-EKAANDLGIQLINFPLSATRELNDEQIKQLISILKTA 127 G K+++N R + + + AA G+ + P++A ++ + ++ + + A Sbjct: 27 GFKTVINNRPDREEESQPDFAQIKAAAEAAGVTYHHQPVTA-GDITPDDVETFRAAIGAA 85 Query: 128 PKPLLIHCKSG 138 P+L +C+SG Sbjct: 86 EGPVLAYCRSG 96 >gnl|CDD|119193 pfam10673, DUF2487, Protein of unknown function (DUF2487). This is a bacterial family of uncharacterized proteins. Length = 143 Score = 27.7 bits (62), Expect = 2.5 Identities = 17/45 (37%), Positives = 27/45 (60%), Gaps = 4/45 (8%) Query: 84 ESWHKEEEKAANDL----GIQLINFPLSATRELNDEQIKQLISIL 124 SW +EEE+ DL I L + S R++ D+Q+KQL+++L Sbjct: 95 SSWKEEEEELEGDLFWLPAIPLEHMSDSLKRKIVDDQVKQLLNLL 139 >gnl|CDD|184109 PRK13520, PRK13520, L-tyrosine decarboxylase; Provisional. Length = 371 Score = 27.5 bits (62), Expect = 2.6 Identities = 14/41 (34%), Positives = 24/41 (58%) Query: 82 LPESWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLIS 122 +PES H +KAA+ LG++L PL ++ + ++ LI Sbjct: 109 VPESAHFSFDKAADMLGVELRRAPLDDDYRVDVKAVEDLID 149 >gnl|CDD|181124 PRK07803, sdhA, succinate dehydrogenase flavoprotein subunit; Reviewed. Length = 626 Score = 27.3 bits (61), Expect = 2.6 Identities = 16/38 (42%), Positives = 20/38 (52%), Gaps = 2/38 (5%) Query: 148 VYLYIVAHYPKEEAHRQLSMLYGHFPVLKTITMDITFE 185 VYL I + P EE R+L +Y F L + DIT E Sbjct: 344 VYLDIASRLPAEEIKRRLPSMYHQFKELADV--DITKE 379 >gnl|CDD|130045 TIGR00972, 3a0107s01c2, phosphate ABC transporter, ATP-binding protein. This model represents the ATP-binding protein of a family of ABC transporters for inorganic phosphate. In the model species Escherichia coli, a constitutive transporter for inorganic phosphate, with low affinity, is also present. The high affinity transporter that includes this polypeptide is induced when extracellular phosphate concentrations are low. The proteins most similar to the members of this family but not included appear to be amino acid transporters. Length = 247 Score = 27.6 bits (62), Expect = 2.6 Identities = 10/28 (35%), Positives = 15/28 (53%) Query: 163 RQLSMLYGHFPVLKTITMDITFEKITQL 190 L++ YG LK I +DI ++T L Sbjct: 5 ENLNLFYGEKEALKNINLDIPKNQVTAL 32 >gnl|CDD|185330 PRK15432, PRK15432, autoinducer 2 ABC transporter permease LsrC; Provisional. Length = 344 Score = 27.0 bits (60), Expect = 3.2 Identities = 8/28 (28%), Positives = 14/28 (50%) Query: 20 LGVLVLCAVSLGLYFLTITTFTQNFHAV 47 +G L L + + L T F ++F+A Sbjct: 162 IGWLTLILILAMAWLLAKTAFGRSFYAT 189 >gnl|CDD|177772 PLN00177, PLN00177, sulfite oxidase; Provisional. Length = 393 Score = 27.1 bits (60), Expect = 3.4 Identities = 10/17 (58%), Positives = 13/17 (76%) Query: 72 IKSILNLRGKLPESWHK 88 ++SI NLRG L SWH+ Sbjct: 367 VESIWNLRGILNTSWHR 383 >gnl|CDD|161992 TIGR00676, fadh2, 5,10-methylenetetrahydrofolate reductase, prokaryotic form. This protein is an FAD-containing flavoprotein. Length = 272 Score = 27.2 bits (61), Expect = 3.5 Identities = 14/47 (29%), Positives = 22/47 (46%), Gaps = 7/47 (14%) Query: 63 IEYLKKEY---GIKSILNLRGKLPESWHKEEEKA---ANDLGIQLIN 103 I + +EY GI+ IL LRG P+ A++L ++ I Sbjct: 75 IREILREYRELGIRHILALRGDPPKGEGTPTPGGFNYASEL-VEFIR 120 >gnl|CDD|129583 TIGR00492, alr, alanine racemase. This enzyme interconverts L-alanine and D-alanine. Its primary function is to generate D-alanine for cell wall formation. With D-alanine-D-alanine ligase, it makes up the D-alanine branch of the peptidoglycan biosynthetic route. It is a monomer with one pyridoxal phosphate per subunit. In E. coli, the ortholog is duplicated so that a second isozyme, DadX, is present. DadX, a paralog of the biosynthetic Alr, is induced by D- or L-alanine and is involved in catabolism. Length = 367 Score = 26.9 bits (60), Expect = 3.9 Identities = 20/83 (24%), Positives = 33/83 (39%), Gaps = 5/83 (6%) Query: 113 NDEQIKQLISILKTAPKPLLIHCK--SGADRTGLASAVYLYIVAHYPKEEAHRQLSMLYG 170 + EQ++ L L PK L +H K +G +R G+ V + + +L ++ Sbjct: 102 SVEQLQALEEALLKEPKRLKVHLKIDTGMNRLGVKPDEAALFVQKLRQLKKFLELEGIFS 161 Query: 171 HFPV---LKTITMDITFEKITQL 190 HF KT T E+ Sbjct: 162 HFATADEPKTGTTQKQIERFNSF 184 >gnl|CDD|151053 pfam10493, Rod_C, Rough deal protein C-terminal region. Rod, the Rough deal protein, displays a dynamic intracellular staining pattern, localising first to kinetochores in pro-metaphase, but moving to kinetochore microtubules at metaphase. Early in anaphase the protein is once again restricted to the kinetochores, where it persists until the end of telophase. This behaviour is in all respects similar to that described for ZW10, and indeed the two proteins function together, localisation of each depending upon the other. These two proteins are found at the kinetochore in complex with a third, Zwilch, in both flies and humans. The C-terminus is the most conserved part of the protein. During pro-metaphase, the ZW10-Rod complex, dynein/dynactin, and Mad2 all accumulate on unattached kinetochores; microtubule capture leads to Mad2 depletion as it is carried off by dynein/dynactin; ZW10-Rod complex accumulation continues, replenishing kinetochore dynein. The continuing recruitment of the ZW10-Rod complex during metaphase may serve to maintain adequate dynein/dynactin complex on kinetochores for assisting chromatid movement during anaphase. The ZW10-Rod complex acts as a bridge whose association with Zwint-1 links Mad1 and Mad2, components that are directly responsible for generating the diffusible 'wait anaphase' signal, to a structural, inner kinetochore complex containing Mis12 and KNL-1AF15q14, the last of which has been proved to be essential for kinetochore assembly in C. elegans. Removal of ZW10 or Rod inactivates the mitotic checkpoint. Length = 555 Score = 26.7 bits (59), Expect = 4.2 Identities = 27/143 (18%), Positives = 46/143 (32%), Gaps = 25/143 (17%) Query: 64 EYLKKEYGIKSILNLRGKLPE-----SWHKEEEKAANDLGIQLINFPLSATRELNDEQIK 118 +Y SI + +L E SWH + + A I L +++ + Sbjct: 59 DYFCMSAVKNSIKEYKPQLLEKAPAESWHLQPKNNAFLQSI------LRYVDSVSNPEWA 112 Query: 119 QLISILKTAPKPLLIHCKSGADRTGLASAVYLYIVAHY----PKEEAHRQLSMLYGHFPV 174 I T P GAD+ + EA ++ + +P+ Sbjct: 113 LAILYYITNEAP------DGADQVEALYFCLKFAEKWKKNLSGDPEAREKIEKIKRKYPI 166 Query: 175 LKT----ITMDITFEKITQLYPN 193 KT I + EK+ +L N Sbjct: 167 SKTQHLLIQYGLNDEKLLRLIGN 189 >gnl|CDD|180207 PRK05696, fliL, flagellar basal body-associated protein FliL; Reviewed. Length = 170 Score = 26.8 bits (60), Expect = 4.5 Identities = 9/30 (30%), Positives = 15/30 (50%), Gaps = 3/30 (10%) Query: 6 KPRKNLLIFYIKILLGVLVLCAVSLGLYFL 35 K +K L+I I++GVL+ +F Sbjct: 15 KSKKKLIII---IVIGVLLALGGGGAAWFF 41 >gnl|CDD|131767 TIGR02720, pyruv_oxi_spxB, pyruvate oxidase. Members of this family are examples of pyruvate oxidase (EC 1.2.3.3), an enzyme with FAD and TPP as cofactors that catalyzes the reaction pyruvate + phosphate + O2 + H2O = acetyl phosphate + CO2 + H2O2. It should not be confused with pyruvate dehydrogenase [cytochrome] (EC 1.2.2.2) as in E. coli PoxB, although the E. coli enzyme is closely homologous and has pyruvate oxidase as an alternate name. Length = 575 Score = 26.7 bits (59), Expect = 4.5 Identities = 11/67 (16%), Positives = 27/67 (40%), Gaps = 11/67 (16%) Query: 100 QLINFPLSATRELNDEQIKQLISILKTAPKPLLIHC-----KSGADRTGLASAVYLYIVA 154 Q P + E + + + LK A +P +I+ K+G + L+ + + +++ Sbjct: 178 QTPLLP-----APDVEAVTRAVQTLKAAERP-VIYYGIGARKAGEELEALSEKLKIPLIS 231 Query: 155 HYPKEEA 161 + Sbjct: 232 TGLAKGI 238 >gnl|CDD|180540 PRK06354, PRK06354, pyruvate kinase; Provisional. Length = 590 Score = 26.4 bits (59), Expect = 5.7 Identities = 13/36 (36%), Positives = 20/36 (55%), Gaps = 2/36 (5%) Query: 152 IVAHYPKEEAHRQLSMLYGHFP--VLKTITMDITFE 185 I+A P E R+L +++G P VL + D TF+ Sbjct: 403 ILAVTPNESVARRLQLVWGVTPLLVLDAPSTDETFD 438 >gnl|CDD|165114 PHA02747, PHA02747, protein tyrosine phosphatase; Provisional. Length = 312 Score = 26.1 bits (57), Expect = 6.2 Identities = 8/19 (42%), Positives = 13/19 (68%) Query: 130 PLLIHCKSGADRTGLASAV 148 P+++HC G +TG+ AV Sbjct: 231 PIVVHCSDGVGKTGIFCAV 249 >gnl|CDD|181458 PRK08527, PRK08527, acetolactate synthase 3 catalytic subunit; Validated. Length = 563 Score = 25.8 bits (57), Expect = 7.2 Identities = 9/20 (45%), Positives = 11/20 (55%) Query: 113 NDEQIKQLISILKTAPKPLL 132 N QIK+ +K A KPL Sbjct: 189 NSRQIKKAAEAIKEAKKPLF 208 >gnl|CDD|183473 PRK12361, PRK12361, hypothetical protein; Provisional. Length = 547 Score = 26.1 bits (58), Expect = 7.2 Identities = 25/92 (27%), Positives = 39/92 (42%), Gaps = 11/92 (11%) Query: 63 IEYLKKEYGIKSILNLRGKLPE-SWHKEEEKAANDLGIQLINFPLSATRELNDEQIKQLI 121 +E LK I +IL++ + W EE I +N P+ Q+ Q I Sbjct: 113 LEKLKSN-KITAILDVTAEFDGLDWSLTEED------IDYLNIPILDHSVPTLAQLNQAI 165 Query: 122 SILKT---APKPLLIHCKSGADRTGLASAVYL 150 + + A K +++HC G R+ L A YL Sbjct: 166 NWIHRQVRANKSVVVHCALGRGRSVLVLAAYL 197 >gnl|CDD|172386 PRK13865, PRK13865, type IV secretion system protein VirB8; Provisional. Length = 229 Score = 26.0 bits (57), Expect = 7.5 Identities = 9/29 (31%), Positives = 17/29 (58%) Query: 162 HRQLSMLYGHFPVLKTITMDITFEKITQL 190 +++ + G PV+ T T + +EK+T L Sbjct: 177 YKRTLTMDGKMPVVSTWTATVRYEKVTSL 205 >gnl|CDD|185417 PTZ00053, PTZ00053, methionine aminopeptidase 2; Provisional. Length = 470 Score = 25.8 bits (57), Expect = 8.5 Identities = 10/18 (55%), Positives = 11/18 (61%) Query: 63 IEYLKKEYGIKSILNLRG 80 +E K Y IKSI NL G Sbjct: 305 VEIKGKTYPIKSIRNLNG 322 Database: CddB Posted date: Feb 4, 2011 9:54 PM Number of letters in database: 5,994,473 Number of sequences in database: 21,608 Lambda K H 0.321 0.138 0.399 Gapped Lambda K H 0.267 0.0710 0.140 Matrix: BLOSUM62 Gap Penalties: Existence: 11, Extension: 1 Number of Sequences: 21608 Number of Hits to DB: 3,298,589 Number of extensions: 201612 Number of successful extensions: 606 Number of sequences better than 10.0: 1 Number of HSP's gapped: 605 Number of HSP's successfully gapped: 46 Length of query: 207 Length of database: 5,994,473 Length adjustment: 89 Effective length of query: 118 Effective length of database: 4,071,361 Effective search space: 480420598 Effective search space used: 480420598 Neighboring words threshold: 11 Window for multiple hits: 40 X1: 16 ( 7.4 bits) X2: 38 (14.6 bits) X3: 64 (24.7 bits) S1: 41 (21.8 bits) S2: 55 (25.0 bits)