>cd04926 ACT_ACR_4 C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). This CD includes the C-terminal ACT domain, of a novel type of ACT domain-containing protein which is composed almost entirely of four ACT domain repeats (the "ACR" protein). ACR proteins, found only in Arabidopsis and Oryza, as yet, are proposed to function as novel regulatory or sensor proteins in plants. Nine ACR gene products have been described (ACR1-8 in Arabidopsis and OsARC1-9 in Oryza) and are represented in this CD. Members of this CD belong to the superfamily of ACT regulatory domains.

Probab=95.57 E-value=0.045 Score=34.54 Aligned_cols=51 Identities=14% Similarity=0.267 Sum_probs=37.6 Q ss_pred EEEEECCCCCHHHHHHHHHHHCCCCEEEEEECCCCCCCCEEEEEEEEEECCHH Q ss_conf 99992488874899999988669957888822677877613599992104889 Q gi|254780900|r 356 IRLTIRNFEGILDKITSQMSDFNISLRLFSCPHQEENSQEFSVFMITHKVSGK 408 (438) Q Consensus 356 LRl~v~DkpGVLa~It~ilak~~ISIesi~Q~~~~~~~~~~~IViiTh~~~e~ 408 (438) T Consensus 4 lEv~~~DRpGLL~~itr~l~e~gL~I~~A~IsT--~Gera~DvFYVtD~~G~~ 54 (72) T cd04926 4 LELRTEDRVGLLSDVTRVFRENGLTVTRAEIST--QGDMAVNVFYVTDANGNP 54 (72) T ss_pred EEEEECCCCCHHHHHHHHHHHCCCEEEEEEEEE--CCCEEEEEEEEECCCCCC T ss_conf 999869968689999999998791588999960--498898999998999899

HHsearch alignment for GI: 254780900 and conserved domain: cd04926